Citrus Sinensis ID: 022164

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-
MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
cccccccHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHccccHHHHHccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccEEEEccEEEcccccEEcccEEEEccccEEEEccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcc
ccccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHEccccHHHHHHHHc
mvketeyydvlgvsptaseAEIKKAYYIKARkvhpdknpndplaAQNFQVLGEAYQvlsdpaqrqaydaygksgisteaiiDPAAIFAMLFGSELFEDYIGQLAMASVAsldiftegeefdAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
mvketeyydvlgvsptaseaeIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTeeeleeYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
******YYDVLGVS*****AEIKKAYYIKAR*************AQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEF*******************LADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQ***********************SHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAY*
*VKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKS************IFAMLFGSELFEDYIGQLA************************MKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAE***************LNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATG*******************************SHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
****TEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEFDxxxxxxxxxxxxxxxxxxxxxILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYLWFLAYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query301 2.2.26 [Sep-21-2011]
Q8GYX8398 Chaperone protein dnaJ 10 no no 0.953 0.721 0.840 1e-138
P39101391 Protein CAJ1 OS=Saccharom yes no 0.946 0.728 0.286 7e-30
P40564 432 DnaJ-like protein 1 OS=Sa no no 0.348 0.243 0.537 1e-24
O59731355 Uncharacterized J domain- yes no 0.950 0.805 0.272 4e-21
Q10209392 Uncharacterized J domain- no no 0.913 0.701 0.261 2e-19
Q2S030388 Chaperone protein DnaJ OS yes no 0.239 0.185 0.555 2e-17
Q8WW22397 DnaJ homolog subfamily A yes no 0.299 0.226 0.479 5e-17
Q823T2392 Chaperone protein DnaJ OS yes no 0.229 0.176 0.608 7e-17
Q96EY1480 DnaJ homolog subfamily A no no 0.312 0.195 0.440 7e-17
Q9JMC3397 DnaJ homolog subfamily A yes no 0.299 0.226 0.479 8e-17
>sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 Back     alignment and function desciption
 Score =  492 bits (1267), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 271/288 (94%), Gaps = 1/288 (0%)

Query: 1   MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSD 60
           MVKETEYYDVLGVSPTA+E+EIKKAYYIKAR+VHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct: 1   MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD 60

Query: 61  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEF 120
             QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMAS+ASLDIFTEG++F
Sbjct: 61  SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQF 120

Query: 121 DAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDML 180
           D KK+Q+K+++VQKERE+KLA IL+ RLN+YV  NK++FI+ AEAEV+RLSNAAYGVDML
Sbjct: 121 DTKKIQEKLRIVQKEREDKLAQILKDRLNEYVI-NKDEFISNAEAEVARLSNAAYGVDML 179

Query: 181 NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK 240
           NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQ+TAATGA AL QLQE+MK+
Sbjct: 180 NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR 239

Query: 241 QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVV 288
           QL+ EGNYTEEELEEY+Q+HK++MIDSLWKLNVADIEATL RVCQ+V+
Sbjct: 240 QLNTEGNYTEEELEEYLQAHKRVMIDSLWKLNVADIEATLCRVCQLVL 287
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 Back     alignment and function description
>sp|P40564|DJP1_YEAST DnaJ-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DJP1 PE=1 SV=1 Back     alignment and function description
>sp|O59731|YHXB_SCHPO Uncharacterized J domain-containing protein C3E7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3E7.11c PE=3 SV=1 Back     alignment and function description
>sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 Back     alignment and function description
>sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 Back     alignment and function description
>sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q96EY1|DNJA3_HUMAN DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens GN=DNAJA3 PE=1 SV=2 Back     alignment and function description
>sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
225457731 405 PREDICTED: chaperone protein dnaJ 10 [Vi 0.956 0.711 0.930 1e-158
255539400400 Chaperone protein dnaJ, putative [Ricinu 0.953 0.717 0.944 1e-157
356497524395 PREDICTED: chaperone protein dnaJ 10-lik 0.956 0.729 0.927 1e-156
224086162 414 predicted protein [Populus trichocarpa] 0.956 0.695 0.873 1e-150
115479909395 Os09g0493800 [Oryza sativa Japonica Grou 0.956 0.729 0.833 1e-140
357159134395 PREDICTED: chaperone protein dnaJ 10-lik 0.956 0.729 0.826 1e-140
222640884 689 hypothetical protein OsJ_27983 [Oryza sa 0.956 0.417 0.809 1e-138
115477372394 Os08g0522600 [Oryza sativa Japonica Grou 0.956 0.730 0.809 1e-137
297842429398 DNAJ heat shock N-terminal domain-contai 0.953 0.721 0.840 1e-137
297850538391 DNAJ heat shock N-terminal domain-contai 0.950 0.731 0.822 1e-137
>gi|225457731|ref|XP_002278176.1| PREDICTED: chaperone protein dnaJ 10 [Vitis vinifera] gi|297745644|emb|CBI40809.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/288 (93%), Positives = 287/288 (99%)

Query: 1   MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSD 60
           MVKETEYYDVLG+SP+A+EAEIKKAYYIKAR+VHPDKNPNDPLAAQNFQVLGEAYQVLSD
Sbjct: 1   MVKETEYYDVLGISPSATEAEIKKAYYIKARQVHPDKNPNDPLAAQNFQVLGEAYQVLSD 60

Query: 61  PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEF 120
           P+QRQAYDA+GKSGIST++II+PAAIFAMLFGSELFE+YIGQLAMAS+ASLDIFTEGE+F
Sbjct: 61  PSQRQAYDAHGKSGISTDSIIEPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEQF 120

Query: 121 DAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDML 180
           DAKKLQ+KM+VVQKEREEKLADIL+ RLNQYVQGNKEDF+N+AEAE+SRLSNAAYGVDML
Sbjct: 121 DAKKLQEKMRVVQKEREEKLADILKDRLNQYVQGNKEDFVNHAEAELSRLSNAAYGVDML 180

Query: 181 NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK 240
           NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK
Sbjct: 181 NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK 240

Query: 241 QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVV 288
           QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMV+
Sbjct: 241 QLSAEGNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVL 288

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255539400|ref|XP_002510765.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223551466|gb|EEF52952.1| Chaperone protein dnaJ, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356497524|ref|XP_003517610.1| PREDICTED: chaperone protein dnaJ 10-like [Glycine max] Back     alignment and taxonomy information
>gi|224086162|ref|XP_002307837.1| predicted protein [Populus trichocarpa] gi|222857286|gb|EEE94833.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115479909|ref|NP_001063548.1| Os09g0493800 [Oryza sativa Japonica Group] gi|113631781|dbj|BAF25462.1| Os09g0493800 [Oryza sativa Japonica Group] gi|215740574|dbj|BAG97230.1| unnamed protein product [Oryza sativa Japonica Group] gi|218202387|gb|EEC84814.1| hypothetical protein OsI_31884 [Oryza sativa Indica Group] gi|222641844|gb|EEE69976.1| hypothetical protein OsJ_29869 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357159134|ref|XP_003578350.1| PREDICTED: chaperone protein dnaJ 10-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|222640884|gb|EEE69016.1| hypothetical protein OsJ_27983 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115477372|ref|NP_001062282.1| Os08g0522600 [Oryza sativa Japonica Group] gi|42407330|dbj|BAD08769.1| DnaJ protein family-like [Oryza sativa Japonica Group] gi|42407725|dbj|BAD08872.1| DnaJ protein family-like [Oryza sativa Japonica Group] gi|113624251|dbj|BAF24196.1| Os08g0522600 [Oryza sativa Japonica Group] gi|215740556|dbj|BAG97212.1| unnamed protein product [Oryza sativa Japonica Group] gi|218201477|gb|EEC83904.1| hypothetical protein OsI_29937 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|297842429|ref|XP_002889096.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334937|gb|EFH65355.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297850538|ref|XP_002893150.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338992|gb|EFH69409.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
TAIR|locus:2030101398 AT1G76700 [Arabidopsis thalian 0.953 0.721 0.819 6.3e-124
TAIR|locus:2025252379 AT1G77020 [Arabidopsis thalian 0.946 0.751 0.623 5.5e-93
TAIR|locus:2050120346 AT2G21510 [Arabidopsis thalian 0.956 0.832 0.558 6.9e-86
TAIR|locus:2136378345 AT4G39150 [Arabidopsis thalian 0.950 0.828 0.565 2.4e-85
ASPGD|ASPL0000040613 466 AN3375 [Emericella nidulans (t 0.448 0.289 0.453 9e-37
DICTYBASE|DDB_G0267994408 DDB_G0267994 "DNAJ heat shock 0.877 0.647 0.340 9.2e-36
SGD|S000000850391 CAJ1 "Nuclear type II J heat s 0.455 0.350 0.412 1.9e-35
CGD|CAL0002990 461 orf19.1267 [Candida albicans ( 0.425 0.277 0.474 1.4e-33
UNIPROTKB|Q5A441 461 DJP2 "Potential peroxisomal pr 0.425 0.277 0.474 1.4e-33
UNIPROTKB|G4MPU8 540 MGG_09235 "DnaJ domain-contain 0.408 0.227 0.527 2.2e-27
TAIR|locus:2030101 AT1G76700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1218 (433.8 bits), Expect = 6.3e-124, P = 6.3e-124
 Identities = 236/288 (81%), Positives = 265/288 (92%)

Query:     1 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSD 60
             MVKETEYYDVLGVSPTA+E+EIKKAYYIKAR+VHPDKNPNDP AA NFQVLGEAYQVLSD
Sbjct:     1 MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD 60

Query:    61 PAQRQAYDAYGKSGISTEAIIDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTEGEEF 120
               QRQAYDA GKSGIST+AIIDPAAIFAMLFGSELFE YIGQLAMAS+ASLDIFTEG++F
Sbjct:    61 SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQF 120

Query:   121 DAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDML 180
             D KK+Q+K+++VQKERE+KLA IL+ RLN+YV  NK++FI+ AEAEV+RLSNAAYGVDML
Sbjct:   121 DTKKIQEKLRIVQKEREDKLAQILKDRLNEYVI-NKDEFISNAEAEVARLSNAAYGVDML 179

Query:   181 NTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKK 240
             NTIGYIY RQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQ+TAATGA AL QLQE+MK+
Sbjct:   180 NTIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKR 239

Query:   241 QLSAEGNYTXXXXXXYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVV 288
             QL+ EGNYT      Y+Q+HK++MIDSLWKLNVADIEATL RVCQ+V+
Sbjct:   240 QLNTEGNYTEEELEEYLQAHKRVMIDSLWKLNVADIEATLCRVCQLVL 287
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
GO:0048527 "lateral root development" evidence=RCA
TAIR|locus:2025252 AT1G77020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050120 AT2G21510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136378 AT4G39150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000040613 AN3375 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267994 DDB_G0267994 "DNAJ heat shock N-terminal domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000000850 CAJ1 "Nuclear type II J heat shock protein of the E. coli dnaJ family" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0002990 orf19.1267 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A441 DJP2 "Potential peroxisomal protein import protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|G4MPU8 MGG_09235 "DnaJ domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
pfam14308204 pfam14308, DnaJ-X, X-domain of DnaJ-containing 3e-61
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 4e-29
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-27
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-25
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-24
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 4e-23
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-22
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 4e-22
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 5e-22
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 1e-21
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-21
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 3e-21
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 5e-21
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 9e-21
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-20
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-20
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 1e-19
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-19
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-19
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-19
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-19
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 8e-19
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-18
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-17
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 3e-17
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-17
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 1e-16
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-16
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 8e-16
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 3e-15
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-14
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-14
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-13
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-13
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-12
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 2e-12
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-12
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 2e-10
PTZ00475282 PTZ00475, PTZ00475, RESA-like protein; Provisional 1e-05
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 4e-05
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 5e-05
>gnl|CDD|222667 pfam14308, DnaJ-X, X-domain of DnaJ-containing Back     alignment and domain information 
 Score =  193 bits (492), Expect = 3e-61
 Identities = 59/157 (37%), Positives = 90/157 (57%)

Query: 131 VVQKEREEKLADILRGRLNQYVQGNKEDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQ 190
             QKEREE+LA+ LR RL+ YV+G+K++F    E E   L   ++G+++L+TIG++Y  +
Sbjct: 1   EEQKEREEELAEKLRDRLSPYVEGDKDEFREKLEQEAEDLKMESFGLEILHTIGWVYENK 60

Query: 191 AAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAIALIQLQEDMKKQLSAEGNYTE 250
           A   LGKK  +LG+  I    ++KG  +KS     + A+      E+MKK     G  TE
Sbjct: 61  ANSFLGKKKTFLGISGIFTSVKDKGRSVKSTFNTLSSALDAQSTMEEMKKLEEKGGELTE 120

Query: 251 EELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMV 287
           EEL E  +     ++ + W ++  DIE+TL  VC  V
Sbjct: 121 EELAEMEEKVTGKILAAAWAISKFDIESTLREVCDKV 157

IN certain plant and yeast proteins, the DnaJ-1 proteins have a three-domain structure. The x-domain lies between the N-terminal DnaJ and the C-terminal Z domains. The exact function is not known. Length = 204
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|185654 PTZ00475, PTZ00475, RESA-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 301
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 100.0
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
PF14308204 DnaJ-X: X-domain of DnaJ-containing 100.0
PTZ00475282 RESA-like protein; Provisional 99.97
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.95
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.93
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
PRK14288369 chaperone protein DnaJ; Provisional 99.88
PRK14286372 chaperone protein DnaJ; Provisional 99.87
PRK14296372 chaperone protein DnaJ; Provisional 99.87
PRK14277386 chaperone protein DnaJ; Provisional 99.86
PRK14298377 chaperone protein DnaJ; Provisional 99.85
PRK14287371 chaperone protein DnaJ; Provisional 99.85
PRK14282369 chaperone protein DnaJ; Provisional 99.85
PRK14285365 chaperone protein DnaJ; Provisional 99.85
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.85
PRK14276380 chaperone protein DnaJ; Provisional 99.85
PRK14297380 chaperone protein DnaJ; Provisional 99.85
PRK14279392 chaperone protein DnaJ; Provisional 99.85
PRK14294366 chaperone protein DnaJ; Provisional 99.85
PRK14283378 chaperone protein DnaJ; Provisional 99.84
PRK14301373 chaperone protein DnaJ; Provisional 99.84
PRK14299291 chaperone protein DnaJ; Provisional 99.84
PRK14278378 chaperone protein DnaJ; Provisional 99.83
PRK14284391 chaperone protein DnaJ; Provisional 99.83
PRK14280376 chaperone protein DnaJ; Provisional 99.83
PRK10767371 chaperone protein DnaJ; Provisional 99.83
PRK14295389 chaperone protein DnaJ; Provisional 99.83
PHA03102153 Small T antigen; Reviewed 99.82
PRK14291382 chaperone protein DnaJ; Provisional 99.82
PRK14290365 chaperone protein DnaJ; Provisional 99.82
PRK14289386 chaperone protein DnaJ; Provisional 99.81
PRK14281397 chaperone protein DnaJ; Provisional 99.81
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.8
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK14292371 chaperone protein DnaJ; Provisional 99.8
PRK14300372 chaperone protein DnaJ; Provisional 99.78
PRK14293374 chaperone protein DnaJ; Provisional 99.78
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.77
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.76
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.67
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.67
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.67
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.64
PRK00294173 hscB co-chaperone HscB; Provisional 99.55
PRK05014171 hscB co-chaperone HscB; Provisional 99.54
PRK03578176 hscB co-chaperone HscB; Provisional 99.51
PRK01356166 hscB co-chaperone HscB; Provisional 99.49
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.47
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.46
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.41
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.38
PTZ00100116 DnaJ chaperone protein; Provisional 99.27
PHA02624 647 large T antigen; Provisional 99.26
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.24
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.15
PRK01773173 hscB co-chaperone HscB; Provisional 99.15
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.04
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 99.0
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.85
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.33
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.2
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.06
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.47
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.26
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.94
KOG0431453 consensus Auxilin-like protein and related protein 95.56
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.02
PF03207254 OspD: Borrelia outer surface protein D (OspD); Int 82.34
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.8e-60  Score=483.66  Aligned_cols=286  Identities=19%  Similarity=0.326  Sum_probs=249.3

Q ss_pred             CCCCCccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHHcCChhHHHHHHhcCCCCCCCCCC
Q 022164            1 MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGISTEAI   80 (301)
Q Consensus         1 m~~~~~~Y~iLgv~~~as~~eIkkayr~la~~~HPDkn~~~~~a~~~f~~i~~AY~vLsdp~~R~~YD~~g~~~~~~~~~   80 (301)
                      |+++++||++|||+++||..+||+|||++|++||||+||++ .|.++|+.|++||+|||||.+|+.||+||..+++.+++
T Consensus       569 ~~~d~dYYdILGVs~dAS~~EIKKAYRKLAlkyHPDKN~~~-~A~ekFq~I~EAYeVLSDp~kRk~YD~~G~~Gl~~~~~  647 (1136)
T PTZ00341        569 EIPDTLFYDILGVGVNADMKEISERYFKLAENYYPPKRSGN-EGFHKFKKINEAYQILGDIDKKKMYNKFGYDGIKGVNF  647 (1136)
T ss_pred             cCCCCChHHHcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc-hHHHHHHHHHHHHHHhCCHHHHHHHhhccccccCCCCc
Confidence            67899999999999999999999999999999999999864 68889999999999999999999999999999998999


Q ss_pred             CChHHHHHhhhcchhHHHHhhhHHHhhhhhcccccc--cc--ccchHHHHHHHHHHHHHHHHHHHHHHHhhccccccCCh
Q 022164           81 IDPAAIFAMLFGSELFEDYIGQLAMASVASLDIFTE--GE--EFDAKKLQDKMKVVQKEREEKLADILRGRLNQYVQGNK  156 (301)
Q Consensus        81 ~dp~~~f~~~fg~~~f~~~~g~~~~~~~~~~~~~~~--~~--~~~~~~~~~~~~~~~~~R~~~La~~L~~~l~~~v~~~~  156 (301)
                      +||..+| ++||++.|.+|+|++.+++++.......  ..  ....+.+++.++..|++|+.+||..|++||++||+|+.
T Consensus       648 iDP~~Ff-mlFgse~F~dYiG~l~iatl~k~~fe~~~s~~d~~~~~e~l~e~m~~~QkeRE~kLA~~LkdRL~~YVdgd~  726 (1136)
T PTZ00341        648 IHPSIFY-LLASLEKFADFTGSPQIVTLLKFFFEKKLSMNDLDNKSEHLLKFMEQYQKEREAHISENLINILQPCIAGDR  726 (1136)
T ss_pred             cCHHHHH-HHhhhHHHHHhcCCHHHHHHHHHHHHhcccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccH
Confidence            9999766 7899999999999999988765432111  11  11235678889999999999999999999999999886


Q ss_pred             HHHHHHHHHHHHHhhhcchhhhHHhhHHHHHHHHHHHHhhhhccccCchhHHHHhhhhhhhHHHHHHHHHHHH-HHHHHH
Q 022164          157 EDFINYAEAEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQVTAATGAI-ALIQLQ  235 (301)
Q Consensus       157 ~~f~~~~~~e~~~L~~~sfG~~~L~~IG~~Y~~~A~~~l~~~~~~~g~~~~~~~~r~k~~~~k~~~~~~~~a~-~~~~~~  235 (301)
                       .|...+..||+.|+.+|||..|||+|||||.++|..|||+.++  |+++++.+++.++.+++++++.+++++ +++..+
T Consensus       727 -~w~~~~e~Ei~~L~~sSFG~~IL~tIGwiY~n~A~~fL~~~k~--g~~kl~~r~k~n~~~v~~~~n~lss~lkda~~t~  803 (1136)
T PTZ00341        727 -KWDVPIIDKIEELKGSPFDIAIIDSIGWIFKHVAKSHLKKPKK--AAKKLEQRSKANKEELANENNKLMNILKEYFGNN  803 (1136)
T ss_pred             -HHHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHhccch--hHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhH
Confidence             5999999999999999999999999999999999999999875  778899999999999999999998888 777777


Q ss_pred             HHHHHHhhhc----------------CCCCHHHHHHHHHHhHHHHHHHHHhHhHHHHHHHHHHHHHHhccccchhh
Q 022164          236 EDMKKQLSAE----------------GNYTEEELEEYMQSHKKLMIDSLWKLNVADIEATLSRVCQMVVLLVSYYL  295 (301)
Q Consensus       236 ~~~~k~~~~~----------------~~~~~ee~~~~~~~~~~~~L~a~W~~~~~dIe~tlr~Vc~~VL~D~~v~~  295 (301)
                      +++.+.....                ..++++   + +..+++++|.++|+++++||++|||.||++||.|++|..
T Consensus       804 eq~nki~~n~En~t~~~~nen~~k~i~~l~~e---e-e~~ilgkiL~~iw~isl~DIE~TVR~VCekVL~Dk~Vd~  875 (1136)
T PTZ00341        804 EQINSITYNFENINLNEDNENGSKKILDLNHK---D-QKEIFEEIISYIVDISLSDIENTAKNAAEQILSDEGLDE  875 (1136)
T ss_pred             HHHHHhhhhhcccccccccccccccccccCHH---H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCH
Confidence            7776543211                012233   2 666789999999999999999999999999999999854

>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14308 DnaJ-X: X-domain of DnaJ-containing Back     alignment and domain information
>PTZ00475 RESA-like protein; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF03207 OspD: Borrelia outer surface protein D (OspD); InterPro: IPR004894 This is a family of outer surface proteins from Borrelia Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 2e-15
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-15
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 4e-15
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 3e-14
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-13
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-13
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-13
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 3e-13
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 4e-13
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-12
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 3e-12
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-11
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-11
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 5e-11
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 5e-11
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 9e-11
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-10
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 9e-09
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 1e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 4e-07
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 3e-06
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 50/71 (70%), Gaps = 3/71 (4%)
Query: 1  MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSD 60
          MVKET YYDVLGV P AS+ E+KKAY   A K HPDKNP+    A+ F+ + +AY+VLSD
Sbjct: 4  MVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPD---GAEQFKQISQAYEVLSD 60
Query: 61 PAQRQAYDAYG 71
            +RQ YD  G
Sbjct: 61 EKKRQIYDQGG 71
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-30
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-29
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-29
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 6e-29
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-28
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-28
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 4e-28
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-27
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-27
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 3e-27
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 1e-26
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-26
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 6e-26
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 9e-26
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 1e-25
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-25
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-25
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 7e-25
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 8e-23
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-22
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 3e-22
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 5e-21
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-20
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-18
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-14
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-14
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 9e-13
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 1e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-12
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 6e-11
2guz_A71 Mitochondrial import inner membrane translocase su 3e-10
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 3e-08
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score =  109 bits (273), Expect = 3e-30
 Identities = 29/74 (39%), Positives = 39/74 (52%)

Query: 1  MVKETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSD 60
              T  YD+LGV  TA++A+IK AYY +    HPD+N     AA+ F  + +AY VL  
Sbjct: 13 SYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGS 72

Query: 61 PAQRQAYDAYGKSG 74
             R+ YD    S 
Sbjct: 73 ATLRRKYDRGLLSD 86
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.87
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.87
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.87
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.87
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.85
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.85
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.85
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.84
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.84
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.83
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.83
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.83
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.83
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.83
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.82
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.81
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.81
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.77
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.77
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.77
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.76
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.75
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.74
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.74
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.69
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.68
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.68
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.67
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.64
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.63
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.63
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.62
2guz_A71 Mitochondrial import inner membrane translocase su 99.57
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.04
2guz_B65 Mitochondrial import inner membrane translocase su 98.72
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
Probab=99.87  E-value=5.9e-23  Score=163.03  Aligned_cols=74  Identities=47%  Similarity=0.785  Sum_probs=69.8

Q ss_pred             CCccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHHcCChhHHHHHHhcCCCCCCC
Q 022164            4 ETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGIST   77 (301)
Q Consensus         4 ~~~~Y~iLgv~~~as~~eIkkayr~la~~~HPDkn~~~~~a~~~f~~i~~AY~vLsdp~~R~~YD~~g~~~~~~   77 (301)
                      ..|||+||||++++|.++||+|||++++++|||++++++.+.++|+.|++||++|+||.+|..||.+|..++..
T Consensus         2 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~~   75 (103)
T 1bq0_A            2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQ   75 (103)
T ss_dssp             CCCSTTTTSSCSSCCHHHHHHHHHHHHTTTCTTTCTTTCTHHHHHHHHTTTTTSTTCSHHHHHTTTSTTTSSCS
T ss_pred             CCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHCCHHHHHHHHHHhhhhhcc
Confidence            47999999999999999999999999999999999877889999999999999999999999999999887654
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 301
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-19
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 1e-17
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-17
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 6e-16
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-15
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 6e-14
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-13
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-12
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 78.5 bits (193), Expect = 2e-19
 Identities = 35/69 (50%), Positives = 45/69 (65%)

Query: 7  YYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQA 66
          YY++LGVS TA E EI+KAY   A K HPD+N  D  A   F+ + EAY+VL+D  +R A
Sbjct: 5  YYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAA 64

Query: 67 YDAYGKSGI 75
          YD YG +  
Sbjct: 65 YDQYGHAAF 73
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.91
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.82
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.81
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.7
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.69
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.64
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.61
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.91  E-value=5.5e-25  Score=163.56  Aligned_cols=72  Identities=49%  Similarity=0.806  Sum_probs=69.0

Q ss_pred             CCccccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHHcCChhHHHHHHhcCCCCC
Q 022164            4 ETEYYDVLGVSPTASEAEIKKAYYIKARKVHPDKNPNDPLAAQNFQVLGEAYQVLSDPAQRQAYDAYGKSGI   75 (301)
Q Consensus         4 ~~~~Y~iLgv~~~as~~eIkkayr~la~~~HPDkn~~~~~a~~~f~~i~~AY~vLsdp~~R~~YD~~g~~~~   75 (301)
                      ..|||+||||+++||.++||+|||++++++|||+|++++.+.+.|+.|++||+||+||.+|..||++|..++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            579999999999999999999999999999999999888999999999999999999999999999998764
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure