Citrus Sinensis ID: 022161

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-
MAQSCAAALSSTAIFAAFCNHFPAESHSSSLRFSPLRLRKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAAAGQ
cccHHHHHHHcHHHHccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHcccccEEEcccccccccccccccc
cccHHHcccHHHcccccccccccccccccccccccccccccccccccHHHHccccHEEEEcccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHcHHHHHHcccEEEEEccEcHHHHHHHHHHHHHHHHHcccccEEEEEEEccEcHHHHHHHHHHHHHccccEEEEEEEEEEcHHHHHHHccccccEEEccccEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccEEEEHHHHHHHccccEEcHcHHHHccccccHccc
MAQSCAAALSSTAIFAAFCnhfpaeshssslrfspLRLRKMIVssnrerkcekfgvkaaytsdysslddcesTWKGIWSIrndlevpsspyiptyaqgeqgggpppmlLGRFQNVLSQLFQHRiircggpvedDMANIIVAQLLYldavdpnkdIIMYlnspggsvtagMAIFDTirhirpdvSTVCVGLAASMGAFLLSagtkgkryslpnsrimihqplggaqggqsdiDLQANEMLHHKANLNgylsyhtgqtlekinedtdrdffmsaeeakdyglidgvvmnphkilQPVAAAAGQ
MAQSCAAALSSTAIFAAFCNHFPAEshssslrfsplRLRKMivssnrerkcekfgvkaaytsdysslddcESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAAAGQ
MAQSCaaalsstaifaafCNHFPAEshssslrfsplrlrKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAAAGQ
*******ALSSTAIFAAFCNHFPA***********LRLRKMIVS****RKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYA**********MLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQ*************LQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQ********
*********SSTAIFAAFC***************************************************************DLEVPSSPYIPTYAQGEQG*****MLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVM***************
********LSSTAIFAAFCNHFPAESHSSSLRFSPLRLRKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAAAGQ
*******************************R*****L*****SSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPH************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQSCAAALSSTAIFAAFCNHFPAESHSSSLRFSPLRLRKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAAAGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query301 2.2.26 [Sep-21-2011]
Q9S834298 ATP-dependent Clp proteas yes no 0.973 0.983 0.693 1e-117
Q3MFR5204 ATP-dependent Clp proteas yes no 0.607 0.897 0.666 2e-67
Q8YXH5204 ATP-dependent Clp proteas yes no 0.607 0.897 0.661 8e-67
Q8YQX8232 ATP-dependent Clp proteas no no 0.581 0.754 0.685 9e-65
Q3M726214 ATP-dependent Clp proteas no no 0.581 0.817 0.685 1e-64
C0QGT0205 ATP-dependent Clp proteas yes no 0.621 0.912 0.614 6e-64
P54416198 ATP-dependent Clp proteas N/A no 0.581 0.883 0.651 9e-64
Q2JIP1200 ATP-dependent Clp proteas yes no 0.617 0.93 0.624 1e-63
Q2JV68200 ATP-dependent Clp proteas yes no 0.581 0.875 0.64 9e-63
Q8DLI2229 ATP-dependent Clp proteas yes no 0.581 0.764 0.657 1e-62
>sp|Q9S834|CLPP5_ARATH ATP-dependent Clp protease proteolytic subunit 5, chloroplastic OS=Arabidopsis thaliana GN=CLPP5 PE=1 SV=1 Back     alignment and function desciption
 Score =  421 bits (1082), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/303 (69%), Positives = 246/303 (81%), Gaps = 10/303 (3%)

Query: 1   MAQSCAAALSSTAIFAA-FCNHFPA----ESHSSSLRFSPLRLRKMIVSSNRERKCEKFG 55
           MA +C +  +S+  F A F +  P     +S   SL F PLR RK     +  +  +   
Sbjct: 1   MAHACVSTSASSLRFTAGFVSASPNGSSFDSPKLSLPFEPLRSRKTNKLVSDRKNWKNST 60

Query: 56  VKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNV 115
            KA Y+ +  + +      +G+WSIR+DL+VPSSPY P YAQG+   GPPPM+  RFQ++
Sbjct: 61  PKAVYSGNLWTPEIPSP--QGVWSIRDDLQVPSSPYFPAYAQGQ---GPPPMVQERFQSI 115

Query: 116 LSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDT 175
           +SQLFQ+RIIRCGG V+DDMANIIVAQLLYLDAVDP KDI+MY+NSPGGSVTAGMAIFDT
Sbjct: 116 ISQLFQYRIIRCGGAVDDDMANIIVAQLLYLDAVDPTKDIVMYVNSPGGSVTAGMAIFDT 175

Query: 176 IRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQA 235
           +RHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQ+DID+QA
Sbjct: 176 MRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQTDIDIQA 235

Query: 236 NEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQPV 295
           NEMLHHKANLNGYL+YHTGQ+LEKIN+DTDRDFFMSA+EAK+YGLIDGV+MNP K LQP+
Sbjct: 236 NEMLHHKANLNGYLAYHTGQSLEKINQDTDRDFFMSAKEAKEYGLIDGVIMNPLKALQPL 295

Query: 296 AAA 298
           AAA
Sbjct: 296 AAA 298
Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 9EC: 2
>sp|Q3MFR5|CLPP1_ANAVT ATP-dependent Clp protease proteolytic subunit 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=clpP1 PE=3 SV=1 Back     alignment and function description
>sp|Q8YXH5|CLPP1_NOSS1 ATP-dependent Clp protease proteolytic subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpP1 PE=3 SV=1 Back     alignment and function description
>sp|Q8YQX8|CLPP2_NOSS1 ATP-dependent Clp protease proteolytic subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpP2 PE=3 SV=1 Back     alignment and function description
>sp|Q3M726|CLPP3_ANAVT ATP-dependent Clp protease proteolytic subunit 3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=clpP3 PE=3 SV=2 Back     alignment and function description
>sp|C0QGT0|CLPP_DESAH ATP-dependent Clp protease proteolytic subunit OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=clpP PE=3 SV=1 Back     alignment and function description
>sp|P54416|CLPP1_SYNY3 ATP-dependent Clp protease proteolytic subunit 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpP1 PE=3 SV=1 Back     alignment and function description
>sp|Q2JIP1|CLPP2_SYNJB ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=clpP2 PE=3 SV=1 Back     alignment and function description
>sp|Q2JV68|CLPP2_SYNJA ATP-dependent Clp protease proteolytic subunit 2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=clpP2 PE=3 SV=1 Back     alignment and function description
>sp|Q8DLI2|CLPP1_THEEB ATP-dependent Clp protease proteolytic subunit 1 OS=Thermosynechococcus elongatus (strain BP-1) GN=clpP1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
76262827306 ATP-dependent Clp protease proteolytic s 0.890 0.875 0.751 1e-118
224068558300 predicted protein [Populus trichocarpa] 0.897 0.9 0.75 1e-118
255548433305 ATP-dependent Clp protease proteolytic s 0.906 0.895 0.746 1e-117
449469024306 PREDICTED: ATP-dependent Clp protease pr 0.877 0.862 0.758 1e-116
449484212306 PREDICTED: ATP-dependent Clp protease pr 0.877 0.862 0.758 1e-116
297843050298 hypothetical protein ARALYDRAFT_887394 [ 0.973 0.983 0.693 1e-115
15485610299 Clp protease 2 proteolytic subunit [Sola 0.970 0.976 0.693 1e-115
18378982298 ATP-dependent Clp protease, protease sub 0.973 0.983 0.693 1e-115
363806660304 uncharacterized protein LOC100798621 [Gl 0.853 0.845 0.771 1e-115
225437581289 PREDICTED: ATP-dependent Clp protease pr 0.877 0.913 0.749 1e-115
>gi|76262827|gb|ABA41488.1| ATP-dependent Clp protease proteolytic subunit [Carica papaya] Back     alignment and taxonomy information
 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 206/274 (75%), Positives = 236/274 (86%), Gaps = 6/274 (2%)

Query: 25  ESHSSSLRFSPLRLRKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDL 84
           ES S  L   PLR RK+    + ++K      KA YTS+   L   ES+ +GIWSIR+DL
Sbjct: 30  ESQSLCLPLEPLRSRKLKKLVSNQKKVRNSTAKAVYTSN---LRMPESSHQGIWSIRDDL 86

Query: 85  EVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLL 144
           ++PSSPY P YAQG+   GPPPM+  RFQ+V+SQLFQHRIIRCGG V+DDMANIIVAQLL
Sbjct: 87  QIPSSPYFPAYAQGQ---GPPPMVQERFQSVISQLFQHRIIRCGGAVDDDMANIIVAQLL 143

Query: 145 YLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTK 204
           YLDAVDPNKDI+MY+NSPGGSVTAGMA+FDT+RHIRPDVSTVCVGLAASMGAFLLSAGTK
Sbjct: 144 YLDAVDPNKDIVMYVNSPGGSVTAGMAVFDTMRHIRPDVSTVCVGLAASMGAFLLSAGTK 203

Query: 205 GKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDT 264
           GKRYSLPNSRIMIHQPLGGAQGGQ+DID+QANEMLHHKANLN YL+YHTGQ+LE+IN+DT
Sbjct: 204 GKRYSLPNSRIMIHQPLGGAQGGQTDIDIQANEMLHHKANLNSYLAYHTGQSLERINQDT 263

Query: 265 DRDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAA 298
           DRDFFMSA+EAK+YGLIDGV+MNP K LQP+ A+
Sbjct: 264 DRDFFMSAKEAKEYGLIDGVIMNPLKALQPLTAS 297

Source: Carica papaya

Species: Carica papaya

Genus: Carica

Family: Caricaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224068558|ref|XP_002302770.1| predicted protein [Populus trichocarpa] gi|222844496|gb|EEE82043.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548433|ref|XP_002515273.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223545753|gb|EEF47257.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449469024|ref|XP_004152221.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449484212|ref|XP_004156818.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297843050|ref|XP_002889406.1| hypothetical protein ARALYDRAFT_887394 [Arabidopsis lyrata subsp. lyrata] gi|297335248|gb|EFH65665.1| hypothetical protein ARALYDRAFT_887394 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15485610|emb|CAC67407.1| Clp protease 2 proteolytic subunit [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|18378982|ref|NP_563657.1| ATP-dependent Clp protease, protease subunit [Arabidopsis thaliana] gi|75313059|sp|Q9S834.1|CLPP5_ARATH RecName: Full=ATP-dependent Clp protease proteolytic subunit 5, chloroplastic; AltName: Full=Endopeptidase ClpP5; Short=nClpP5; AltName: Full=nClpP1; Flags: Precursor gi|9972387|gb|AAG10637.1|AC022521_15 ATP-dependent Clp protease subunit ClpP [Arabidopsis thaliana] gi|4887543|emb|CAB43488.1| ATP-dependent Clp protease subunit ClpP [Arabidopsis thaliana] gi|5360579|dbj|BAA82065.1| nClpP1 [Arabidopsis thaliana] gi|21536639|gb|AAM60971.1| ATP-dependent Clp protease proteolytic subunit ClpP5 [Arabidopsis thaliana] gi|89274139|gb|ABD65590.1| At1g02560 [Arabidopsis thaliana] gi|332189323|gb|AEE27444.1| ATP-dependent Clp protease, protease subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|363806660|ref|NP_001242516.1| uncharacterized protein LOC100798621 [Glycine max] gi|255645951|gb|ACU23464.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225437581|ref|XP_002277104.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic isoform 1 [Vitis vinifera] gi|297743987|emb|CBI36957.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
TAIR|locus:2196120298 CLPP5 "nuclear encoded CLP pro 0.734 0.741 0.848 9.8e-103
TIGR_CMR|CHY_0325195 CHY_0325 "ATP-dependent Clp pr 0.581 0.897 0.605 1.1e-55
UNIPROTKB|P63786195 clpP "ATP-dependent Clp protea 0.584 0.902 0.590 2.1e-54
TIGR_CMR|CPS_3785220 CPS_3785 "ATP-dependent Clp pr 0.581 0.795 0.594 2.1e-54
UNIPROTKB|P0A6G7207 clpP [Escherichia coli K-12 (t 0.571 0.830 0.581 8e-53
TIGR_CMR|SO_1794202 SO_1794 "ATP-dependent Clp pro 0.571 0.851 0.622 1.7e-52
TIGR_CMR|VC_1922200 VC_1922 "ATP-dependent Clp pro 0.581 0.875 0.594 2.1e-52
TIGR_CMR|CJE_0185194 CJE_0185 "ATP-dependent Clp pr 0.598 0.927 0.572 4.4e-52
TIGR_CMR|GSU_1792199 GSU_1792 "ATP-dependent Clp pr 0.581 0.879 0.582 4.4e-52
TIGR_CMR|BA_5380193 BA_5380 "ATP-dependent Clp pro 0.588 0.917 0.570 2.4e-51
TAIR|locus:2196120 CLPP5 "nuclear encoded CLP protease 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1018 (363.4 bits), Expect = 9.8e-103, P = 9.8e-103
 Identities = 190/224 (84%), Positives = 213/224 (95%)

Query:    75 KGIWSIRNDLEVPSSPYIPTYAQGEQGGGPPPMLLGRFQNVLSQLFQHRIIRCGGPVEDD 134
             +G+WSIR+DL+VPSSPY P YAQG+   GPPPM+  RFQ+++SQLFQ+RIIRCGG V+DD
Sbjct:    78 QGVWSIRDDLQVPSSPYFPAYAQGQ---GPPPMVQERFQSIISQLFQYRIIRCGGAVDDD 134

Query:   135 MANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVGLAASM 194
             MANIIVAQLLYLDAVDP KDI+MY+NSPGGSVTAGMAIFDT+RHIRPDVSTVCVGLAASM
Sbjct:   135 MANIIVAQLLYLDAVDPTKDIVMYVNSPGGSVTAGMAIFDTMRHIRPDVSTVCVGLAASM 194

Query:   195 GAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTG 254
             GAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQ+DID+QANEMLHHKANLNGYL+YHTG
Sbjct:   195 GAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQTDIDIQANEMLHHKANLNGYLAYHTG 254

Query:   255 QTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAA 298
             Q+LEKIN+DTDRDFFMSA+EAK+YGLIDGV+MNP K LQP+AAA
Sbjct:   255 QSLEKINQDTDRDFFMSAKEAKEYGLIDGVIMNPLKALQPLAAA 298
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009840 "chloroplastic endopeptidase Clp complex" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009532 "plastid stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0000023 "maltose metabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
TIGR_CMR|CHY_0325 CHY_0325 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P63786 clpP "ATP-dependent Clp protease proteolytic subunit" [Staphylococcus aureus subsp. aureus MW2 (taxid:196620)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3785 CPS_3785 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6G7 clpP [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1794 SO_1794 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1922 VC_1922 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0185 CJE_0185 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1792 GSU_1792 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5380 BA_5380 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2JIP1CLPP2_SYNJB3, ., 4, ., 2, 1, ., 9, 20.62430.61790.93yesno
Q7M7M3CLPP_WOLSU3, ., 4, ., 2, 1, ., 9, 20.570.64110.9897yesno
A6Q1C1CLPP_NITSB3, ., 4, ., 2, 1, ., 9, 20.57860.63120.9693yesno
Q48KZ0CLPP_PSE143, ., 4, ., 2, 1, ., 9, 20.56710.64780.9154yesno
O30612CLPP2_MYXXD3, ., 4, ., 2, 1, ., 9, 20.59780.62450.9261yesno
Q5QXN8CLPP_IDILO3, ., 4, ., 2, 1, ., 9, 20.54410.65440.9563yesno
Q4ZVM7CLPP_PSEU23, ., 4, ., 2, 1, ., 9, 20.56710.64780.9154yesno
A5W635CLPP_PSEP13, ., 4, ., 2, 1, ., 9, 20.5750.64450.9107yesno
Q9S834CLPP5_ARATH3, ., 4, ., 2, 1, ., 9, 20.69300.97340.9832yesno
Q3SI98CLPP_THIDA3, ., 4, ., 2, 1, ., 9, 20.58850.61790.8773yesno
B0KJG6CLPP_PSEPG3, ., 4, ., 2, 1, ., 9, 20.570.64450.9107yesno
Q3MFR5CLPP1_ANAVT3, ., 4, ., 2, 1, ., 9, 20.66660.60790.8970yesno
Q8YXH5CLPP1_NOSS13, ., 4, ., 2, 1, ., 9, 20.66120.60790.8970yesno
Q88KJ0CLPP_PSEPK3, ., 4, ., 2, 1, ., 9, 20.5750.64450.9107yesno
B1J692CLPP_PSEPW3, ., 4, ., 2, 1, ., 9, 20.570.64450.9107yesno
Q87YR6CLPP_PSESM3, ., 4, ., 2, 1, ., 9, 20.56710.64780.9154yesno
C0QGT0CLPP_DESAH3, ., 4, ., 2, 1, ., 9, 20.61490.62120.9121yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.976
3rd Layer3.4.21.920.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
PRK00277200 PRK00277, clpP, ATP-dependent Clp protease proteol 1e-114
pfam00574182 pfam00574, CLP_protease, Clp protease 1e-105
cd07017171 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) 1e-104
TIGR00493192 TIGR00493, clpP, ATP-dependent Clp endopeptidase, 4e-95
COG0740200 COG0740, ClpP, Protease subunit of ATP-dependent C 3e-93
PRK12553207 PRK12553, PRK12553, ATP-dependent Clp protease pro 2e-91
PRK12551196 PRK12551, PRK12551, ATP-dependent Clp protease pro 1e-85
CHL00028200 CHL00028, clpP, ATP-dependent Clp protease proteol 2e-78
PRK14514221 PRK14514, PRK14514, ATP-dependent Clp protease pro 5e-72
cd07013162 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is 1e-66
PRK14513201 PRK14513, PRK14513, ATP-dependent Clp protease pro 4e-65
PRK12552222 PRK12552, PRK12552, ATP-dependent Clp protease-lik 1e-60
PRK14512197 PRK14512, PRK14512, ATP-dependent Clp protease pro 7e-53
cd00394161 cd00394, Clp_protease_like, Caseinolytic protease 9e-44
cd07016160 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) 5e-31
COG0616317 COG0616, SppA, Periplasmic serine proteases (ClpP 2e-05
cd07015172 cd07015, Clp_protease_NfeD, Nodulation formation e 9e-05
cd07023208 cd07023, S49_Sppa_N_C, Signal peptide peptidase A 3e-04
>gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information 
 Score =  326 bits (839), Expect = e-114
 Identities = 117/175 (66%), Positives = 145/175 (82%)

Query: 111 RFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGM 170
           R  ++ S+L + RII  GG VED MAN+IVAQLL+L+A DP+KDI +Y+NSPGGSVTAG+
Sbjct: 20  RSYDIYSRLLKERIIFLGGEVEDHMANLIVAQLLFLEAEDPDKDIYLYINSPGGSVTAGL 79

Query: 171 AIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSD 230
           AI+DT++ I+PDVST+C+G AASMGAFLL+AG KGKR++LPNSRIMIHQPLGG QG  +D
Sbjct: 80  AIYDTMQFIKPDVSTICIGQAASMGAFLLAAGAKGKRFALPNSRIMIHQPLGGFQGQATD 139

Query: 231 IDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVV 285
           I++ A E+L  K  LN  L+ HTGQ LEKI +DTDRD FMSAEEAK+YGLID V+
Sbjct: 140 IEIHAREILKLKKRLNEILAEHTGQPLEKIEKDTDRDNFMSAEEAKEYGLIDEVL 194

Length = 200
>gnl|CDD|201316 pfam00574, CLP_protease, Clp protease Back     alignment and domain information
>gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic subunit ClpP Back     alignment and domain information
>gnl|CDD|223811 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237133 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|214340 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>gnl|CDD|184722 PRK14514, PRK14514, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|237742 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|183588 PRK12552, PRK12552, ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|237741 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>gnl|CDD|223689 COG0616, SppA, Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|132926 cd07015, Clp_protease_NfeD, Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>gnl|CDD|132934 cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 301
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 100.0
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 100.0
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 100.0
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 100.0
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 100.0
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 100.0
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 100.0
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 100.0
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 100.0
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 100.0
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 100.0
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 100.0
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 100.0
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.97
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.96
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.95
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 99.88
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.88
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.87
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.86
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.86
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.84
PRK10949618 protease 4; Provisional 99.84
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.82
PRK11778330 putative inner membrane peptidase; Provisional 99.79
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 99.78
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 99.76
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 99.6
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 99.44
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 99.42
PRK10949 618 protease 4; Provisional 99.33
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 98.99
PRK05869222 enoyl-CoA hydratase; Validated 98.75
PRK06688259 enoyl-CoA hydratase; Provisional 98.74
PRK08258277 enoyl-CoA hydratase; Provisional 98.72
PRK06495257 enoyl-CoA hydratase; Provisional 98.71
PRK03580261 carnitinyl-CoA dehydratase; Provisional 98.69
COG3904245 Predicted periplasmic protein [Function unknown] 98.68
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.67
PRK07509262 enoyl-CoA hydratase; Provisional 98.66
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.66
PRK06190258 enoyl-CoA hydratase; Provisional 98.64
PRK06142272 enoyl-CoA hydratase; Provisional 98.63
PRK05981266 enoyl-CoA hydratase; Provisional 98.62
PRK07658257 enoyl-CoA hydratase; Provisional 98.62
PRK07511260 enoyl-CoA hydratase; Provisional 98.61
PRK06210272 enoyl-CoA hydratase; Provisional 98.61
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 98.6
PRK06143256 enoyl-CoA hydratase; Provisional 98.6
PRK09076258 enoyl-CoA hydratase; Provisional 98.59
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 98.59
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 98.59
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 98.57
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 98.57
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 98.57
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 98.56
PRK05980260 enoyl-CoA hydratase; Provisional 98.56
PRK07938249 enoyl-CoA hydratase; Provisional 98.56
PLN02600251 enoyl-CoA hydratase 98.56
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 98.56
PRK08260296 enoyl-CoA hydratase; Provisional 98.55
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 98.55
PRK08139266 enoyl-CoA hydratase; Validated 98.55
PRK06023251 enoyl-CoA hydratase; Provisional 98.54
PLN02888265 enoyl-CoA hydratase 98.54
PRK08150255 enoyl-CoA hydratase; Provisional 98.54
PLN02921327 naphthoate synthase 98.54
PRK08138261 enoyl-CoA hydratase; Provisional 98.53
PRK06127269 enoyl-CoA hydratase; Provisional 98.52
PRK07327268 enoyl-CoA hydratase; Provisional 98.52
PRK07468262 enoyl-CoA hydratase; Provisional 98.52
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.52
PRK05995262 enoyl-CoA hydratase; Provisional 98.52
PRK09245266 enoyl-CoA hydratase; Provisional 98.52
PRK05864276 enoyl-CoA hydratase; Provisional 98.51
PRK06494259 enoyl-CoA hydratase; Provisional 98.5
PLN02267239 enoyl-CoA hydratase/isomerase family protein 98.5
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 98.5
PRK07854243 enoyl-CoA hydratase; Provisional 98.5
PRK06072248 enoyl-CoA hydratase; Provisional 98.5
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.49
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.49
PRK08290288 enoyl-CoA hydratase; Provisional 98.49
PRK06144262 enoyl-CoA hydratase; Provisional 98.49
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.49
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 98.48
PRK07260255 enoyl-CoA hydratase; Provisional 98.47
PRK08321302 naphthoate synthase; Validated 98.47
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.47
PRK06563255 enoyl-CoA hydratase; Provisional 98.46
PRK07827260 enoyl-CoA hydratase; Provisional 98.46
PRK08252254 enoyl-CoA hydratase; Provisional 98.46
PRK05870249 enoyl-CoA hydratase; Provisional 98.46
PRK05862257 enoyl-CoA hydratase; Provisional 98.46
PRK07657260 enoyl-CoA hydratase; Provisional 98.46
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 98.43
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.43
PRK08788287 enoyl-CoA hydratase; Validated 98.43
PRK08140262 enoyl-CoA hydratase; Provisional 98.42
PRK06213229 enoyl-CoA hydratase; Provisional 98.41
PRK08259254 enoyl-CoA hydratase; Provisional 98.4
PRK08272302 enoyl-CoA hydratase; Provisional 98.39
PRK07799263 enoyl-CoA hydratase; Provisional 98.39
PRK07659260 enoyl-CoA hydratase; Provisional 98.38
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 98.37
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 98.36
PRK12478298 enoyl-CoA hydratase; Provisional 98.33
TIGR03200 360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 98.31
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 98.25
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 98.24
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.21
PRK05617 342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 98.15
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.13
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.12
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.11
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.1
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 98.1
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 98.09
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 98.09
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 98.09
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 98.06
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.04
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 97.79
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 97.73
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.66
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 97.62
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 97.37
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 97.26
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 97.25
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 97.21
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 97.19
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 97.04
PRK07189301 malonate decarboxylase subunit beta; Reviewed 96.71
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 96.49
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 96.27
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 96.17
PF06833234 MdcE: Malonate decarboxylase gamma subunit (MdcE); 95.89
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 95.37
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 94.43
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 92.81
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 91.6
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 91.37
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 90.11
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 86.62
PF08496155 Peptidase_S49_N: Peptidase family S49 N-terminal; 82.86
cd06567224 Peptidase_S41 C-terminal processing peptidase fami 81.59
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.5e-64  Score=458.27  Aligned_cols=256  Identities=48%  Similarity=0.741  Sum_probs=230.7

Q ss_pred             ccccccccchhhhhhhhhcccccccccccceeeeecCCCcccccCcccCccceeeccCCCCCCCCCccccccCCCCCCCC
Q 022161           26 SHSSSLRFSPLRLRKMIVSSNRERKCEKFGVKAAYTSDYSSLDDCESTWKGIWSIRNDLEVPSSPYIPTYAQGEQGGGPP  105 (301)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  105 (301)
                      +.++...+.|...++|.+....+|..++++-++++++.-|++        +.|+++.+..+|.   ++....+   +|  
T Consensus        15 ~~~~~~~l~P~~~~~~~~~~~~~r~~~~~~~~s~~sg~~~~~--------~~~~~~~~~~~p~---~~~~~~~---rG--   78 (275)
T KOG0840|consen   15 SPKRFSGLNPASTSNFPKQRNVRRQLKSSTPKSLRSGGSSNS--------RGWSLRAPILVPR---FPIESPG---RG--   78 (275)
T ss_pred             ccchhcccCchhhhhccccccchhhhhccCcccccccCCCCC--------CcccccccccCCc---ceeeccc---cC--
Confidence            555666777888888887777777777777788888887763        3799999999983   3322222   33  


Q ss_pred             CccchhhcchhhhhcCCcEEEEccccChhHHHHHHHHHHhhhhcCCCCceEEEEcCCCCcHHHHHHHHHHHHhhCCCeEE
Q 022161          106 PMLLGRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVST  185 (301)
Q Consensus       106 p~~~~~~~dv~s~L~~~rII~L~G~Idd~~a~~iiaqL~~L~~~d~~k~I~L~INSPGGsV~ag~aIyd~m~~~~~pV~T  185 (301)
                         .++++|+||+||++|||||+++|||++++.|++||+||+.+|+.|+|+||||||||++++|++|||+|+++++||.|
T Consensus        79 ---~~~~~Di~s~LlreRIi~lg~~Idd~va~~viaqlL~Ld~ed~~K~I~lyINSPGG~vtaglAIYDtMq~ik~~V~T  155 (275)
T KOG0840|consen   79 ---RERPYDIYSRLLRERIVFLGQPIDDDVANLVIAQLLYLDSEDPKKPIYLYINSPGGSVTAGLAIYDTMQYIKPDVST  155 (275)
T ss_pred             ---CCCcccHHHHHHHhheeeeCCcCcHHHHHHHHHHHHHhhccCCCCCeEEEEeCCCCccchhhhHHHHHHhhCCCcee
Confidence               36788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcCccchHhHHHHhcCCCCceEecCCeEEEeecCCCCCCCCCcchHHHHHHHHHHHHHHHHHHHHhhCCCHHHHHhhhc
Q 022161          186 VCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTD  265 (301)
Q Consensus       186 vv~G~AASaaa~Il~aG~kgkR~a~PnS~imIHqp~~g~~G~~~di~~~akel~~~k~~~~~i~A~~tG~s~e~I~~~~~  265 (301)
                      +|.|+|||+|++|+++|.||+|+++||+++|||||.+++.|++.|+.++++|+.++++.+.++|++|||++.|+|.++++
T Consensus       156 ic~G~Aas~aalLLaaG~KG~R~alPnsriMIhQP~gga~Gqa~Di~i~akE~~~~k~~l~~i~a~~Tgq~~e~i~~d~d  235 (275)
T KOG0840|consen  156 ICVGLAASMAALLLAAGAKGKRYALPNSRIMIHQPSGGAGGQATDIVIQAKELMRIKEYLNEIYAKHTGQPLEVIEKDMD  235 (275)
T ss_pred             eehhhHHhHHHHHHhcCCCcceeecCCceeEEeccCCCcCccchHHHHHHHHHHHHHHHHHHHHHHhcCCcHHHHHhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccCHHHHHHcCCceeecCCccccchhhHhhcC
Q 022161          266 RDFFMSAEEAKDYGLIDGVVMNPHKILQPVAAAAG  300 (301)
Q Consensus       266 rd~~lTa~EA~e~GLID~I~~~~~~al~~~~~~~~  300 (301)
                      ||+||+|+||+||||||+|++++.+.......+.|
T Consensus       236 Rd~fmsa~EA~eyGliD~v~~~p~~~~~~~~~~~e  270 (275)
T KOG0840|consen  236 RDRFMSAEEAKEYGLIDKVIDHPPETRVDDGTLVE  270 (275)
T ss_pred             ccccCCHHHHHHhcchhhhhcCCcccccccchhhh
Confidence            99999999999999999999988888776655544

>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>COG3904 Predicted periplasmic protein [Function unknown] Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PF06833 MdcE: Malonate decarboxylase gamma subunit (MdcE); InterPro: IPR009648 This family consists of several bacterial malonate decarboxylase gamma subunit proteins Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>PF08496 Peptidase_S49_N: Peptidase family S49 N-terminal; InterPro: IPR013703 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd06567 Peptidase_S41 C-terminal processing peptidase family S41 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
3qwd_A203 Crystal Structure Of Clpp From Staphylococcus Aureu 2e-60
3st9_A197 Crystal Structure Of Clpp In Heptameric Form From S 2e-60
3v5i_A203 The Crystal Structure Of The Mutant Clpp S98a (Stap 4e-60
2zl0_A196 Crystal Structure Of H.Pylori Clpp Length = 196 3e-59
2zl3_A196 Crystal Structure Of H.Pylori Clpp S99a Length = 19 6e-59
1yg8_A193 The Structure Of A V6a Variant Of Clpp. Length = 19 9e-59
1tyf_A193 The Structure Of Clpp At 2.3 Angstrom Resolution Su 1e-58
3mt6_R207 Structure Of Clpp From Escherichia Coli In Complex 1e-58
3hln_A193 Crystal Structure Of Clpp A153c Mutant With Inter-H 4e-58
3tt6_A196 Structure Of Clpp From Bacillus Subtilis In Compres 3e-57
3tt7_A197 Structure Of Clpp From Bacillus Subtilis In Complex 4e-57
3ktg_A199 Structure Of Clpp From Bacillus Subtilis In Monocli 4e-57
3kti_A199 Structure Of Clpp In Complex With Adep1 Length = 19 7e-57
3p2l_A201 Crystal Structure Of Atp-Dependent Clp Protease Sub 1e-49
1tg6_A277 Crystallography And Mutagenesis Point To An Essenti 6e-46
2ce3_A200 Crystal Structure Of The Atp-Dependent Clp Protease 5e-44
2cby_A208 Crystal Structure Of The Atp-Dependent Clp Protease 5e-44
2c8t_A206 The 3.0 A Resolution Structure Of Caseinolytic Clp 1e-43
2f6i_A215 Crystal Structure Of The Clpp Protease Catalytic Do 2e-43
3q7h_A195 Structure Of The Clpp Subunit Of The Atp-Dependent 8e-41
1y7o_A218 The Structure Of Streptococcus Pneumoniae A153p Clp 1e-38
4hnk_A219 Crystal Structure Of An Enzyme Length = 219 2e-19
4gm2_A205 The Crystal Structure Of A Peptidase From Plasmodiu 5e-19
>pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus Length = 203 Back     alignment and structure 
Iteration: 1

 Score =  229 bits (584), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/184 (57%), Positives = 144/184 (78%)
Query: 111 RFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGM 170
           R  ++ S+L + RII  G  ++D++AN IV+QLL+L A D  KDI +Y+NSPGGSVTAG 
Sbjct: 16  RAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGF 75
Query: 171 AIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSD 230
           AI+DTI+HI+PDV T+C+G+AASMG+FLL+AG KGKR++LPN+ +MIHQPLGGAQG  ++
Sbjct: 76  AIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATE 135
Query: 231 IDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVVMNPHK 290
           I++ AN +L  +  LN  LS  TGQ++EKI +DTDRD F++AEEAK+YGLID V++   K
Sbjct: 136 IEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK 195
Query: 291 ILQP 294
              P
Sbjct: 196 WSHP 199
>pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From Staphylococcus Aureus Length = 197 Back     alignment and structure
>pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a (Staphylococcus Aureus) Length = 203 Back     alignment and structure
>pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 Back     alignment and structure
>pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 Back     alignment and structure
>pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 Back     alignment and structure
>pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 Back     alignment and structure
>pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 Back     alignment and structure
>pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 Back     alignment and structure
>pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed State Length = 196 Back     alignment and structure
>pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With Dfp Length = 197 Back     alignment and structure
>pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 Back     alignment and structure
>pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 Back     alignment and structure
>pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 Back     alignment and structure
>pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N- Terminus Of Human Mitochondrial Clpp Length = 277 Back     alignment and structure
>pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 Back     alignment and structure
>pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 Back     alignment and structure
>pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 Back     alignment and structure
>pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 Back     alignment and structure
>pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 Back     alignment and structure
>pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 Back     alignment and structure
>pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme Length = 219 Back     alignment and structure
>pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium Falciparum Length = 205 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 1e-116
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 1e-114
2f6i_A215 ATP-dependent CLP protease, putative; structural g 1e-114
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 1e-113
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 1e-113
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 1e-111
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 1e-109
3viv_A230 441AA long hypothetical NFED protein; protein-pept 3e-39
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 Back     alignment and structure
 Score =  331 bits (850), Expect = e-116
 Identities = 83/174 (47%), Positives = 120/174 (68%)

Query: 112 FQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMA 171
             +V  +L   RII  G  V D++AN + AQ+L L A D +KDI +Y+NSPGGS++AGMA
Sbjct: 17  TDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAGMA 76

Query: 172 IFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDI 231
           I+DT+     D++T  +G+AASMG FLL+AGTKGKRY+LP++RI++HQPLGG  G  +DI
Sbjct: 77  IYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAADI 136

Query: 232 DLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVV 285
            +QA +    K  +    +  TGQ +E+I  D+DRD + +A EA +YG +D ++
Sbjct: 137 AIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHII 190
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Length = 203 Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Length = 193 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 100.0
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 100.0
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 100.0
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 100.0
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 100.0
2f6i_A215 ATP-dependent CLP protease, putative; structural g 100.0
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 100.0
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 100.0
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.97
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 99.91
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.88
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.83
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 98.98
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 98.98
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 98.95
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 98.89
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 98.88
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 98.88
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 98.87
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 98.87
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 98.86
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 98.83
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 98.83
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 98.79
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 98.78
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 98.78
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 98.77
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 98.77
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 98.76
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 98.75
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 98.75
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 98.74
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 98.74
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 98.73
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 98.71
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 98.7
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 98.7
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 98.68
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 98.67
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 98.66
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 98.66
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 98.66
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 98.65
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 98.64
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 98.64
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 98.63
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 98.63
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 98.62
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 98.62
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 98.62
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 98.62
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 98.61
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 98.61
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 98.61
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 98.61
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 98.6
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 98.59
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.59
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.59
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 98.59
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 98.58
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 98.58
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 98.58
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 98.56
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 98.55
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 98.55
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 98.54
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 98.54
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 98.53
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 98.51
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 98.48
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 98.47
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 98.47
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 98.46
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 98.45
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 98.45
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 98.44
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 98.44
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 98.42
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 98.41
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 98.4
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.39
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 98.38
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 98.38
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 98.35
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 98.34
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 98.33
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 98.29
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.24
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 98.18
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.14
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 98.06
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 98.05
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 98.04
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 97.97
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 97.94
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.92
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 97.8
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 97.79
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 97.67
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 97.62
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 97.46
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 96.96
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 96.33
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 95.96
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 95.75
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 95.52
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 95.37
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 95.26
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 95.13
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 94.6
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 94.23
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 93.52
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 92.78
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 89.67
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
Probab=100.00  E-value=9.3e-55  Score=390.46  Aligned_cols=178  Identities=31%  Similarity=0.485  Sum_probs=169.6

Q ss_pred             hhhcchhhhhcCCcEEEEccccChhHHHHHHHHHHhhhhcCCCCceEEEEcCCC----------CcHHHHHHHHHHHHhh
Q 022161          110 GRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPG----------GSVTAGMAIFDTIRHI  179 (301)
Q Consensus       110 ~~~~dv~s~L~~~rII~L~G~Idd~~a~~iiaqL~~L~~~d~~k~I~L~INSPG----------GsV~ag~aIyd~m~~~  179 (301)
                      ++++|+|++||++|||||+|+||+++++.|++||++|+.+++.++|.|||||||          |+|++|++|||+|+++
T Consensus        16 ~~~~di~s~Ll~~Riifl~~~I~d~~a~~iiaqLl~L~~ed~~k~I~lyINSpG~~~~~~~~~~G~v~aglaIyd~m~~~   95 (205)
T 4gm2_A           16 NLYFQGPSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGITDVISIVDVINYI   95 (205)
T ss_dssp             ------CHHHHTTTEEEECSCCCHHHHHHHHHHHHHHHHHCTTCCEEEEEEECTTEETTEESCTTHHHHHHHHHHHHHHS
T ss_pred             CCCcCHHHHHhcCCEEEECCEEcHHHHHHHHHHHHHHHhcCCCCCEEEEEeCCCCCCcCCCCCCCCHHHHHHHHHHHHhc
Confidence            678899999999999999999999999999999999999999999999999999          9999999999999999


Q ss_pred             CCCeEEEEcCccchHhHHHHhcCCCCceEecCCeEEEeecCCCCC-CCCCcchHHHHHHHHHHHHHHHHHHHHhhCCCHH
Q 022161          180 RPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGA-QGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLE  258 (301)
Q Consensus       180 ~~pV~Tvv~G~AASaaa~Il~aG~kgkR~a~PnS~imIHqp~~g~-~G~~~di~~~akel~~~k~~~~~i~A~~tG~s~e  258 (301)
                      ++||+|+|.|+|||||++|+++|++|+|+++|||++|||||+++. .|++.|+++++++++++++.+.++|+++||++.|
T Consensus        96 ~~~V~t~~~G~AaS~as~il~aG~~gkR~~lP~a~iMIHqP~~~~~~G~a~di~i~a~el~~~~~~i~~iya~~TG~~~e  175 (205)
T 4gm2_A           96 SSDVYTYCLGKAYGIACILASSGKKGYRFSLKNSSFCLNQSYSIIPFNQATNIEIQNKEIMNTKKKVIEIISKNTEKDTN  175 (205)
T ss_dssp             SSCEEEEEEEEEETHHHHHHTTSCTTCEEECTTCEEEECCCCCCCCSSCCSCHHHHHHHHHHHHHHHHHHHHHHHTCCHH
T ss_pred             CCCEEEEEEeeehhHHHHHHhcCCCCCEEecCCCEEEEecCcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHH
Confidence            999999999999999999999999999999999999999999998 9999999999999999999999999999999999


Q ss_pred             HHHhhhcCCcccCHHHHHHcCCceeecCC
Q 022161          259 KINEDTDRDFFMSAEEAKDYGLIDGVVMN  287 (301)
Q Consensus       259 ~I~~~~~rd~~lTa~EA~e~GLID~I~~~  287 (301)
                      +|.+++++|+||||+||++|||||+|+++
T Consensus       176 ~I~~~m~rd~~msa~EA~eyGlID~V~~~  204 (205)
T 4gm2_A          176 VISNVLERDKYFNADEAVDFKLIDHILEK  204 (205)
T ss_dssp             HHHHHTTSCEEEEHHHHHHTTSCSEECCC
T ss_pred             HHHHHhcCCcccCHHHHHHcCCccEeecC
Confidence            99999999999999999999999999864
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 301
d1yg6a1183 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Es 2e-78
d1tg6a1193 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Hum 2e-68
d2cbya1179 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {My 4e-67
d1y7oa1192 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str 1e-57
d2f6ia1190 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {P 2e-54
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Escherichia coli [TaxId: 562]

 Score =  234 bits (598), Expect = 2e-78
 Identities = 101/175 (57%), Positives = 139/175 (79%)

Query: 111 RFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGM 170
           R  ++ S+L + R+I   G VED MAN+IVAQ+L+L+A +P KDI +Y+NSPGG +TAGM
Sbjct: 5   RSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGM 64

Query: 171 AIFDTIRHIRPDVSTVCVGLAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSD 230
           +I+DT++ I+PDVST+C+G AASMGAFLL+AG KGKR+ LPNSR+MIHQPLGG QG  +D
Sbjct: 65  SIYDTMQFIKPDVSTICMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATD 124

Query: 231 IDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFFMSAEEAKDYGLIDGVV 285
           I++ A E+L  K  +N  ++ HTGQ+LE+I  DT+RD F+SA EA +YGL+D ++
Sbjct: 125 IEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSIL 179
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 100.0
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 100.0
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 100.0
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 100.0
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 100.0
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.78
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 98.69
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 98.68
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 98.64
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.64
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 98.59
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 98.58
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 98.57
d1wdka4 310 Fatty oxidation complex alpha subunit, N-terminal 98.5
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 98.46
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.46
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 98.44
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 98.36
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 98.35
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 98.32
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 98.18
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 97.97
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.85
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 97.78
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 97.72
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 97.62
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 97.12
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 96.88
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 96.79
d1uyra2 404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 96.78
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 96.27
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 95.75
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 95.65
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 84.69
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Clp protease, ClpP subunit
domain: Clp protease, ClpP subunit
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

Probab=100.00  E-value=2.2e-53  Score=375.75  Aligned_cols=180  Identities=48%  Similarity=0.794  Sum_probs=174.2

Q ss_pred             hhhcchhhhhcCCcEEEEccccChhHHHHHHHHHHhhhhcCCCCceEEEEcCCCCcHHHHHHHHHHHHhhCCCeEEEEcC
Q 022161          110 GRFQNVLSQLFQHRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYLNSPGGSVTAGMAIFDTIRHIRPDVSTVCVG  189 (301)
Q Consensus       110 ~~~~dv~s~L~~~rII~L~G~Idd~~a~~iiaqL~~L~~~d~~k~I~L~INSPGGsV~ag~aIyd~m~~~~~pV~Tvv~G  189 (301)
                      |+++|+||+|+++|||||+|+||+++++.++++|++|+.+++.++|.||||||||++++|++|||+|+.++.+|+|+|.|
T Consensus        14 ~~~~Di~s~l~~~Riifl~g~I~~~~~~~~i~~l~~l~~~~~~~~I~l~InS~GG~v~~g~~i~d~i~~~~~~V~tv~~G   93 (193)
T d1tg6a1          14 ERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVG   93 (193)
T ss_dssp             ---CBHHHHHHTTTEEEEESSBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHHHHHHHHHHSCSCEEEEEEE
T ss_pred             chhhhHhHHHhccCEEEECCEEchHHHHHHHHHHHHhcccCCCcEEEEEeecCcccHHHHHHHHHHHHhhcCceEEEEcc
Confidence            67889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchHhHHHHhcCCCCceEecCCeEEEeecCCCCCCCCCcchHHHHHHHHHHHHHHHHHHHHhhCCCHHHHHhhhcCCcc
Q 022161          190 LAASMGAFLLSAGTKGKRYSLPNSRIMIHQPLGGAQGGQSDIDLQANEMLHHKANLNGYLSYHTGQTLEKINEDTDRDFF  269 (301)
Q Consensus       190 ~AASaaa~Il~aG~kgkR~a~PnS~imIHqp~~g~~G~~~di~~~akel~~~k~~~~~i~A~~tG~s~e~I~~~~~rd~~  269 (301)
                      +|||||++|+++|++|+|++.|||++|+|||+++..|+..|++++++++.++++.+.++|+++||++.++|++++++|+|
T Consensus        94 ~aaS~a~~il~aG~~g~R~~~pns~~miHq~~~~~~G~~~di~~~~~el~~~~~~i~~i~a~~Tg~~~~~i~~~~~rD~~  173 (193)
T d1tg6a1          94 QAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRY  173 (193)
T ss_dssp             EEETHHHHHHHTSCTTCEEECTTCEEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHSSCEE
T ss_pred             chHHHHHHHhhcCccCccccCcccHHHhcCCccCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHhccCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCHHHHHHcCCceeecCCcc
Q 022161          270 MSAEEAKDYGLIDGVVMNPH  289 (301)
Q Consensus       270 lTa~EA~e~GLID~I~~~~~  289 (301)
                      |+|+||++|||||+|++++.
T Consensus       174 lta~EAl~yGliD~Ii~~~p  193 (193)
T d1tg6a1         174 MSPMEAQEFGILDKVLVHPP  193 (193)
T ss_dssp             ECHHHHHHHTSCSEECSSCC
T ss_pred             CCHHHHHHcCCCCEEccCCC
Confidence            99999999999999998863
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure