Citrus Sinensis ID: 022128

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MAQVSLFSLSSPFPASAVSSRLRLNRPLPFQFSRIQASSDATSASASNSNPKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEALREHGHF
ccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHccccEEEcccEEEEEcccHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHccccccEEEcccccccHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHcccEEEEEEEEEccccccccHHHHHHcccccEEEEEcHHHHHHHHHHccccccccccEEEEEcHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHcccc
ccccEEEcccccccHHHHHcccccccccccEHcccccccccccccccccccEEEEEccHHHHHHHHHHHHHcccEEEEEEEEEEcccccHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHcccEEEEEEEEEEccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHcccccccEEEEEcHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHccccc
maqvslfslsspfpasavssrlrlnrplpfqfsriqassdatsasasnsnpkvvvtrergkNGKLIKALAKHRidclelpliqhaqgpdtdrlssvlnadtIFDWIiitspeagSVFLEAWKeagtpnvrigvvgAGTASIFEEVIQSSkcsldvafspskatGKILaselpkngkkkctvlypasakasNEIEEglsnrgfevvrlntyttepvhhvDQTVLKQAlsipvvavaspsAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGlknvyypthpglegWVDSILEALREHGHF
maqvslfslsspfpasavSSRLRLNRPLPFQFSRIQassdatsasasnsnpkvvvtrergknGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKilaselpkngkkkCTVLYPAsakasneieeglsnrgFEVVRLNTYTTEPVHHVDQTVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEALREHGHF
MAQvslfslsspfpasavssRLRLNRPLPFQFSRIQassdatsasasnsNPKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQalsipvvavaspsavrsswvNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEALREHGHF
**************************************************************GKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFS*******************KCTVLYP************LSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEAL******
**********SPF*ASA*S*RLRLNRPLPFQ*******************PKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEALRE****
MAQVSLFSLSSPFPASAVSSRLRLNRPLPFQFSRI******************VVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEALREHGHF
********L*SPFPASAVSSRLRLNRPLPFQFSRIQA*********SNSNPKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEALREHG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQVSLFSLSSPFPASAVSSRLRLNRPLPFQFSRIQASSDATSASASNSNPKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVDSILEALREHGHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query302 2.2.26 [Sep-21-2011]
O48721321 Uroporphyrinogen-III synt yes no 0.817 0.769 0.722 2e-99
Q10QR9302 Uroporphyrinogen-III synt yes no 0.847 0.847 0.682 4e-97
Q59294504 Porphyrin biosynthesis pr N/A no 0.784 0.470 0.253 2e-10
>sp|O48721|HEM4_ARATH Uroporphyrinogen-III synthase, chloroplastic OS=Arabidopsis thaliana GN=UROS PE=2 SV=2 Back     alignment and function desciption
 Score =  362 bits (928), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 180/249 (72%), Positives = 209/249 (83%), Gaps = 2/249 (0%)

Query: 51  PKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITS 110
           P+VVVTRERGKN ++IKAL K+ I  LELPLIQHA+GPD DRL+SVLN D  FDWIIITS
Sbjct: 65  PQVVVTRERGKNNQIIKALEKNGISSLELPLIQHARGPDFDRLASVLN-DKSFDWIIITS 123

Query: 111 PEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASE 170
           PEAGSVFLEAWK A +P V+IGVVGAGTA +FEE ++S+   L VAF+PSKATGK+LASE
Sbjct: 124 PEAGSVFLEAWKTASSPEVQIGVVGAGTARVFEEAMKSADGLLHVAFTPSKATGKVLASE 183

Query: 171 LPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIP 230
           LP+   K+ +VLYPAS KA N+I EGLS RGFEVVRLNTYTT PV  VD  +L+QALS P
Sbjct: 184 LPEKVGKRSSVLYPASLKAGNDIVEGLSKRGFEVVRLNTYTTVPVQSVDTVLLQQALSAP 243

Query: 231 VVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVD 290
           V++VASPSAVR +W++LI + EQWSN VACIGETTASAA+RLGLKNVYYP  PGLEGWV+
Sbjct: 244 VLSVASPSAVR-AWLHLIQNEEQWSNYVACIGETTASAARRLGLKNVYYPEKPGLEGWVE 302

Query: 291 SILEALREH 299
           SI+EAL  H
Sbjct: 303 SIMEALGAH 311
Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III, a precursor of tetrapyrroles such as chlorophyll, heme and phycobilins.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 7EC: 5
>sp|Q10QR9|HEM4_ORYSJ Uroporphyrinogen-III synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=UROS PE=2 SV=1 Back     alignment and function description
>sp|Q59294|HEM4_CLOJO Porphyrin biosynthesis protein HemD OS=Clostridium josui GN=hemD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
224137378296 predicted protein [Populus trichocarpa] 0.821 0.837 0.815 1e-115
359492064304 PREDICTED: uroporphyrinogen-III synthase 0.907 0.901 0.732 1e-111
449470043311 PREDICTED: uroporphyrinogen-III synthase 0.990 0.961 0.685 1e-107
356519166297 PREDICTED: uroporphyrinogen-III synthase 0.811 0.824 0.751 1e-102
357465443308 Uroporphyrinogen-III synthase [Medicago 0.854 0.837 0.713 1e-102
356509718300 PREDICTED: uroporphyrinogen-III synthase 0.811 0.816 0.742 1e-101
18694346321 uroporphyrinogen III synthase [Arabidops 0.817 0.769 0.722 1e-97
18401160321 Uroporphyrinogen-III synthase [Arabidops 0.817 0.769 0.722 1e-97
21592861321 uroporphyrinogen III synthase [Arabidops 0.817 0.769 0.718 2e-97
297825849305 hypothetical protein ARALYDRAFT_481514 [ 0.817 0.809 0.722 3e-97
>gi|224137378|ref|XP_002327111.1| predicted protein [Populus trichocarpa] gi|222835426|gb|EEE73861.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/249 (81%), Positives = 226/249 (90%), Gaps = 1/249 (0%)

Query: 51  PKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITS 110
           PKVVVTRERGKNGKLIKALAK+ I CLELPLIQH QGPD+D+LSSVL AD+ FDWII+TS
Sbjct: 46  PKVVVTRERGKNGKLIKALAKYGISCLELPLIQHTQGPDSDKLSSVLCADSAFDWIIVTS 105

Query: 111 PEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASE 170
           PEAGSVFLEAWK AGTP V++GVVGAGTASIFEEV+QSS+ SLDVAF+PSKATGK+LASE
Sbjct: 106 PEAGSVFLEAWKVAGTPKVKLGVVGAGTASIFEEVMQSSERSLDVAFTPSKATGKVLASE 165

Query: 171 LPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQALSIP 230
           LP+NG K+CTVLYPASAKASNEIE+GL NRGFEVVRLNTYTT PV HVD+ VLKQA+S P
Sbjct: 166 LPRNGNKRCTVLYPASAKASNEIEQGLYNRGFEVVRLNTYTTVPVGHVDEMVLKQAISAP 225

Query: 231 VVAVASPSAVRSSWVNLISDTEQWSNSVACIGETTASAAKRLGLKNVYYPTHPGLEGWVD 290
           VVAVASPS+VR +W NLI ++E+W+NSVACIGETT SAAKRLG K VY+P  PGLEGWVD
Sbjct: 226 VVAVASPSSVR-AWANLIPESEEWNNSVACIGETTGSAAKRLGFKKVYFPRQPGLEGWVD 284

Query: 291 SILEALREH 299
           SILEALR H
Sbjct: 285 SILEALRAH 293

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359492064|ref|XP_002282338.2| PREDICTED: uroporphyrinogen-III synthase, chloroplastic-like [Vitis vinifera] gi|302142364|emb|CBI19567.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449470043|ref|XP_004152728.1| PREDICTED: uroporphyrinogen-III synthase, chloroplastic-like [Cucumis sativus] gi|449496021|ref|XP_004160014.1| PREDICTED: uroporphyrinogen-III synthase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356519166|ref|XP_003528245.1| PREDICTED: uroporphyrinogen-III synthase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357465443|ref|XP_003603006.1| Uroporphyrinogen-III synthase [Medicago truncatula] gi|355492054|gb|AES73257.1| Uroporphyrinogen-III synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356509718|ref|XP_003523593.1| PREDICTED: uroporphyrinogen-III synthase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|18694346|emb|CAC85287.1| uroporphyrinogen III synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18401160|ref|NP_565625.1| Uroporphyrinogen-III synthase [Arabidopsis thaliana] gi|75219491|sp|O48721.2|HEM4_ARATH RecName: Full=Uroporphyrinogen-III synthase, chloroplastic; Short=AtUROS; AltName: Full=Hydroxymethylbilane hydrolyase [cyclizing]; AltName: Full=Uroporphyrinogen-III cosynthase; Flags: Precursor gi|20196944|gb|AAC14502.2| expressed protein [Arabidopsis thaliana] gi|109946587|gb|ABG48472.1| At2g26540 [Arabidopsis thaliana] gi|330252760|gb|AEC07854.1| Uroporphyrinogen-III synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21592861|gb|AAM64811.1| uroporphyrinogen III synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297825849|ref|XP_002880807.1| hypothetical protein ARALYDRAFT_481514 [Arabidopsis lyrata subsp. lyrata] gi|297326646|gb|EFH57066.1| hypothetical protein ARALYDRAFT_481514 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query302
TAIR|locus:2066256321 HEMD [Arabidopsis thaliana (ta 0.894 0.841 0.629 9.4e-82
TIGR_CMR|BA_4695250 BA_4695 "uroporphyrinogen-III 0.784 0.948 0.2 0.0005
TAIR|locus:2066256 HEMD [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 820 (293.7 bits), Expect = 9.4e-82, P = 9.4e-82
 Identities = 173/275 (62%), Positives = 197/275 (71%)

Query:    27 PLPFQFSRIQXXXXXXXXXXXXXN--PKVVVTRERGKNGKLIKALAKHRIDCLELPLIQH 84
             P P + S I              N  P+VVVTRERGKN ++IKAL K+ I  LELPLIQH
Sbjct:    40 PSPIRNS-ISSSVSSSSSSVSSSNSIPQVVVTRERGKNNQIIKALEKNGISSLELPLIQH 98

Query:    85 AQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGTPNVRIGVVGAGTASIFEE 144
             A+GPD DRL+SVLN D  FDWIIITSPEAGSVFLEAWK A +P V+IGVVGAGTA +FEE
Sbjct:    99 ARGPDFDRLASVLN-DKSFDWIIITSPEAGSVFLEAWKTASSPEVQIGVVGAGTARVFEE 157

Query:   145 VIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEV 204
              ++S+   L VAF+PSKATGK+LASELP+   K+ +VLYPAS KA N+I EGLS RGFEV
Sbjct:   158 AMKSADGLLHVAFTPSKATGKVLASELPEKVGKRSSVLYPASLKAGNDIVEGLSKRGFEV 217

Query:   205 VRLNTYTTEPVHHVDQTVLKQXXXXXXXXXXXXXXXXXXXXNLISDTEQWSNSVACIGET 264
             VRLNTYTT PV  VD TVL Q                    +LI + EQWSN VACIGET
Sbjct:   218 VRLNTYTTVPVQSVD-TVLLQQALSAPVLSVASPSAVRAWLHLIQNEEQWSNYVACIGET 276

Query:   265 TASAAKRLGLKNVYYPTHPGLEGWVDSILEALREH 299
             TASAA+RLGLKNVYYP  PGLEGWV+SI+EAL  H
Sbjct:   277 TASAARRLGLKNVYYPEKPGLEGWVESIMEALGAH 311
GO:0004852 "uroporphyrinogen-III synthase activity" evidence=IEA;ISS;IDA
GO:0006779 "porphyrin-containing compound biosynthetic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0033014 "tetrapyrrole biosynthetic process" evidence=IEA
GO:0006780 "uroporphyrinogen III biosynthetic process" evidence=IDA
TIGR_CMR|BA_4695 BA_4695 "uroporphyrinogen-III synthase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10QR9HEM4_ORYSJ4, ., 2, ., 1, ., 7, 50.68210.84760.8476yesno
O48721HEM4_ARATH4, ., 2, ., 1, ., 7, 50.72280.81780.7694yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.10.976
4th Layer4.2.1.750.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.40.619.1
hypothetical protein (272 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pm.C_LG_VII000271
hydroxymethylbilane synthase (EC-2.5.1.61) (363 aa)
•  • •• 0.959
fgenesh4_pg.C_LG_V000312
hydroxymethylbilane synthase (EC-2.5.1.61) (364 aa)
•  • •• 0.958
estExt_fgenesh4_pg.C_LG_XIX0326
SubName- Full=Putative uncharacterized protein; (403 aa)
•  • •• 0.932
gw1.182.88.1
uroporphyrinogen decarboxylase (EC-4.1.1.37) (357 aa)
•  • •• 0.932
eugene3.00150799
glutamate-1-semialdehyde 2,1-aminomutase (EC-5.4.3.8) (479 aa)
•  •  • 0.574
gw1.148.3.1
uroporphyrin-III C-methyltransferase (EC-2.1.1.107) (328 aa)
•     • 0.415
estExt_Genewise1_v1.C_LG_II0707
glutamyl-tRNA reductase (EC-1.2.1.70) (469 aa)
•     • 0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
cd06578239 cd06578, HemD, Uroporphyrinogen-III synthase (HemD 1e-44
COG1587248 COG1587, HemD, Uroporphyrinogen-III synthase [Coen 6e-37
pfam02602230 pfam02602, HEM4, Uroporphyrinogen-III synthase Hem 6e-36
PRK05928249 PRK05928, hemD, uroporphyrinogen-III synthase; Rev 5e-33
PRK06975 656 PRK06975, PRK06975, bifunctional uroporphyrinogen- 1e-08
cd06578 239 cd06578, HemD, Uroporphyrinogen-III synthase (HemD 6e-07
COG1587 248 COG1587, HemD, Uroporphyrinogen-III synthase [Coen 2e-06
>gnl|CDD|119440 cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information 
 Score =  151 bits (383), Expect = 1e-44
 Identities = 74/248 (29%), Positives = 110/248 (44%), Gaps = 17/248 (6%)

Query: 53  VVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPE 112
           V+VTR R +  +L   L     + LELPLI+     D +  +++ + D  +DW+I TSP 
Sbjct: 1   VLVTRPRPQADELAALLEALGAEVLELPLIEIEPLDDAELDAALADLDE-YDWLIFTSPN 59

Query: 113 AGSVFLEAWKEAGT---PNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILAS 169
           A   F EA +E G      ++I  VG  TA    E        L   F P +   + L  
Sbjct: 60  AVEAFFEALEELGLRALAGLKIAAVGPKTAEALRE------AGLTADFVPEEGDSEGLLE 113

Query: 170 ELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTV--LKQAL 227
            L     K   +L P   +A  ++ E L  RG EV  +  Y T P     + +  L++  
Sbjct: 114 LLELQDGKGKRILRPRGGRAREDLAEALRERGAEVDEVEVYRTVPPDLDAELLELLEEGA 173

Query: 228 SIPVVAVASPSAVRSSWVNLISDTEQWSNS---VACIGETTASAAKRLGLKNVYYPTHPG 284
            I  V   SPS VR + + L+    +       +A IG  TA A + LGLK V     P 
Sbjct: 174 -IDAVLFTSPSTVR-NLLELLGKEGRALLKNVKIAAIGPRTAEALRELGLKVVIVAESPT 231

Query: 285 LEGWVDSI 292
           LE  ++++
Sbjct: 232 LEALLEAL 239

This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in the human uroporphyrinogen-III synthase gene cause congenital erythropoietic porphyria, a recessive inborn error of metabolism also known as Gunther disease. Length = 239
>gnl|CDD|224503 COG1587, HemD, Uroporphyrinogen-III synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|217136 pfam02602, HEM4, Uroporphyrinogen-III synthase HemD Back     alignment and domain information
>gnl|CDD|235647 PRK05928, hemD, uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|119440 cd06578, HemD, Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information
>gnl|CDD|224503 COG1587, HemD, Uroporphyrinogen-III synthase [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 302
PRK05752255 uroporphyrinogen-III synthase; Validated 100.0
PRK08811266 uroporphyrinogen-III synthase; Validated 100.0
COG1587248 HemD Uroporphyrinogen-III synthase [Coenzyme metab 100.0
PRK07239381 bifunctional uroporphyrinogen-III synthetase/respo 100.0
PRK09189240 uroporphyrinogen-III synthase; Validated 100.0
PRK05928249 hemD uroporphyrinogen-III synthase; Reviewed 100.0
PRK06975 656 bifunctional uroporphyrinogen-III synthetase/uropo 100.0
PF02602231 HEM4: Uroporphyrinogen-III synthase HemD; InterPro 100.0
cd06578239 HemD Uroporphyrinogen-III synthase (HemD) catalyze 100.0
KOG4132260 consensus Uroporphyrinogen III synthase UROS/HEM4 100.0
PRK07168474 bifunctional uroporphyrinogen-III methyltransferas 100.0
PRK05928249 hemD uroporphyrinogen-III synthase; Reviewed 99.63
cd06578239 HemD Uroporphyrinogen-III synthase (HemD) catalyze 99.6
PRK07239381 bifunctional uroporphyrinogen-III synthetase/respo 99.51
PRK08811 266 uroporphyrinogen-III synthase; Validated 99.51
PRK05752255 uroporphyrinogen-III synthase; Validated 99.47
PF02602231 HEM4: Uroporphyrinogen-III synthase HemD; InterPro 99.45
PRK07168474 bifunctional uroporphyrinogen-III methyltransferas 99.45
PRK09189240 uroporphyrinogen-III synthase; Validated 99.42
COG1587248 HemD Uroporphyrinogen-III synthase [Coenzyme metab 99.4
KOG4132260 consensus Uroporphyrinogen III synthase UROS/HEM4 99.34
PRK06975 656 bifunctional uroporphyrinogen-III synthetase/uropo 99.33
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 96.84
cd06295275 PBP1_CelR Ligand binding domain of a transcription 96.59
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 96.53
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 96.46
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding doma 96.44
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 96.39
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 96.27
cd06309273 PBP1_YtfQ_like Periplasmic binding domain of ABC-t 96.2
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 96.2
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transc 96.18
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 96.05
PRK02261137 methylaspartate mutase subunit S; Provisional 96.02
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 95.87
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-bind 95.83
cd06274264 PBP1_FruR Ligand binding domain of DNA transcripti 95.72
PRK10423327 transcriptional repressor RbsR; Provisional 95.71
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 95.7
cd06288269 PBP1_sucrose_transcription_regulator Ligand-bindin 95.63
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transc 95.62
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of unchara 95.6
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 95.58
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding pr 95.55
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharac 95.51
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 95.43
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 95.41
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 95.4
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 95.39
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 95.37
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharac 95.37
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.37
COG1609333 PurR Transcriptional regulators [Transcription] 95.34
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 95.3
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 95.27
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 95.25
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 95.22
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 95.18
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 95.13
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of unchara 95.12
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 95.08
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 94.99
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 94.98
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 94.94
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 94.93
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 94.88
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 94.86
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 94.83
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 94.8
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 94.74
PRK02261137 methylaspartate mutase subunit S; Provisional 94.59
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of unchara 94.5
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 94.36
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 94.22
cd06316294 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi 94.15
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcripti 94.15
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 93.96
cd01541273 PBP1_AraR Ligand-binding domain of DNA transcripti 93.83
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 93.67
PRK10653295 D-ribose transporter subunit RbsB; Provisional 93.35
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 93.31
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 92.98
PF04392294 ABC_sub_bind: ABC transporter substrate binding pr 92.9
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 92.8
cd06287269 PBP1_LacI_like_8 Ligand-binding domain of uncharac 92.78
cd06354265 PBP1_BmpA_PnrA_like Periplasmic binding domain of 92.62
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 92.5
cd06314271 PBP1_tmGBP Periplasmic sugar-binding domain of The 92.46
cd06312271 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi 92.36
PRK10401346 DNA-binding transcriptional regulator GalS; Provis 92.22
cd06302298 PBP1_LsrB_Quorum_Sensing Periplasmic binding domai 92.05
cd01544270 PBP1_GalR Ligand-binding domain of DNA transcripti 91.88
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 91.85
cd06307275 PBP1_uncharacterized_sugar_binding Periplasmic sug 91.81
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 91.75
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 91.65
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 91.34
PRK09492315 treR trehalose repressor; Provisional 91.1
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-l 90.82
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 90.73
PRK08306296 dipicolinate synthase subunit A; Reviewed 90.71
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 90.67
cd06276247 PBP1_FucR_like Ligand-binding domain of a transcri 90.47
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 90.35
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 90.33
PRK09526342 lacI lac repressor; Reviewed 90.17
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 90.05
PRK09496 453 trkA potassium transporter peripheral membrane com 89.89
cd01965428 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_l 89.8
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain 89.57
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b 89.56
cd01538288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 89.52
PF1008797 DUF2325: Uncharacterized protein conserved in bact 89.1
PRK14987331 gluconate operon transcriptional regulator; Provis 89.02
cd01972426 Nitrogenase_VnfE_like Nitrogenase_VnfE_like: VnfE 89.02
COG4822265 CbiK Cobalamin biosynthesis protein CbiK, Co2+ che 88.81
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 88.29
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 88.29
cd01539303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 88.14
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 88.11
PRK10339327 DNA-binding transcriptional repressor EbgR; Provis 87.88
PRK06756148 flavodoxin; Provisional 87.82
cd06324305 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b 87.23
cd06304260 PBP1_BmpA_like Periplasmic binding component of a 86.89
cd06306268 PBP1_TorT-like TorT-like proteins, a periplasmic b 86.35
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 86.19
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 85.79
PRK02910 519 light-independent protochlorophyllide reductase su 85.71
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 85.6
PRK15408336 autoinducer 2-binding protein lsrB; Provisional 85.33
PRK15424 538 propionate catabolism operon regulatory protein Pr 84.89
PLN02928347 oxidoreductase family protein 84.81
PRK11041309 DNA-binding transcriptional regulator CytR; Provis 84.05
cd06321271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 84.0
PRK09701311 D-allose transporter subunit; Provisional 83.8
cd01974435 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitro 83.53
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 83.2
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 83.08
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 82.85
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 82.34
PRK06756148 flavodoxin; Provisional 81.91
TIGR01282466 nifD nitrogenase molybdenum-iron protein alpha cha 81.32
PRK06703151 flavodoxin; Provisional 80.95
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.35
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 80.33
>PRK05752 uroporphyrinogen-III synthase; Validated Back     alignment and domain information 
Probab=100.00  E-value=4.6e-45  Score=328.07  Aligned_cols=242  Identities=19%  Similarity=0.161  Sum_probs=212.0

Q ss_pred             CCCCeEEEeCCCCChHHHHHHHHhCCCcEEEeceEEeeeCCCchHHHHHHhcCCCccEEEEeChHHHHHHHHHHHHcCC-
Q 022128           48 NSNPKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGT-  126 (302)
Q Consensus        48 l~g~~IlitR~~~~~~~l~~~L~~~G~~v~~~P~~~~~~~~~~~~l~~~l~~l~~~d~IifTS~~av~~f~~~l~~~~~-  126 (302)
                      +.|++||||||.+++.++.+.|+++|++++.+|++++++.++...+...+.++.+||||||||+|||++|++.+.+.+. 
T Consensus         1 ~~g~~vlvTRp~~~~~~l~~~l~~~G~~~~~~P~i~i~p~~~~~~~~~~l~~l~~~d~iifTS~naV~~~~~~l~~~~~~   80 (255)
T PRK05752          1 MSGWRLLLTRPAEECAALAASLAEAGIFSSSLPLLAIEPLPETPEQRALLLELDRYCAVIVVSKPAARLGLELLDRYWPQ   80 (255)
T ss_pred             CCCCEEEECCcHHHHHHHHHHHHHcCCCEEEcCcEEEeeCCCCHHHHHHHhcCCCCCEEEEECHHHHHHHHHHHHhhCCC
Confidence            4699999999999999999999999999999999999998776677777778899999999999999999999877653 


Q ss_pred             -CCceEEEEChhhHHHHHHHhhccCCCCceeccCCCccHHHHHHh--cccC-CCCCCEEEEeCCCcchhhHHHHHHhCCC
Q 022128          127 -PNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASE--LPKN-GKKKCTVLYPASAKASNEIEEGLSNRGF  202 (302)
Q Consensus       127 -~~~~i~aVG~~Ta~~l~~~~~~~~~G~~~~~~p~~~~~e~L~~~--L~~~-~~~~~~vL~~rg~~~~~~L~~~L~~~G~  202 (302)
                       .+.+++|||++|+++|+++      |+.++++|..+++++|++.  +... ..++++||++||+.+++.|.+.|++.|+
T Consensus        81 ~~~~~~~aVG~~Ta~al~~~------G~~~~~~p~~~~se~Ll~~~~l~~~~~~~~~~vLi~rg~~~r~~L~~~L~~~G~  154 (255)
T PRK05752         81 PPQQPWFSVGAATAAILQDY------GLDVSYPEQGDDSEALLALPALRQALAVPDPRVLIMRGEGGRELLAERLREQGA  154 (255)
T ss_pred             CcCCEEEEECHHHHHHHHHc------CCCcccCCCCCCcHHHHhChhhhccccCCCCEEEEEccCccHHHHHHHHHHCCC
Confidence             3689999999999999999      9999998999999999876  3332 1367899999999999999999999999


Q ss_pred             eeEEEeeeeeecCCCCcHHHHHHc--CCCCEEEEECcHHHHHHHHHhhhccc--CCCceEEEECHHHHHHHHHcCCCeEE
Q 022128          203 EVVRLNTYTTEPVHHVDQTVLKQA--LSIPVVAVASPSAVRSSWVNLISDTE--QWSNSVACIGETTASAAKRLGLKNVY  278 (302)
Q Consensus       203 ~v~~~~vY~~~~~~~~~~~~~~~~--~~~d~ivftS~s~v~~~~~~~l~~~~--~~~~~i~~IG~~Ta~~l~~~G~~~~~  278 (302)
                      .|.++++|++.+.......+.+.+  +.+|+|+|||+++++ +|++.+....  ....+++|||++|+++++++|++.++
T Consensus       155 ~v~~~~vY~~~~~~~~~~~~~~~~~~~~~d~v~ftS~~~~~-~~~~~~~~~~~~~~~~~~~~ig~~ta~a~~~~G~~~~~  233 (255)
T PRK05752        155 SVDYLELYRRCLPDYPAGTLLQRVEAERLNGLVVSSGQGFE-HLQQLAGADWPELARLPLFVPSPRVAEQARAAGAQTVV  233 (255)
T ss_pred             EEeEEEEEeecCCCCCHHHHHHHHHhCCCCEEEECCHHHHH-HHHHHhChhHHHhcCceEEEeCHHHHHHHHHcCCCcee
Confidence            999999999987665544444333  579999999999999 9999876431  23578999999999999999999988


Q ss_pred             ecCCCChHHHHHHHHHHH
Q 022128          279 YPTHPGLEGWVDSILEAL  296 (302)
Q Consensus       279 v~~~~~~~~ll~~i~~~~  296 (302)
                      +++.++.++|+++|.++.
T Consensus       234 ~a~~~t~~~L~~al~~~~  251 (255)
T PRK05752        234 DCRGASAAALLAALRRQA  251 (255)
T ss_pred             eCCCCChHHHHHHHHhcc
Confidence            999999999999998764

>PRK08811 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>COG1587 HemD Uroporphyrinogen-III synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated Back     alignment and domain information
>PRK09189 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>PF02602 HEM4: Uroporphyrinogen-III synthase HemD; InterPro: IPR003754 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>cd06578 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information
>KOG4132 consensus Uroporphyrinogen III synthase UROS/HEM4 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07168 bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK05928 hemD uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>cd06578 HemD Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme Back     alignment and domain information
>PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated Back     alignment and domain information
>PRK08811 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PRK05752 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PF02602 HEM4: Uroporphyrinogen-III synthase HemD; InterPro: IPR003754 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK07168 bifunctional uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase; Reviewed Back     alignment and domain information
>PRK09189 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>COG1587 HemD Uroporphyrinogen-III synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG4132 consensus Uroporphyrinogen III synthase UROS/HEM4 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06975 bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs Back     alignment and domain information
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs Back     alignment and domain information
>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>cd06276 PBP1_FucR_like Ligand-binding domain of a transcription repressor, FucR, which functions as a molecular sensor of L-fucose availability Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>cd01972 Nitrogenase_VnfE_like Nitrogenase_VnfE_like: VnfE subunit of the VnfEN complex_like Back     alignment and domain information
>COG4822 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism] Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK02910 light-independent protochlorophyllide reductase subunit B; Provisional Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>cd01974 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitrogenase MoFe protein, beta subunit Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>TIGR01282 nifD nitrogenase molybdenum-iron protein alpha chain Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query302
1jr2_A286 Uroporphyrinogen-III synthase; heme biosynthesis, 2e-47
3re1_A269 Uroporphyrinogen-III synthetase; HEMD-like family, 2e-45
3mw8_A240 Uroporphyrinogen-III synthase; structural genomics 7e-40
3mw8_A 240 Uroporphyrinogen-III synthase; structural genomics 3e-05
1wcw_A261 Uroporphyrinogen III synthase; congenital erythrop 3e-38
3p9z_A229 Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2 3e-34
3d8t_A286 Uroporphyrinogen-III synthase; heme biosynthesis, 8e-33
>1jr2_A Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} SCOP: c.113.1.1 Length = 286 Back     alignment and structure
 Score =  159 bits (405), Expect = 2e-47
 Identities = 44/272 (16%), Positives = 89/272 (32%), Gaps = 30/272 (11%)

Query: 51  PKVVVTRERGKNGKL---IKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWII 107
             +++   +  +      I+ L  + ++   +P++   +       S  L+    +  +I
Sbjct: 23  KVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSF-EFLSLPSFSEKLSHPEDYGGLI 81

Query: 108 ITSPEAGSVFLEAWKEAGTP------------NVRIGVVGAGTASIFEEVIQSSKCSLDV 155
            TSP A        ++                   + VVG  TAS+  ++   ++     
Sbjct: 82  FTSPRAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTE----- 136

Query: 156 AFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPV 215
               +    + LA  +         +L+P        + + L ++G  +  +  Y T   
Sbjct: 137 --GETCGNAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTVAH 194

Query: 216 HHVDQ---TVLKQALSIPVVAVASPSAVRSSWVNLISDTEQWSNS---VACIGETTASAA 269
             +     +   Q      +   SPS +    +  I +    +      A IG TTA A 
Sbjct: 195 PGIQGNLNSYYSQQGVPASITFFSPSGLTY-SLKHIQELSGDNIDQIKFAAIGPTTARAL 253

Query: 270 KRLGLKNVYYPTHPGLEGWVDSILEALREHGH 301
              GL        P  +     I +AL+ HG 
Sbjct: 254 AAQGLPVSCTAESPTPQALATGIRKALQPHGC 285
>3re1_A Uroporphyrinogen-III synthetase; HEMD-like family, uroporphyrinogen III synthase, HMB, lyase; 2.50A {Pseudomonas syringae PV} Length = 269 Back     alignment and structure
>3mw8_A Uroporphyrinogen-III synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 1.65A {Shewanella amazonensis} Length = 240 Back     alignment and structure
>3mw8_A Uroporphyrinogen-III synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 1.65A {Shewanella amazonensis} Length = 240 Back     alignment and structure
>1wcw_A Uroporphyrinogen III synthase; congenital erythropoietic porph structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Length = 261 Back     alignment and structure
>3p9z_A Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, structural genomics, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.10A {Helicobacter pylori} Length = 229 Back     alignment and structure
>3d8t_A Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
4es6_A254 Uroporphyrinogen-III synthase; heme-biosynthesis, 100.0
3re1_A269 Uroporphyrinogen-III synthetase; HEMD-like family, 100.0
3d8t_A286 Uroporphyrinogen-III synthase; heme biosynthesis, 100.0
1jr2_A286 Uroporphyrinogen-III synthase; heme biosynthesis, 100.0
3mw8_A240 Uroporphyrinogen-III synthase; structural genomics 100.0
1wcw_A261 Uroporphyrinogen III synthase; congenital erythrop 100.0
3p9z_A229 Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2 100.0
3p9z_A229 Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2 99.66
1jr2_A286 Uroporphyrinogen-III synthase; heme biosynthesis, 99.66
3re1_A269 Uroporphyrinogen-III synthetase; HEMD-like family, 99.64
4es6_A254 Uroporphyrinogen-III synthase; heme-biosynthesis, 99.62
1wcw_A261 Uroporphyrinogen III synthase; congenital erythrop 99.6
3d8t_A286 Uroporphyrinogen-III synthase; heme biosynthesis, 99.6
3mw8_A 240 Uroporphyrinogen-III synthase; structural genomics 99.59
3gbv_A304 Putative LACI-family transcriptional regulator; NY 96.56
3gv0_A288 Transcriptional regulator, LACI family; transcript 96.13
3egc_A291 Putative ribose operon repressor; structural genom 95.92
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 95.84
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 95.75
3h75_A350 Periplasmic sugar-binding domain protein; protein 95.73
3g85_A289 Transcriptional regulator (LACI family); transcrip 95.51
3k4h_A292 Putative transcriptional regulator; structural gen 95.44
3qk7_A294 Transcriptional regulators; structural genomics, N 95.4
2q5c_A196 NTRC family transcriptional regulator; structural 95.28
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 95.13
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 95.01
2pju_A225 Propionate catabolism operon regulatory protein; s 94.95
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 94.76
3kke_A303 LACI family transcriptional regulator; structural 94.73
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 94.66
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 94.29
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 94.28
3gyb_A280 Transcriptional regulators (LACI-family transcript 94.22
3k9c_A289 Transcriptional regulator, LACI family protein; PS 94.11
2rir_A300 Dipicolinate synthase, A chain; structural genomic 94.09
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 94.09
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 94.05
3c3k_A285 Alanine racemase; structural genomics, protein str 93.95
3o74_A272 Fructose transport system repressor FRUR; dual tra 93.91
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 93.86
2vk2_A306 YTFQ, ABC transporter periplasmic-binding protein 93.84
3bbl_A287 Regulatory protein of LACI family; protein structu 93.76
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 93.62
3e3m_A355 Transcriptional regulator, LACI family; structural 93.61
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 93.49
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 93.36
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 93.3
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 93.13
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 92.86
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 92.73
3e61_A277 Putative transcriptional repressor of ribose OPER; 92.71
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 92.55
3l6u_A293 ABC-type sugar transport system periplasmic compo; 92.37
3jvd_A333 Transcriptional regulators; structural genomics, P 91.87
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 91.86
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 91.75
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 91.69
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 91.6
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 91.53
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 91.37
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 90.85
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 90.85
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 90.8
1mio_B458 Nitrogenase molybdenum iron protein (beta chain); 90.68
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.64
2dri_A271 D-ribose-binding protein; sugar transport; HET: RI 90.45
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 90.34
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 89.89
2h3h_A313 Sugar ABC transporter, periplasmic sugar-binding p 89.68
3miz_A301 Putative transcriptional regulator protein, LACI f 89.61
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 89.41
2qu7_A288 Putative transcriptional regulator; structural gen 89.31
2x7x_A325 Sensor protein; transferase, sensor histidine kina 89.05
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 88.99
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 88.85
2iks_A293 DNA-binding transcriptional dual regulator; escher 88.8
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.62
1byk_A255 Protein (trehalose operon repressor); LACI family, 87.8
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 87.67
2qh8_A302 Uncharacterized protein; conserved domain protein, 87.65
3aek_A437 Light-independent protochlorophyllide reductase S; 87.47
4fe7_A 412 Xylose operon regulatory protein; HTH_ARAC, helix- 87.11
1lss_A140 TRK system potassium uptake protein TRKA homolog; 86.93
2rjo_A332 Twin-arginine translocation pathway signal protei; 86.92
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 86.84
3bil_A348 Probable LACI-family transcriptional regulator; st 86.44
3d02_A303 Putative LACI-type transcriptional regulator; peri 86.37
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 86.12
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 85.84
2hqb_A296 Transcriptional activator of COMK gene; berkeley s 85.57
2pln_A137 HP1043, response regulator; signaling protein; 1.8 85.45
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 85.41
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 85.32
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 85.12
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.76
3h5o_A339 Transcriptional regulator GNTR; transcription regu 84.68
1id1_A153 Putative potassium channel protein; RCK domain, E. 84.47
2xij_A762 Methylmalonyl-COA mutase, mitochondrial; isomerase 84.4
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 84.3
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 84.0
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 83.91
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 83.45
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 83.23
1lss_A140 TRK system potassium uptake protein TRKA homolog; 83.11
1gud_A288 ALBP, D-allose-binding periplasmic protein; peripl 83.02
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 82.41
1tjy_A316 Sugar transport protein; protein-ligand complex, s 82.0
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 81.42
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 81.41
3aek_B 525 Light-independent protochlorophyllide reductase S; 81.39
3c85_A183 Putative glutathione-regulated potassium-efflux S 81.29
3gt7_A154 Sensor protein; structural genomics, signal receiv 80.34
3npg_A249 Uncharacterized DUF364 family protein; protein wit 80.24
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 80.13
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 80.12
>4es6_A Uroporphyrinogen-III synthase; heme-biosynthesis, cytoplasmi; 2.22A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=100.00  E-value=1.1e-47  Score=343.28  Aligned_cols=243  Identities=18%  Similarity=0.176  Sum_probs=214.4

Q ss_pred             CCCCCCeEEEeCCCCChHHHHHHHHhCCCcEEEeceEEeeeCCCchHHHHHHhcCCCccEEEEeChHHHHHHHHHHHHcC
Q 022128           46 ASNSNPKVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAG  125 (302)
Q Consensus        46 ~~l~g~~IlitR~~~~~~~l~~~L~~~G~~v~~~P~~~~~~~~~~~~l~~~l~~l~~~d~IifTS~~av~~f~~~l~~~~  125 (302)
                      +|+.|++||+|||..+++++.+.|+++|++++.+|+|++++.++...+.+.+.++.+||||||||+|||++|++.+.+.+
T Consensus         2 ~~L~g~~vlvtRp~~~~~~l~~~L~~~G~~~~~~P~i~i~~~~~~~~l~~~l~~l~~~d~vifTS~~aV~~~~~~l~~~~   81 (254)
T 4es6_A            2 SHMSGWRLLLTRPDEECAALAASLGEAGVHSSSLPLLAIDPLEETPEQRTLMLDLDRYCAVVVVSKPAARLGLERLDRYW   81 (254)
T ss_dssp             ----CCEEEECSCHHHHHHHHHHHHHTTCEEEECCSCEEEECCCCHHHHHHHHTGGGCSEEEECSHHHHHHHHHHHHHHC
T ss_pred             CCCCCCEEEEeCChHHhHHHHHHHHHCCCcEEEeCCEEEeeCcChHHHHHHHHhccCCCEEEEECHHHHHHHHHHHHHhC
Confidence            48999999999999999999999999999999999999999987777888887788999999999999999999988765


Q ss_pred             C--CCceEEEEChhhHHHHHHHhhccCCCCceeccCCCccHHHHHHhcc--c-CCCCCCEEEEeCCCcchhhHHHHHHhC
Q 022128          126 T--PNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELP--K-NGKKKCTVLYPASAKASNEIEEGLSNR  200 (302)
Q Consensus       126 ~--~~~~i~aVG~~Ta~~l~~~~~~~~~G~~~~~~p~~~~~e~L~~~L~--~-~~~~~~~vL~~rg~~~~~~L~~~L~~~  200 (302)
                      .  .+++++|||++|+++|+++      |+.++++|+.+++++|++.+.  . ...++++||++||+.+++.|.+.|+++
T Consensus        82 ~~~~~~~i~aVG~~Ta~~L~~~------G~~~~~~~~~~~~e~L~~~l~~~~~~~~~~~~vL~~rg~~~r~~L~~~L~~~  155 (254)
T 4es6_A           82 PQPPQQTWCSVGAATAAILEAY------GLDVTYPEQGDDSEALLALPAFQDSLRVHDPKVLIMRGEGGREFLAERLRGQ  155 (254)
T ss_dssp             SSCCSCEEEESSHHHHHHHHHH------TCCEECCSSCCSHHHHHTCHHHHHHTCSSSCEEEEEECSSCCCHHHHHHHHT
T ss_pred             CCcccCEEEEECHHHHHHHHHc------CCCcccCCCCCCHHHHHHhHhhcccccCCCCEEEEEcCCccHHHHHHHHHHC
Confidence            4  3589999999999999999      999999998899999998886  3 234689999999999999999999999


Q ss_pred             CCeeEEEeeeeeecCCCCcHHHHHHc--CCCCEEEEECcHHHHHHHHHhhhcc--cCCCceEEEECHHHHHHHHHcCCCe
Q 022128          201 GFEVVRLNTYTTEPVHHVDQTVLKQA--LSIPVVAVASPSAVRSSWVNLISDT--EQWSNSVACIGETTASAAKRLGLKN  276 (302)
Q Consensus       201 G~~v~~~~vY~~~~~~~~~~~~~~~~--~~~d~ivftS~s~v~~~~~~~l~~~--~~~~~~i~~IG~~Ta~~l~~~G~~~  276 (302)
                      |++|+++++|++++.+.....+.+.+  ..+|+|+|||+++++ +|++.+.+.  ...+++++||||+|+++++++|+++
T Consensus       156 G~~v~~~~vY~~~~~~~~~~~~~~~l~~~~~d~v~ftS~s~v~-~~~~~~~~~~~~l~~~~~~aIG~~Ta~~l~~~G~~~  234 (254)
T 4es6_A          156 GVQVDYLPLYRRRAPDYPAGELLARVRAERLNGLVVSSGQGLQ-NLYQLAAADWPEIGRLPLFVPSPRVAEMARELGAQR  234 (254)
T ss_dssp             TCEEEEEECEEEECCCCCTTHHHHHHHHTTCCEEECCSHHHHH-HHHHHHGGGHHHHTTSCEEESSHHHHHHHHHTTCSS
T ss_pred             CCEEEEEeEEEeeCCCCCHHHHHHHHHhCCCCEEEEcCHHHHH-HHHHHhhHHHHHHhCCeEEEECHHHHHHHHHcCCCc
Confidence            99999999999999887655443333  689999999999999 999988753  1346889999999999999999999


Q ss_pred             EEecCCCChHHHHHHHHHH
Q 022128          277 VYYPTHPGLEGWVDSILEA  295 (302)
Q Consensus       277 ~~v~~~~~~~~ll~~i~~~  295 (302)
                      ++++++|+.++|+++|.++
T Consensus       235 ~~~a~~~~~~~l~~ai~~a  253 (254)
T 4es6_A          235 VIDCRGASAPALLAALTSA  253 (254)
T ss_dssp             EEECSSSSHHHHHHHHHHC
T ss_pred             eEECCCCCHHHHHHHHHhh
Confidence            9999999999999999863
>3re1_A Uroporphyrinogen-III synthetase; HEMD-like family, uroporphyrinogen III synthase, HMB, lyase; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3d8t_A Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Back     alignment and structure
>1jr2_A Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} SCOP: c.113.1.1 Back     alignment and structure
>3mw8_A Uroporphyrinogen-III synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 1.65A {Shewanella amazonensis} Back     alignment and structure
>1wcw_A Uroporphyrinogen III synthase; congenital erythropoietic porph structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Back     alignment and structure
>3p9z_A Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, structural genomics, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.10A {Helicobacter pylori} Back     alignment and structure
>3p9z_A Uroporphyrinogen III cosynthase (HEMD); MCSG, PSI2, structural genomics, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.10A {Helicobacter pylori} Back     alignment and structure
>1jr2_A Uroporphyrinogen-III synthase; heme biosynthesis, HEAM biosynthesis, lyase; 1.84A {Homo sapiens} SCOP: c.113.1.1 Back     alignment and structure
>3re1_A Uroporphyrinogen-III synthetase; HEMD-like family, uroporphyrinogen III synthase, HMB, lyase; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4es6_A Uroporphyrinogen-III synthase; heme-biosynthesis, cytoplasmi; 2.22A {Pseudomonas aeruginosa} Back     alignment and structure
>1wcw_A Uroporphyrinogen III synthase; congenital erythropoietic porph structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} PDB: 1wd7_A 1wcx_A Back     alignment and structure
>3d8t_A Uroporphyrinogen-III synthase; heme biosynthesis, lyase; 1.60A {Thermus thermophilus} PDB: 3d8r_A 3d8s_A 3d8n_A Back     alignment and structure
>3mw8_A Uroporphyrinogen-III synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 1.65A {Shewanella amazonensis} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>1mio_B Nitrogenase molybdenum iron protein (beta chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} SCOP: c.92.2.3 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3aek_A Light-independent protochlorophyllide reductase S; iron/sulfur cluster, oxidoreductase, bacteriochlorophyll biosynthesis; HET: PMR; 2.30A {Rhodobacter capsulatus} PDB: 3aeq_A* 3aes_A* 3aer_A* 3aet_A 3aeu_A Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>3aek_B Light-independent protochlorophyllide reductase S; iron/sulfur cluster, oxidoreductase, bacteriochlorophyll biosynthesis; HET: PMR; 2.30A {Rhodobacter capsulatus} PDB: 3aeq_B* 3aer_B 3aes_B* 3aeu_B 3aet_B Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3npg_A Uncharacterized DUF364 family protein; protein with unknown function from DUF364 family, structural genomics; 2.70A {Pyrococcus horikoshii} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 302
d1wd7a_254 c.113.1.1 (A:) Probable uroporphyrinogen-III synth 6e-30
d1jr2a_260 c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, 4e-27
>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HemD-like
superfamily: HemD-like
family: HemD-like
domain: Probable uroporphyrinogen-III synthase
species: Thermus thermophilus [TaxId: 274]

 Score =  111 bits (279), Expect = 6e-30
 Identities = 44/261 (16%), Positives = 71/261 (27%), Gaps = 26/261 (9%)

Query: 52  KVVVTRERGKNGKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSP 111
           +V     R +         K     L  P+    + P  +    V       D  + T+ 
Sbjct: 3   RVAYAGLR-RKEAFKALAEKLGFTPLLFPVQATEKVPVPEYRDQVRALAQGVDLFLATTG 61

Query: 112 EAGSVFLEAWKEAGTP------NVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGK 165
                 LEA K  G               GA  A   +      +  L         +  
Sbjct: 62  VGVRDLLEAGKALGLDLEGPLAKAFRLARGAKAARALK------EAGLPPHAVGDGTSKS 115

Query: 166 ILASELPKNGKKKCTVLYPASAKASNEIEEGLSNRGFEVVRLNTYTTEPVHHVDQTVLKQ 225
           +L       G            K    +E  L+ RG+ V+ L  Y   P       + + 
Sbjct: 116 LLPLLPQGRGV----AALQLYGKPLPLLENALAERGYRVLPLMPYRHLPDPEGILRLEEA 171

Query: 226 ALSIPVVAV--ASPSAVRSSWVNLISDTEQWSNS------VACIGETTASAAKRLGLKNV 277
            L   V A+   +   V         D +    +         +G  TA A +  G+K  
Sbjct: 172 LLRGEVDALAFVAAIQVEF-LFEGAKDPKALREALNTRVKALAVGRVTADALREWGVKPF 230

Query: 278 YYPTHPGLEGWVDSILEALRE 298
           Y      L   +     AL++
Sbjct: 231 YVDETERLGSLLQGFKRALQK 251
>d1jr2a_ c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo sapiens) [TaxId: 9606]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query302
d1jr2a_260 Uroporphyrinogen III synthase (U3S, HemD) {Human ( 100.0
d1wd7a_254 Probable uroporphyrinogen-III synthase {Thermus th 100.0
d1wd7a_254 Probable uroporphyrinogen-III synthase {Thermus th 99.47
d1jr2a_260 Uroporphyrinogen III synthase (U3S, HemD) {Human ( 99.46
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 95.69
d2pjua1186 Propionate catabolism operon regulatory protein Pr 95.35
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 94.26
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 93.7
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 93.69
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 93.67
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 93.35
d1jx6a_338 Quorum-sensing signal (autoinducer-2) binding prot 93.27
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 91.7
d1mb3a_123 Cell division response regulator DivK {Caulobacter 91.02
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 90.74
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 89.82
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 89.59
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.33
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 88.91
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 88.75
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.69
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 88.1
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 88.05
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 87.74
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 86.92
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 86.9
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 86.58
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 85.48
d1guda_288 D-allose-binding protein {Escherichia coli [TaxId: 85.26
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 83.72
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 83.26
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 82.22
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 81.95
d2dria_271 D-ribose-binding protein {Escherichia coli, strain 81.93
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 81.8
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 81.54
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 81.23
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 80.79
>d1jr2a_ c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HemD-like
superfamily: HemD-like
family: HemD-like
domain: Uroporphyrinogen III synthase (U3S, HemD)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.4e-42  Score=307.05  Aligned_cols=238  Identities=18%  Similarity=0.210  Sum_probs=206.9

Q ss_pred             CeEEEeCCCCCh---HHHHHHHHhCCCcEEEeceEEeeeCCCchHHHHHHhcCCCccEEEEeChHHHHHHHHHHHHcCC-
Q 022128           51 PKVVVTRERGKN---GKLIKALAKHRIDCLELPLIQHAQGPDTDRLSSVLNADTIFDWIIITSPEAGSVFLEAWKEAGT-  126 (302)
Q Consensus        51 ~~IlitR~~~~~---~~l~~~L~~~G~~v~~~P~~~~~~~~~~~~l~~~l~~l~~~d~IifTS~~av~~f~~~l~~~~~-  126 (302)
                      +.||+|||.+++   +++.+.|+++|++++.+|++++++.. .+.+...+.++.+||||||||++||++|++.+.+.+. 
T Consensus         2 k~il~trp~~~~~~~d~~~~~L~~~G~~~~~~P~i~i~~~~-~~~~~~~l~~~~~~d~iifTS~~aV~~~~~~l~~~~~~   80 (260)
T d1jr2a_           2 KVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLS-LPSFSEKLSHPEDYGGLIFTSPRAVEAAELCLEQNNKT   80 (260)
T ss_dssp             EEEEEESSCCCBTTBCHHHHHHHTTTCEEEEEECEEEEECC-HHHHHHHHTCGGGCSEEEECCHHHHHHHHHHHHHTTCH
T ss_pred             cEEEecCCCCCcccccHHHHHHHhCCCcEEEECCEEEeeCC-hHHHHHHHhChhhccEEEEeCchHHHHHHHHHHhhCcc
Confidence            568999998654   57999999999999999999999864 5667777778889999999999999999999877653 


Q ss_pred             -----------CCceEEEEChhhHHHHHHHhhccCCCCceeccCCCccHHHHHHhcccCCCCCCEEEEeCCCcchhhHHH
Q 022128          127 -----------PNVRIGVVGAGTASIFEEVIQSSKCSLDVAFSPSKATGKILASELPKNGKKKCTVLYPASAKASNEIEE  195 (302)
Q Consensus       127 -----------~~~~i~aVG~~Ta~~l~~~~~~~~~G~~~~~~p~~~~~e~L~~~L~~~~~~~~~vL~~rg~~~~~~L~~  195 (302)
                                 ++.+++|||++|+++|+++      |+.+++.+ .+++++|++.+......++++|+++|+.++++|.+
T Consensus        81 ~~~~~~~~~~~~~~~i~aVG~~Ta~~l~~~------G~~~~~~~-~~~s~~l~~~~~~~~~~~~~il~~~g~~~~~~L~~  153 (260)
T d1jr2a_          81 EVWERSLKEKWNAKSVYVVGNATASLVSKI------GLDTEGET-CGNAEKLAEYICSRESSALPLLFPCGNLKREILPK  153 (260)
T ss_dssp             HHHHHHTHHHHHHSEEEECSHHHHHHHHHT------TCCCSCCS-CSSHHHHHHHHHTSCCCSSCEEEEESCGGGCCHHH
T ss_pred             hhhhhhhhhhhccCeEEEEcHHHHHHHHHc------CCCccccc-cccHHHHHHHHhhhcccCceEEEeeccccchHHHH
Confidence                       3679999999999999999      99987654 67899999988776667789999999999999999


Q ss_pred             HHHhCCCeeEEEeeeeeecCCCCcHHHHHH---cCCCCEEEEECcHHHHHHHHHhhhccc---CCCceEEEECHHHHHHH
Q 022128          196 GLSNRGFEVVRLNTYTTEPVHHVDQTVLKQ---ALSIPVVAVASPSAVRSSWVNLISDTE---QWSNSVACIGETTASAA  269 (302)
Q Consensus       196 ~L~~~G~~v~~~~vY~~~~~~~~~~~~~~~---~~~~d~ivftS~s~v~~~~~~~l~~~~---~~~~~i~~IG~~Ta~~l  269 (302)
                      .|++.|+.|.++.+|++++.+.........   ...+|+|+|||+++++ .|++.+.+..   ..+.+++|||++|++++
T Consensus       154 ~L~~~g~~v~~~~~Y~~~~~~~~~~~~~~~l~~~~~~d~i~f~S~s~v~-~~~~~~~~~~~~~~~~~~i~~IG~~ta~~l  232 (260)
T d1jr2a_         154 ALKDKGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLT-YSLKHIQELSGDNIDQIKFAAIGPTTARAL  232 (260)
T ss_dssp             HHHTTTCCEEEEECEEEEECTTHHHHHHHHHHHHCSCSEEEESSHHHHH-HHHHHHHHHHGGGGGGSEEEESSHHHHHHH
T ss_pred             HHHhcCCcceEEEeeeeeccccchHHHHHHHHhccCceEEeecCHHHHH-HHHHHHHHhhhccccCcEEEEECHHHHHHH
Confidence            999999999999999999987665543332   2568999999999999 9999887532   23578999999999999


Q ss_pred             HHcCCCeEEecCCCChHHHHHHHHHHHH
Q 022128          270 KRLGLKNVYYPTHPGLEGWVDSILEALR  297 (302)
Q Consensus       270 ~~~G~~~~~v~~~~~~~~ll~~i~~~~~  297 (302)
                      +++|+++++++++|+.++|+++|.++++
T Consensus       233 ~~~G~~~~~~a~~p~~e~lv~aI~~~l~  260 (260)
T d1jr2a_         233 AAQGLPVSCTAESPTPQALATGIRKALQ  260 (260)
T ss_dssp             HHTTCCCSEECSSSSHHHHHHHHHHHTC
T ss_pred             HHcCCCceEEeCCCCHHHHHHHHHHHhC
Confidence            9999999899999999999999999874
>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wd7a_ c.113.1.1 (A:) Probable uroporphyrinogen-III synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr2a_ c.113.1.1 (A:) Uroporphyrinogen III synthase (U3S, HemD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure