Citrus Sinensis ID: 022126
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| 224118990 | 301 | predicted protein [Populus trichocarpa] | 0.986 | 0.990 | 0.839 | 1e-150 | |
| 225461800 | 301 | PREDICTED: uncharacterized protein LOC10 | 0.986 | 0.990 | 0.848 | 1e-149 | |
| 356556629 | 304 | PREDICTED: uncharacterized protein LOC10 | 0.996 | 0.990 | 0.822 | 1e-146 | |
| 356530649 | 304 | PREDICTED: uncharacterized protein LOC10 | 0.996 | 0.990 | 0.812 | 1e-145 | |
| 449438901 | 304 | PREDICTED: uncharacterized protein LOC10 | 0.996 | 0.990 | 0.809 | 1e-144 | |
| 145336703 | 304 | RING/U-box domain-containing protein [Ar | 0.986 | 0.980 | 0.795 | 1e-142 | |
| 297847746 | 303 | predicted protein [Arabidopsis lyrata su | 0.983 | 0.980 | 0.791 | 1e-138 | |
| 386302981 | 304 | HEI10 [Oryza sativa Japonica Group] | 0.993 | 0.986 | 0.732 | 1e-127 | |
| 222622480 | 336 | hypothetical protein OsJ_05990 [Oryza sa | 0.990 | 0.889 | 0.731 | 1e-127 | |
| 115445183 | 303 | Os02g0232100 [Oryza sativa Japonica Grou | 0.990 | 0.986 | 0.731 | 1e-127 |
| >gi|224118990|ref|XP_002331298.1| predicted protein [Populus trichocarpa] gi|222873881|gb|EEF11012.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 538 bits (1386), Expect = e-150, Method: Compositional matrix adjust.
Identities = 256/305 (83%), Positives = 280/305 (91%), Gaps = 7/305 (2%)
Query: 1 MRCNACWRELEGRAISTTCGHLLCTEDANKILSNDAACPICDQVLSKSLMKPVDINPNDE 60
MRCN+CWRELEGRA+STTCG TEDANKIL+NDAACPICDQVLSKSLMKPV+INPNDE
Sbjct: 1 MRCNSCWRELEGRAVSTTCG----TEDANKILNNDAACPICDQVLSKSLMKPVEINPNDE 56
Query: 61 WVNMAMAGVSPQILMKSAYRSVMFYLGQKELEMQYKMNRIVAQCRQKCEAMQEKFTEKLE 120
W+NMAMAG+SPQILMKSAYRSVMF+ GQ+ELEMQYKMNRIVAQCRQKCE+MQEKFTEKLE
Sbjct: 57 WINMAMAGISPQILMKSAYRSVMFFTGQRELEMQYKMNRIVAQCRQKCESMQEKFTEKLE 116
Query: 121 QVHTAYQKMAKRCQMMEQEIESLSKDKQELQEKFSEKSRQKRKLDEMYDQLRSEYESMKR 180
Q+H AYQKMAKRCQMMEQEIESLSKDKQELQEKFSEK+RQKRKLDEMYDQLRSEYES KR
Sbjct: 117 QLHAAYQKMAKRCQMMEQEIESLSKDKQELQEKFSEKARQKRKLDEMYDQLRSEYESNKR 176
Query: 181 SAIQPSNSFYPRNDPDLFS---ANMMDNRDPIRKDWSVYSPGTPGPREDIWPARQNSSNS 237
SAIQP+N+F+ RN+PDLFS A MMDNRDPIRKDW+V++P TPGPREDIWPARQNSSNS
Sbjct: 177 SAIQPANNFFSRNEPDLFSNPAATMMDNRDPIRKDWTVFTPSTPGPREDIWPARQNSSNS 236
Query: 238 GPFDIATGSPAKQPVIPVDGGNRRADARPAFGGGAANPSMTLRNLILSPIKRPQLSRNRT 297
GPF+I GSPA Q +PVD GNRR A P+FG G+ NPSMTLRNLILSPIKRPQLSR+R
Sbjct: 237 GPFEIRGGSPANQAAMPVDVGNRRIGAVPSFGAGSGNPSMTLRNLILSPIKRPQLSRSRP 296
Query: 298 QIFTL 302
Q+FTL
Sbjct: 297 QMFTL 301
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225461800|ref|XP_002285631.1| PREDICTED: uncharacterized protein LOC100243485 [Vitis vinifera] gi|302142815|emb|CBI20110.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356556629|ref|XP_003546626.1| PREDICTED: uncharacterized protein LOC100783938 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356530649|ref|XP_003533893.1| PREDICTED: uncharacterized protein LOC100810502 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449438901|ref|XP_004137226.1| PREDICTED: uncharacterized protein LOC101209267 [Cucumis sativus] gi|449483181|ref|XP_004156515.1| PREDICTED: uncharacterized protein LOC101230782 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145336703|ref|NP_175754.2| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|332194827|gb|AEE32948.1| RING/U-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297847746|ref|XP_002891754.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297337596|gb|EFH68013.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|386302981|gb|AFJ04809.1| HEI10 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|222622480|gb|EEE56612.1| hypothetical protein OsJ_05990 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|115445183|ref|NP_001046371.1| Os02g0232100 [Oryza sativa Japonica Group] gi|50251774|dbj|BAD27706.1| putative bZIP protein [Oryza sativa Japonica Group] gi|113535902|dbj|BAF08285.1| Os02g0232100 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 302 | ||||||
| TAIR|locus:2024917 | 304 | HEI10 "AT1G53490" [Arabidopsis | 0.986 | 0.980 | 0.795 | 1.9e-131 | |
| DICTYBASE|DDB_G0269498 | 350 | DDB_G0269498 "RING zinc finger | 0.602 | 0.52 | 0.286 | 3.6e-19 | |
| RGD|1561930 | 276 | Ccnb1ip1 "cyclin B1 interactin | 0.649 | 0.710 | 0.258 | 5.3e-17 | |
| UNIPROTKB|Q2YDD5 | 277 | CCNB1IP1 "Uncharacterized prot | 0.596 | 0.649 | 0.264 | 8.6e-17 | |
| UNIPROTKB|Q9NPC3 | 277 | CCNB1IP1 "E3 ubiquitin-protein | 0.549 | 0.599 | 0.271 | 1.4e-16 | |
| UNIPROTKB|F1S8F8 | 277 | CCNB1IP1 "Uncharacterized prot | 0.549 | 0.599 | 0.271 | 1.4e-16 | |
| UNIPROTKB|E2RHZ9 | 336 | CCNB1IP1 "Uncharacterized prot | 0.596 | 0.535 | 0.269 | 3.6e-16 | |
| UNIPROTKB|G3V5S3 | 154 | CCNB1IP1 "E3 ubiquitin-protein | 0.447 | 0.876 | 0.246 | 1.3e-09 | |
| UNIPROTKB|E1BV34 | 582 | Gga.3145 "Uncharacterized prot | 0.403 | 0.209 | 0.259 | 0.00069 |
| TAIR|locus:2024917 HEI10 "AT1G53490" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1289 (458.8 bits), Expect = 1.9e-131, P = 1.9e-131
Identities = 245/308 (79%), Positives = 275/308 (89%)
Query: 1 MRCNACWRELEGRAISTTCGHLLCTEDANKILSNDAACPICDQVLSKSLMKPVDINPNDE 60
MRCNACWR+LEGRAISTTCGHLLCTEDA+KILSND ACPICDQVLSKSLMKPVDINPN+E
Sbjct: 1 MRCNACWRDLEGRAISTTCGHLLCTEDASKILSNDGACPICDQVLSKSLMKPVDINPNEE 60
Query: 61 WVNMAMAGVSPQILMKSAYRSVMFYLGQKELEMQYKMNRIVAQCRQKCEAMQEKFTEKLE 120
W+NMAMAG+SPQILMKSAYRSVMFY+ Q++LEMQYKMNR+VAQCRQKCE MQ KF+EK+E
Sbjct: 61 WINMAMAGISPQILMKSAYRSVMFYIAQRDLEMQYKMNRVVAQCRQKCEGMQAKFSEKME 120
Query: 121 QVHTAYQKMAKRCQMMEQEIESLSKDKQELQEKFSEKSRQKRKLDEMYDQLRSEYESMKR 180
QVHTAYQKM KRCQMMEQE+E+L+KDKQELQEKFSEKSRQKRKLDEMYDQLRSEYES+KR
Sbjct: 121 QVHTAYQKMGKRCQMMEQEVENLTKDKQELQEKFSEKSRQKRKLDEMYDQLRSEYESVKR 180
Query: 181 SAIQPSNSFYPRN-DPDLFS---ANMMDNRDPIRKDWSVYSPGTPGPREDIWPARQNSSN 236
+AIQP+N+FYPR+ +PD FS NMM+NR+ IRKD S +SP TPGP+++IWPARQNSSN
Sbjct: 181 TAIQPANNFYPRHQEPDFFSNPAVNMMENRETIRKDRSFFSPATPGPKDEIWPARQNSSN 240
Query: 237 SGPFDIATGSPAKQPVIPVDGGNRRAD-ARPAFGGGA-ANPSMTLRNLILSPIKRPQLSR 294
SGPFDI+T SPA IP D GNRRA P +GGG ANP TLRNLILSPIKR QLSR
Sbjct: 241 SGPFDISTDSPA----IPSDLGNRRAGRGHPVYGGGGTANPQSTLRNLILSPIKRSQLSR 296
Query: 295 NRTQIFTL 302
+R Q+FTL
Sbjct: 297 SRPQLFTL 304
|
|
| DICTYBASE|DDB_G0269498 DDB_G0269498 "RING zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| RGD|1561930 Ccnb1ip1 "cyclin B1 interacting protein 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2YDD5 CCNB1IP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NPC3 CCNB1IP1 "E3 ubiquitin-protein ligase CCNB1IP1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8F8 CCNB1IP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RHZ9 CCNB1IP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V5S3 CCNB1IP1 "E3 ubiquitin-protein ligase CCNB1IP1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BV34 Gga.3145 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.01680006 | hypothetical protein (301 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-06 | |
| pfam10158 | 131 | pfam10158, LOH1CR12, Tumour suppressor protein | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-04 | |
| cd07657 | 237 | cd07657, F-BAR_Fes_Fer, The F-BAR (FES-CIP4 Homolo | 0.002 | |
| pfam04111 | 356 | pfam04111, APG6, Autophagy protein Apg6 | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Score = 43.6 bits (103), Expect = 2e-06
Identities = 14/41 (34%), Positives = 18/41 (43%)
Query: 3 CNACWRELEGRAISTTCGHLLCTEDANKILSNDAACPICDQ 43
C C L + T CGH+ C E + L + CPIC
Sbjct: 5 CPICLDLLRDPVVLTPCGHVFCRECILRYLKKKSKCPICRT 45
|
Length = 45 |
| >gnl|CDD|118686 pfam10158, LOH1CR12, Tumour suppressor protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|153341 cd07657, F-BAR_Fes_Fer, The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 99.3 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.15 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.08 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.07 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.06 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.94 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.91 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.9 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.83 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.69 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.68 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.67 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.62 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.6 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.55 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.52 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.46 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.43 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.4 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.3 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 98.28 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 98.12 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 98.12 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 98.09 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.08 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.07 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.03 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.84 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.58 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.57 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.56 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.54 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.51 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.4 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.34 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.22 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.16 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 97.13 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.05 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.9 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.89 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 96.83 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.81 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.78 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.75 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.65 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.61 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 96.6 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 96.44 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.25 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 96.2 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 96.0 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.93 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 95.59 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.38 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 95.37 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.35 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 95.31 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 95.3 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.28 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.25 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 95.24 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.21 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 95.11 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.1 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 95.05 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 94.99 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.86 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 94.51 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 94.3 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 94.12 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 93.96 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 93.79 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.49 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 93.49 | |
| PF04899 | 70 | MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th | 93.42 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 93.2 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 93.18 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 93.03 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 92.73 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 92.71 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 92.66 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 92.62 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 92.58 | |
| KOG4001 | 259 | consensus Axonemal dynein light chain [Cytoskeleto | 92.51 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.38 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 92.37 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 92.36 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.02 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 92.0 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 91.91 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 91.91 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 91.87 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 91.65 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 91.59 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 91.52 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 91.41 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 91.38 | |
| PRK10780 | 165 | periplasmic chaperone; Provisional | 91.34 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.33 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 91.29 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 91.09 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.08 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 91.04 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 90.96 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 90.89 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 90.89 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 90.75 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 90.75 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 90.64 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 90.63 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 90.58 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 90.53 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 90.39 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 90.11 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 90.0 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 89.91 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.85 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 89.85 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 89.81 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 89.68 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 89.64 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 89.57 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 89.56 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 89.48 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 89.44 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 89.37 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 89.35 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 89.33 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 89.28 | |
| PHA03096 | 284 | p28-like protein; Provisional | 89.17 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 88.95 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 88.82 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 88.8 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 88.77 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 88.69 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 88.63 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 88.51 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 88.46 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 88.45 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 88.19 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 88.05 | |
| PF03938 | 158 | OmpH: Outer membrane protein (OmpH-like); InterPro | 87.98 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 87.73 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 87.54 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 87.42 | |
| KOG3859 | 406 | consensus Septins (P-loop GTPases) [Cell cycle con | 87.38 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 87.35 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 87.35 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 87.33 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 87.3 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 87.24 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 87.17 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 87.02 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 87.02 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 87.0 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 86.94 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 86.9 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 86.88 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 86.86 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 86.84 | |
| PF10205 | 102 | KLRAQ: Predicted coiled-coil domain-containing pro | 86.83 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 86.78 | |
| PRK09039 | 343 | hypothetical protein; Validated | 86.7 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 86.52 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 86.45 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 86.44 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 86.43 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 86.35 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 86.26 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 86.24 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 86.11 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 86.03 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 86.01 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 85.96 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 85.8 | |
| PF10392 | 132 | COG5: Golgi transport complex subunit 5; InterPro: | 85.73 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 85.69 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 85.61 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 85.6 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 85.45 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 85.19 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 85.18 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 85.16 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 85.01 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 84.96 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 84.93 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 84.84 | |
| PRK11546 | 143 | zraP zinc resistance protein; Provisional | 84.71 | |
| PF10158 | 131 | LOH1CR12: Tumour suppressor protein; InterPro: IPR | 84.7 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 84.62 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 84.53 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 84.47 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 84.46 | |
| PF13942 | 179 | Lipoprotein_20: YfhG lipoprotein | 84.44 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 84.37 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 84.33 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 84.3 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 84.16 | |
| PHA01750 | 75 | hypothetical protein | 83.72 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 83.63 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 83.63 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 83.6 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 83.52 | |
| PRK10920 | 390 | putative uroporphyrinogen III C-methyltransferase; | 83.52 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 83.34 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 83.34 | |
| PF07544 | 83 | Med9: RNA polymerase II transcription mediator com | 83.33 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 83.31 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 83.25 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 83.23 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 83.21 | |
| COG2900 | 72 | SlyX Uncharacterized protein conserved in bacteria | 83.21 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 83.11 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 82.98 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 82.89 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 82.82 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 82.8 | |
| KOG4466 | 291 | consensus Component of histone deacetylase complex | 82.68 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 82.66 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 82.65 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 82.6 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 82.48 | |
| KOG4848 | 225 | consensus Extracellular matrix-associated peroxida | 82.47 | |
| KOG4657 | 246 | consensus Uncharacterized conserved protein [Funct | 82.45 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 82.38 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 82.38 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 82.24 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 82.11 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 81.93 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 81.82 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 81.71 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 81.67 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 81.63 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 81.62 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 81.47 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 81.26 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 81.18 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 81.14 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 81.05 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 81.04 | |
| KOG0709 | 472 | consensus CREB/ATF family transcription factor [Tr | 81.03 | |
| PRK09039 | 343 | hypothetical protein; Validated | 80.99 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 80.93 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 80.54 | |
| PF06632 | 342 | XRCC4: DNA double-strand break repair and V(D)J re | 80.47 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 80.4 | |
| PF12240 | 205 | Angiomotin_C: Angiomotin C terminal; InterPro: IPR | 80.33 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 80.21 | |
| cd07656 | 241 | F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/A | 80.17 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 80.13 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 80.1 | |
| KOG0289 | 506 | consensus mRNA splicing factor [General function p | 80.06 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 80.06 |
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
Probab=99.30 E-value=7.4e-11 Score=108.64 Aligned_cols=148 Identities=18% Similarity=0.325 Sum_probs=83.5
Q ss_pred CccccCccccc-CCcEEecCCccccHHHHHhhhcCCCCCCCCccccccCCCcccccCCChHHHHHHhcCCChHHHHHHHH
Q 022126 1 MRCNACWRELE-GRAISTTCGHLLCTEDANKILSNDAACPICDQVLSKSLMKPVDINPNDEWVNMAMAGVSPQILMKSAY 79 (302)
Q Consensus 1 l~CNiC~~~l~-~~~vvT~CGHiFC~~Ci~~~~~~~~~CPvC~~~l~~~div~~~LnPse~~Kt~vL~GlsP~~Ime~a~ 79 (302)
.+||.|+..-. +..++|.|+||||..|.... ....||.|++++.. +.|+++-..-...+++..|..|-++..
T Consensus 4 VhCn~C~~~~~~~~f~LTaC~HvfC~~C~k~~--~~~~C~lCkk~ir~-----i~l~~slp~~ik~~F~d~~~~~~~~~~ 76 (233)
T KOG4739|consen 4 VHCNKCFRFPSQDPFFLTACRHVFCEPCLKAS--SPDVCPLCKKSIRI-----IQLNRSLPTDIKSYFADPPRLIQDLYR 76 (233)
T ss_pred EEeccccccCCCCceeeeechhhhhhhhcccC--Cccccccccceeee-----eecccccchhHHHHccCcHHHHHHHHH
Confidence 48999997654 46789999999999997664 23499999998543 233333221224567767765555544
Q ss_pred ---HhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHH
Q 022126 80 ---RSVMFYLGQKELEMQYKMNRIVAQCRQKCEAMQEKFTEKLEQVHTAYQKMAKRCQMMEQEIESLSKDKQELQEKFSE 156 (302)
Q Consensus 80 ---RAi~Fw~~Q~~qe~~yQ~~~l~~~lreK~e~L~~~l~~ki~e~~s~~~kl~~kl~~me~E~e~LrKkn~ELq~ky~E 156 (302)
+.++|+..|..+...++. +++. +-....+.+.+|..+.+.++.+ ++..+++...+|+.
T Consensus 77 ~l~r~i~fq~~qr~~~~~~~~----~~~~-~~req~~~~~~K~~e~~~ql~k--------------e~a~~~~nrk~~~~ 137 (233)
T KOG4739|consen 77 KLQRVINFQHKQRNLQVKLEL----KQLE-KDREQTAYFEKKTQEETQQLSK--------------EEAFIENNRKKLQA 137 (233)
T ss_pred HHHHHHhhHHHHHHHHHHHHH----HHHH-HHHHHHHHHHHHHHHHHHHHHH--------------HHHHHHHHHHHHHH
Confidence 455555555543333321 1111 1122333444444444443332 34444555556666
Q ss_pred HHHHHHHHHHHHHHHHHH
Q 022126 157 KSRQKRKLDEMYDQLRSE 174 (302)
Q Consensus 157 KsRq~~qLqelYdkLK~~ 174 (302)
..++.++++.+...+...
T Consensus 138 ~E~~nrka~~~~~~~e~~ 155 (233)
T KOG4739|consen 138 SELENRKAERLISALELK 155 (233)
T ss_pred HHHHHHHHHhchhhhhhc
Confidence 667777777666554433
|
|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG4001 consensus Axonemal dynein light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK10780 periplasmic chaperone; Provisional | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03938 OmpH: Outer membrane protein (OmpH-like); InterPro: IPR005632 This entry includes outer membrane proteins such as OmpH (Skp) among others | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF10392 COG5: Golgi transport complex subunit 5; InterPro: IPR019465 The conserved oligomeric Golgi (COG) complex is a peripheral membrane complex involved in intra-Golgi protein trafficking | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK11546 zraP zinc resistance protein; Provisional | Back alignment and domain information |
|---|
| >PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF13942 Lipoprotein_20: YfhG lipoprotein | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PHA01750 hypothetical protein | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PRK10920 putative uroporphyrinogen III C-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF07544 Med9: RNA polymerase II transcription mediator complex subunit 9; InterPro: IPR011425 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4466 consensus Component of histone deacetylase complex (breast carcinoma metastasis suppressor 1 protein in human) [Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4657 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >KOG0709 consensus CREB/ATF family transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12240 Angiomotin_C: Angiomotin C terminal; InterPro: IPR024646 This domain represents the C-terminal region of angiomotin | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07656 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0289 consensus mRNA splicing factor [General function prediction only] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 302 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-04 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 4e-04 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 7e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 56.4 bits (135), Expect = 5e-09
Identities = 34/238 (14%), Positives = 74/238 (31%), Gaps = 55/238 (23%)
Query: 43 QVLSKSLMKPVDINPNDE-------WVNMAMAGVSPQILMKSAYRSVMFYLGQKELEMQY 95
+LSK + + ++ + W L+ V ++ + L + Y
Sbjct: 44 SILSKEEIDHIIMSKDAVSGTLRLFW-----------TLLSKQEEMVQKFVEEV-LRINY 91
Query: 96 K--MNRIVAQCRQKCEAMQEKFTEKLEQVHTAYQKMAKRCQMMEQEIESLSKDKQELQ-E 152
K M+ I + RQ M + E+ ++++ Q AK Q L + EL+
Sbjct: 92 KFLMSPIKTEQRQP-SMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPA 150
Query: 153 KF--------SEKS-------RQKRKLDEMYDQ---LRSEYESMKRSAIQPSNSFYPRND 194
K S K+ + +M + L + + + ++ + D
Sbjct: 151 KNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQID 210
Query: 195 PDLFSANMMDNRDPIRKDW-----SVYSPGTPGPR-----EDIWPARQNSSNSGPFDI 242
P+ S + + +R P ++ N+ F++
Sbjct: 211 PNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQ----NAKAWNAFNL 264
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.22 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.17 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.17 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.17 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.16 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.16 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.14 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.14 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.13 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.12 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.11 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.1 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.1 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.09 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.08 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.07 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.06 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.06 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.05 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.04 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.04 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.03 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.02 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.02 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.02 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.01 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.0 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.99 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.99 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.98 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.98 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.95 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.95 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.95 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.94 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.93 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.92 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.91 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.91 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.9 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.9 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.89 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.86 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.85 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.84 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.84 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.81 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.8 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.78 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.77 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.76 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.74 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.72 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.69 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.62 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.53 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.49 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.48 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.47 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.35 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.34 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.22 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.19 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.85 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.77 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.55 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 96.74 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 96.11 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 95.72 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 95.1 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 94.95 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 94.77 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.72 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 94.66 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.46 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 94.32 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 94.13 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 93.77 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 93.71 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 93.0 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 92.66 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.5 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 92.35 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 91.94 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 91.86 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 91.72 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 91.64 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 91.62 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 91.57 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 91.41 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 91.35 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 91.24 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 91.08 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 90.25 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 90.2 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 90.12 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 89.97 | |
| 3t98_B | 93 | Nucleoporin NUP58/NUP45; NUP62 complex, nuclear im | 89.87 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 89.85 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 89.77 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 89.7 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 89.51 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 89.5 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 89.43 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 88.9 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 88.86 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.56 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 88.23 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 88.15 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 87.8 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 87.71 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 87.25 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 86.6 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 85.97 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 85.17 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 84.87 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 84.33 | |
| 3q0x_A | 228 | Centriole protein; centrosome protein, coiled coil | 84.28 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 84.25 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 84.19 | |
| 3vmx_A | 48 | Voltage-gated hydrogen channel 1; coiled-coil, ION | 83.68 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 83.03 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 82.88 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 82.82 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 82.68 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 82.43 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 82.24 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 82.24 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 82.15 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 81.9 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 81.62 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 81.53 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 81.44 | |
| 1p9i_A | 31 | Cortexillin I/GCN4 hybrid peptide; coiled-coil, un | 81.3 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 81.18 | |
| 3cl3_D | 130 | NF-kappa-B essential modulator; death effector dom | 81.15 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 81.02 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 80.98 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 80.85 | |
| 4dzo_A | 123 | Mitotic spindle assembly checkpoint protein MAD1; | 80.38 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 80.37 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 80.24 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 80.18 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 80.13 |
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
Probab=99.22 E-value=6.8e-12 Score=94.06 Aligned_cols=51 Identities=18% Similarity=0.386 Sum_probs=44.8
Q ss_pred CccccCcccccCCcEEecCCccccHHHHHhhhcC-CCCCCCCccccccCCCcc
Q 022126 1 MRCNACWRELEGRAISTTCGHLLCTEDANKILSN-DAACPICDQVLSKSLMKP 52 (302)
Q Consensus 1 l~CNiC~~~l~~~~vvT~CGHiFC~~Ci~~~~~~-~~~CPvC~~~l~~~div~ 52 (302)
+.|+||...+. +||++.|||+||..|+.+|+.. ...||+|++.+...++++
T Consensus 9 ~~C~IC~~~~~-~Pv~~~CgH~fc~~Ci~~~~~~~~~~CP~C~~~~~~~~l~~ 60 (78)
T 1t1h_A 9 FRCPISLELMK-DPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTP 60 (78)
T ss_dssp SSCTTTSCCCS-SEEEETTTEEEEHHHHHHHHTTTCCBCTTTCCBCSSCCCEE
T ss_pred CCCCCcccccc-CCEEcCCCCeecHHHHHHHHHHCcCCCCCCcCCCChhhCcc
Confidence 57999999886 6999999999999999999986 789999999998665543
|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t98_B Nucleoporin NUP58/NUP45; NUP62 complex, nuclear import, coiled-coil, HE hairpin, FG-repeat, NPC, nuclear tranport, TRA channel, karyopherin; 2.50A {Rattus norvegicus} PDB: 2osz_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >3cl3_D NF-kappa-B essential modulator; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >4dzo_A Mitotic spindle assembly checkpoint protein MAD1; homodimer, kinetochore, mitosis, spindle checkpoint protein, nucleus, cell cycle; HET: MSE; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 302 | ||||
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 5e-05 |
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Immediate early protein, IEEHV species: Equine herpesvirus 1 [TaxId: 10326]
Score = 38.8 bits (90), Expect = 5e-05
Identities = 9/46 (19%), Positives = 18/46 (39%)
Query: 2 RCNACWRELEGRAISTTCGHLLCTEDANKILSNDAACPICDQVLSK 47
RC C + +++ C H C + + + CP+C +
Sbjct: 7 RCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVES 52
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 302 | |||
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.32 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.27 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.16 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.14 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.12 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.11 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.1 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.04 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.99 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.95 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.91 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.85 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.79 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.67 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.62 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.96 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 97.93 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 92.83 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 86.96 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 86.69 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 85.72 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 83.17 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 83.02 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 81.24 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 80.39 |
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: Pre-mRNA splicing factor Prp19 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.32 E-value=2.2e-13 Score=96.38 Aligned_cols=52 Identities=13% Similarity=0.205 Sum_probs=46.9
Q ss_pred CccccCcccccCCcEEe-cCCccccHHHHHhhhcCCCCCCCCccccccCCCccc
Q 022126 1 MRCNACWRELEGRAIST-TCGHLLCTEDANKILSNDAACPICDQVLSKSLMKPV 53 (302)
Q Consensus 1 l~CNiC~~~l~~~~vvT-~CGHiFC~~Ci~~~~~~~~~CPvC~~~l~~~div~~ 53 (302)
|.|+||.+.+. +||++ .|||+||.+||.+|+....+||+|+++++.+|++++
T Consensus 1 l~C~Ic~~~~~-~Pv~~~~cGh~fc~~cI~~~l~~~~~CP~c~~~l~~~dLipi 53 (56)
T d2baya1 1 MLCAISGKVPR-RPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEI 53 (56)
T ss_dssp CCCTTTCSCCS-SEEEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEEC
T ss_pred CCCccCCchHH-hcCccCCCCCcccHHHHHHHHhhccCCCccCCcCCHHhceeC
Confidence 68999999986 68877 699999999999999988899999999999998764
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|