Citrus Sinensis ID: 022185

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-

MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP

ccccccccccccccHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHcccEEEccccEEEEEEcccccEEEEEEccccEEEccEEEEcccHHHHHHcccccccccHHHHHHHccccccEEEEEEccccccccccccEEEcccccccEEEccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc

cHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHccccHHHHcHHHHHHHHHcccEEEEcccEEEEEEccccEEEEEEEEccEEEEEEEEEEEcccHHHHHHccHHHHccHHHHHHHcccccEEEEEEEEEcHHHHHHHHHccccccccccEEHHHHcccHHHccccccEEEEEEcccccHccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEcccHHHcccccccccccccccccccEEEcccccHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHcccc

mskalnfinpdeLSMQCILIALNRFLqekhgskmafldgnpperlcLPIVEHIQSlggevrlnsrvqkielnddgtvknflltngnvidgdayvfatpvdilklqlpeNWKEMAYFKRLEklvgvpviniHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCkeyynpnqSMLELvfapaeewiscsdSEIIDATMKELAKLFpdeisadqSKAKIVKYHVVktprsvyktipncepcrplqrspvegfylagDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGkgrlaeasmcp

mskalnfinpdeLSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKielnddgtvKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKtprsvyktipncepcrplqRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMCP

******FINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARG***********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		301	2.2.26 [Sep-21-2011]
P28553		570	Phytoene dehydrogenase, c	yes	no	0.996	0.526	0.87	1e-157
Q07356		566	15-cis-phytoene desaturas	yes	no	0.993	0.528	0.862	1e-156
P80093		582	15-cis-phytoene desaturas	N/A	no	0.993	0.513	0.849	1e-151
P28554		583	Phytoene dehydrogenase, c	N/A	no	0.993	0.512	0.862	1e-150
Q40406		570	Phytoene dehydrogenase, c	N/A	no	0.966	0.510	0.855	1e-150
Q0DUI8		578	Phytoene dehydrogenase, c	yes	no	0.960	0.5	0.861	1e-146
A2XDA1		578	Phytoene dehydrogenase, c	N/A	no	0.960	0.5	0.861	1e-146
P49086		571	Phytoene dehydrogenase, c	N/A	no	0.976	0.514	0.840	1e-143
P26294		474	15-cis-phytoene desaturas	yes	no	0.990	0.628	0.593	5e-98
P29273		472	Phytoene dehydrogenase OS	N/A	no	0.933	0.595	0.607	5e-97

>sp\|P28553\|CRTI_SOYBN Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Glycine max GN=PDS1 PE=2 SV=1	Back alignment and function desciption

 Score =  552 bits (1423), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 261/300 (87%), Positives = 284/300 (94%)

Query: 1   MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEV 60
           MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+PIV++IQSLGGEV
Sbjct: 271 MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDYIQSLGGEV 330

Query: 61  RLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLE 120
            LNSR+QKIELNDDGTVK+FLL NG V++GDAYVFATPVDILKL LP+NWK + YF+RL+
Sbjct: 331 HLNSRIQKIELNDDGTVKSFLLNNGKVMEGDAYVFATPVDILKLLLPDNWKGIPYFQRLD 390

Query: 121 KLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAP 180
           KLVGVPVIN+HIWFDRKLKNTYDHLLFSRS LLSVYADMS+TCKEYY+PNQSMLELVFAP
Sbjct: 391 KLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSVTCKEYYSPNQSMLELVFAP 450

Query: 181 AEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCR 240
           AEEWIS SD +II ATM ELAKLFPDEISADQSKAKI+KYHVVKTPRSVYKT+PNCEPCR
Sbjct: 451 AEEWISRSDDDIIQATMTELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTVPNCEPCR 510

Query: 241 PLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMC 300
           P+QRSP+EGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQD  LLA RG+ R+A+AS+ 
Sbjct: 511 PIQRSPIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDSELLATRGQKRMAKASVV 570

This enzyme converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene.
Glycine max (taxid: 3847)
EC: 1EC: .EC: 1EC: 4EC: .EC: 9EC: 9EC: .EC: -

>sp\|Q07356\|PDS_ARATH 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=PDS PE=1 SV=1	Back alignment and function description

>sp\|P80093\|PDS_CAPAN 15-cis-phytoene desaturase, chloroplastic/chromoplastic OS=Capsicum annuum GN=PDS PE=1 SV=1	Back alignment and function description

>sp\|P28554\|CRTI_SOLLC Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Solanum lycopersicum GN=PDS PE=2 SV=1	Back alignment and function description

>sp\|Q40406\|CRTI_NARPS Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=PDS1 PE=1 SV=1	Back alignment and function description

>sp\|Q0DUI8\|CRTI_ORYSJ Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. japonica GN=PDS PE=2 SV=2	Back alignment and function description

>sp\|A2XDA1\|CRTI_ORYSI Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Oryza sativa subsp. indica GN=PDS1 PE=2 SV=2	Back alignment and function description

>sp\|P49086\|CRTI_MAIZE Phytoene dehydrogenase, chloroplastic/chromoplastic OS=Zea mays GN=PDS1 PE=2 SV=1	Back alignment and function description

>sp\|P26294\|PDS_SYNE7 15-cis-phytoene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=pds PE=1 SV=1	Back alignment and function description

>sp\|P29273\|CRTI_SYNY3 Phytoene dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pds PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		301
25518260		553	phytoene desaturase (EC 1.14.99.-) 1 - c	1.0	0.544	1.0	1e-176
350541925		553	phytoene desaturase [Citrus sinensis]	1.0	0.544	0.996	1e-176
350541939		553	phytoene desaturase [Citrus sinensis]	1.0	0.544	0.993	1e-176
350541935		553	phytoene desaturase [Citrus x paradisi]	1.0	0.544	0.996	1e-176
350541929		553	phytoene desaturase [Citrus x paradisi]	1.0	0.544	0.996	1e-176
350541931		553	phytoene desaturase [Citrus x paradisi]	1.0	0.544	0.993	1e-176
13991882		552	phytoene desaturase [Citrus x paradisi]	0.996	0.543	0.996	1e-175
350541927		553	phytoene desaturase [Citrus sinensis]	1.0	0.544	0.990	1e-175
350541937		553	phytoene desaturase [Citrus sinensis]	1.0	0.544	0.993	1e-175
190576745		553	phytoene desaturase [Citrus maxima]	1.0	0.544	0.986	1e-174

>gi\|25518260\|pir\|\|JC7723 phytoene desaturase (EC 1.14.99.-) 1 - citrus gi\|9757659\|dbj\|BAB08179.1\| phytoene desaturase [Citrus unshiu] gi\|18073984\|emb\|CAC85666.1\| phytoene desaturase [Citrus sinensis] gi\|82394889\|gb\|ABB72445.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

 Score =  624 bits (1610), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 301/301 (100%), Positives = 301/301 (100%)

Query: 1   MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEV 60
           MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEV
Sbjct: 253 MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEV 312

Query: 61  RLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLE 120
           RLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLE
Sbjct: 313 RLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLE 372

Query: 121 KLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAP 180
           KLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAP
Sbjct: 373 KLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAP 432

Query: 181 AEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCR 240
           AEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCR
Sbjct: 433 AEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCR 492

Query: 241 PLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMC 300
           PLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMC
Sbjct: 493 PLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASMC 552

Query: 301 P 301
           P
Sbjct: 553 P 553

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|350541925\|gb\|AEQ29518.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541939\|gb\|AEQ29525.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541935\|gb\|AEQ29523.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541929\|gb\|AEQ29520.1\| phytoene desaturase [Citrus x paradisi] gi\|350541933\|gb\|AEQ29522.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541931\|gb\|AEQ29521.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|13991882\|gb\|AAK51545.1\| phytoene desaturase [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|350541927\|gb\|AEQ29519.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|350541937\|gb\|AEQ29524.1\| phytoene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|190576745\|gb\|ACE79168.1\| phytoene desaturase [Citrus maxima]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		301
TAIR\|locus:2129515		566	PDS3 "phytoene desaturase 3" [	0.993	0.528	0.862	1.6e-141
TAIR\|locus:2114789		558	ZDS "zeta-carotene desaturase"	0.710	0.383	0.314	2.5e-25
TAIR\|locus:2077670		488	PAO3 "polyamine oxidase 3" [Ar	0.700	0.432	0.227	3e-06
TAIR\|locus:2018571		497	PAO4 "polyamine oxidase 4" [Ar	0.717	0.434	0.222	5.4e-05
TAIR\|locus:2053723		490	PAO2 "AT2G43020" [Arabidopsis	0.677	0.416	0.241	0.00019

TAIR\|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1384 (492.3 bits), Expect = 1.6e-141, P = 1.6e-141
 Identities = 258/299 (86%), Positives = 287/299 (95%)

Query:     1 MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEV 60
             MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+P+V+HI+SLGGEV
Sbjct:   265 MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPVVDHIRSLGGEV 324

Query:    61 RLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLE 120
             +LNSR++KIELNDDGTVK+FLLTNG+ ++GDAYVFA PVDILKL LP+ WKE+ YFK+L+
Sbjct:   325 QLNSRIKKIELNDDGTVKSFLLTNGSTVEGDAYVFAAPVDILKLLLPDPWKEIPYFKKLD 384

Query:   121 KLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAP 180
             KLVGVPVIN+HIWFDRKLKNTYDHLLFSRS+LLSVYADMSLTCKEYY+PN+SMLELVFAP
Sbjct:   385 KLVGVPVINVHIWFDRKLKNTYDHLLFSRSNLLSVYADMSLTCKEYYDPNRSMLELVFAP 444

Query:   181 AEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCR 240
             AEEWIS +DS+IIDATMKEL KLFPDEISADQSKAKI+KYHVVKTPRSVYKTIPNCEPCR
Sbjct:   445 AEEWISRTDSDIIDATMKELEKLFPDEISADQSKAKILKYHVVKTPRSVYKTIPNCEPCR 504

Query:   241 PLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 299
             PLQRSP+EGFYLAGDYTKQKYLASMEGAVLSGK C+Q+IVQDY LLAA G  +L+EA++
Sbjct:   505 PLQRSPIEGFYLAGDYTKQKYLASMEGAVLSGKFCSQSIVQDYELLAASGPRKLSEATV 563

GO:0009507 "chloroplast" evidence=ISM;IDA;TAS

GO:0009536 "plastid" evidence=IEA

GO:0016117 "carotenoid biosynthetic process" evidence=IEA;IDA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0010155 "regulation of proton transport" evidence=RCA

GO:0046777 "protein autophosphorylation" evidence=RCA

GO:0016120 "carotene biosynthetic process" evidence=IDA

GO:0016166 "phytoene dehydrogenase activity" evidence=IDA

TAIR\|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2077670 PAO3 "polyamine oxidase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2018571 PAO4 "polyamine oxidase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2053723 PAO2 "AT2G43020" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q0DUI8	CRTI_ORYSJ	1, ., 1, 4, ., 9, 9, ., -	0.8615	0.9601	0.5	yes	no
P26294	PDS_SYNE7	1, ., 3, ., 5, ., 5	0.5934	0.9900	0.6286	yes	no
P28553	CRTI_SOYBN	1, ., 1, 4, ., 9, 9, ., -	0.87	0.9966	0.5263	yes	no
Q07356	PDS_ARATH	1, ., 3, ., 5, ., 5	0.8628	0.9933	0.5282	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.14.99	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		301
PLN02612		567	PLN02612, PLN02612, phytoene desaturase	0.0
TIGR02731		453	TIGR02731, phytoene_desat, phytoene desaturase	0.0
COG3349		485	COG3349, COG3349, Uncharacterized conserved protei	3e-74
pfam01593		444	pfam01593, Amino_oxidase, Flavin containing amine	4e-57
TIGR02732		474	TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot	7e-57
PLN02487		569	PLN02487, PLN02487, zeta-carotene desaturase	2e-51
TIGR03467		411	TIGR03467, HpnE, squalene-associated FAD-dependent	4e-31
PRK07233		434	PRK07233, PRK07233, hypothetical protein; Provisio	1e-13
PLN02268		435	PLN02268, PLN02268, probable polyamine oxidase	4e-08
PRK11883		451	PRK11883, PRK11883, protoporphyrinogen oxidase; Re	4e-05
pfam01266		234	pfam01266, DAO, FAD dependent oxidoreductase	6e-04
COG1232		444	COG1232, HemY, Protoporphyrinogen oxidase [Coenzym	6e-04
COG2509		486	COG2509, COG2509, Uncharacterized FAD-dependent de	9e-04
COG1231		450	COG1231, COG1231, Monoamine oxidase [Amino acid tr	0.001

>gnl\|CDD\|215330 PLN02612, PLN02612, phytoene desaturase	Back alignment and domain information

 Score =  642 bits (1657), Expect = 0.0
 Identities = 262/299 (87%), Positives = 286/299 (95%)

Query: 1   MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEV 60
           MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLC+PIV+H QSLGGEV
Sbjct: 266 MSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDHFQSLGGEV 325

Query: 61  RLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLE 120
           RLNSR++KIELNDDGTVK+FLLTNG+V++GD YV ATPVDILKL LP+ WKE+ YFK+L+
Sbjct: 326 RLNSRIKKIELNDDGTVKHFLLTNGSVVEGDVYVSATPVDILKLLLPDQWKEIPYFKKLD 385

Query: 121 KLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYNPNQSMLELVFAP 180
           KLVGVPVIN+HIWFDRKLKNTYDHLLFSRS LLSVYADMS TCKEYY+PN+SMLELVFAP
Sbjct: 386 KLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMSTTCKEYYDPNKSMLELVFAP 445

Query: 181 AEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCR 240
           AEEWIS SD +IIDATMKELAKLFPDEISADQSKAKI+KYHVVKTPRSVYKT+PNCEPCR
Sbjct: 446 AEEWISRSDEDIIDATMKELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTVPNCEPCR 505

Query: 241 PLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEASM 299
           PLQRSP+EGFYLAGDYTKQKYLASMEGAVLSGKLCAQ+IVQDY LLAARG  +L+EA++
Sbjct: 506 PLQRSPIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIVQDYELLAARGPRKLSEATV 564

Length = 567

>gnl\|CDD\|131778 TIGR02731, phytoene_desat, phytoene desaturase	Back alignment and domain information

>gnl\|CDD\|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase	Back alignment and domain information

>gnl\|CDD\|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase	Back alignment and domain information

>gnl\|CDD\|215268 PLN02487, PLN02487, zeta-carotene desaturase	Back alignment and domain information

>gnl\|CDD\|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase	Back alignment and domain information

>gnl\|CDD\|235977 PRK07233, PRK07233, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|177909 PLN02268, PLN02268, probable polyamine oxidase	Back alignment and domain information

>gnl\|CDD\|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>gnl\|CDD\|216400 pfam01266, DAO, FAD dependent oxidoreductase	Back alignment and domain information

>gnl\|CDD\|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|225307 COG2509, COG2509, Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		301
PLN02612		567	phytoene desaturase	100.0
PLN02487		569	zeta-carotene desaturase	100.0
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	100.0
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	100.0
TIGR03467		419	HpnE squalene-associated FAD-dependent desaturase.	99.97
PRK07233		434	hypothetical protein; Provisional	99.95
PLN02676		487	polyamine oxidase	99.93
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	99.93
PLN02976		1713	amine oxidase	99.92
PLN03000		881	amine oxidase	99.91
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	99.91
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	99.91
PLN02568		539	polyamine oxidase	99.9
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	99.9
PLN02529		738	lysine-specific histone demethylase 1	99.9
PLN02328		808	lysine-specific histone demethylase 1 homolog	99.9
PLN02268		435	probable polyamine oxidase	99.9
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	99.9
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	99.89
PRK12416		463	protoporphyrinogen oxidase; Provisional	99.89
PRK11883		451	protoporphyrinogen oxidase; Reviewed	99.89
PRK07208		479	hypothetical protein; Provisional	99.88
PLN02576		496	protoporphyrinogen oxidase	99.88
COG3349		485	Uncharacterized conserved protein [Function unknow	99.84
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	99.83
KOG0029		501	consensus Amine oxidase [Secondary metabolites bio	99.83
KOG4254		561	consensus Phytoene desaturase [Coenzyme transport	99.83
KOG0685		498	consensus Flavin-containing amine oxidase [Coenzym	99.82
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	99.7
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	99.67
KOG1276		491	consensus Protoporphyrinogen oxidase [Coenzyme tra	99.11
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	98.46
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	98.38
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	98.32
COG2907		447	Predicted NAD/FAD-binding protein [General functio	98.2
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	98.11
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	98.11
PRK13977		576	myosin-cross-reactive antigen; Provisional	97.9
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	97.83
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	97.64
COG2081		408	Predicted flavoproteins [General function predicti	97.58
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.58
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	97.53
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	97.52
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	97.5
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	97.48
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	97.42
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	97.41
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	97.4
PRK06847		375	hypothetical protein; Provisional	97.4
PRK10015		429	oxidoreductase; Provisional	97.37
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	97.37
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	97.36
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.3
COG0579		429	Predicted dehydrogenase [General function predicti	97.26
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	97.25
PRK10157		428	putative oxidoreductase FixC; Provisional	97.18
PRK07045		388	putative monooxygenase; Reviewed	97.14
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.02
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.01
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	96.96
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	96.92
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	96.9
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	96.85
PRK06185		407	hypothetical protein; Provisional	96.81
PRK08244		493	hypothetical protein; Provisional	96.74
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	96.74
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	96.69
PRK09126		392	hypothetical protein; Provisional	96.66
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	96.6
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	96.59
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	96.59
PLN02463		447	lycopene beta cyclase	96.56
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	96.51
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	96.5
PRK11728		393	hydroxyglutarate oxidase; Provisional	96.32
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	96.28
PRK05257		494	malate:quinone oxidoreductase; Validated	96.28
PRK06996		398	hypothetical protein; Provisional	96.25
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	96.23
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	96.14
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	96.13
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	96.13
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	96.12
PF07156		368	Prenylcys_lyase: Prenylcysteine lyase; InterPro: I	96.1
PRK08274		466	tricarballylate dehydrogenase; Validated	96.03
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	96.02
PRK07121		492	hypothetical protein; Validated	96.02
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	96.02
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	96.02
PTZ00383		497	malate:quinone oxidoreductase; Provisional	95.99
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.96
PRK13339		497	malate:quinone oxidoreductase; Reviewed	95.93
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	95.91
PRK06116		450	glutathione reductase; Validated	95.79
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	95.7
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	95.69
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	95.66
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	95.65
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.65
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	95.62
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	95.55
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	95.51
TIGR00275		400	flavoprotein, HI0933 family. The model when search	95.51
KOG2820		399	consensus FAD-dependent oxidoreductase [General fu	95.35
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	95.3
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	95.19
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	95.17
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	95.17
PLN02464		627	glycerol-3-phosphate dehydrogenase	95.12
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	95.1
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	95.02
PRK06175		433	L-aspartate oxidase; Provisional	94.96
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	94.95
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	94.93
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	94.86
PLN02697		529	lycopene epsilon cyclase	94.79
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	94.77
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	94.72
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	94.7
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	94.69
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	94.67
PRK12839		572	hypothetical protein; Provisional	94.65
PRK12842		574	putative succinate dehydrogenase; Reviewed	94.63
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	94.62
PRK14989		847	nitrite reductase subunit NirD; Provisional	94.58
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	94.54
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	94.52
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	94.49
PRK06834		488	hypothetical protein; Provisional	94.44
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	94.43
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	94.39
PLN02507		499	glutathione reductase	94.38
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	94.33
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	94.32
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	94.29
PRK08275		554	putative oxidoreductase; Provisional	94.21
PRK07190		487	hypothetical protein; Provisional	94.19
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	94.18
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	94.16
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	94.15
PRK07588		391	hypothetical protein; Provisional	94.09
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	94.08
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	94.01
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	94.01
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	93.97
PRK07845		466	flavoprotein disulfide reductase; Reviewed	93.94
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	93.88
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	93.88
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	93.84
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	93.81
KOG1439		440	consensus RAB proteins geranylgeranyltransferase c	93.8
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	93.79
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	93.75
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	93.71
PRK11445		351	putative oxidoreductase; Provisional	93.63
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	93.63
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	93.6
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	93.6
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	93.57
PRK07804		541	L-aspartate oxidase; Provisional	93.57
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	93.48
PRK08163		396	salicylate hydroxylase; Provisional	93.46
PRK06184		502	hypothetical protein; Provisional	93.45
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	93.45
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	93.39
PRK08401		466	L-aspartate oxidase; Provisional	93.38
PRK07512		513	L-aspartate oxidase; Provisional	93.34
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	93.34
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	93.14
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	93.07
PRK08013		400	oxidoreductase; Provisional	93.04
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	93.01
PRK07395		553	L-aspartate oxidase; Provisional	93.0
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	92.95
PTZ00058		561	glutathione reductase; Provisional	92.85
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	92.8
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	92.77
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	92.76
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	92.73
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	92.71
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	92.66
PRK08294		634	phenol 2-monooxygenase; Provisional	92.59
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	92.53
KOG2844		856	consensus Dimethylglycine dehydrogenase precursor	92.48
PRK09564		444	coenzyme A disulfide reductase; Reviewed	92.47
PTZ00052		499	thioredoxin reductase; Provisional	92.43
PRK09897		534	hypothetical protein; Provisional	92.34
PRK06370		463	mercuric reductase; Validated	92.32
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	92.32
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	92.31
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	92.23
PRK08071		510	L-aspartate oxidase; Provisional	92.03
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	92.0
PRK10262		321	thioredoxin reductase; Provisional	91.98
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	91.97
PRK05868		372	hypothetical protein; Validated	91.81
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	91.81
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	91.66
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	91.63
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	91.62
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	91.6
PRK07236		386	hypothetical protein; Provisional	91.57
PRK14727		479	putative mercuric reductase; Provisional	91.56
PLN02546		558	glutathione reductase	91.55
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	91.51
PRK14694		468	putative mercuric reductase; Provisional	91.47
PRK13512		438	coenzyme A disulfide reductase; Provisional	91.14
TIGR02053		463	MerA mercuric reductase. This model represents the	91.12
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	90.94
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	90.84
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	90.77
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	90.75
PRK06753		373	hypothetical protein; Provisional	90.74
PRK07846		451	mycothione reductase; Reviewed	90.7
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	90.43
PRK13748		561	putative mercuric reductase; Provisional	90.38
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	90.13
PLN02815		594	L-aspartate oxidase	89.98
COG1251		793	NirB NAD(P)H-nitrite reductase [Energy production	89.84
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	89.68
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	89.41
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	89.2
PRK12831		464	putative oxidoreductase; Provisional	89.15
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	89.13
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	88.81
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	88.71
PRK09077		536	L-aspartate oxidase; Provisional	88.68
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	88.65
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	88.57
PRK06475		400	salicylate hydroxylase; Provisional	88.5
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	88.21
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	88.05
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	87.83
PRK08132		547	FAD-dependent oxidoreductase; Provisional	87.79
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	87.74
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	87.69
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	87.16
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	87.02
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	86.97
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	86.88
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	86.78
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	86.76
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	86.76
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	86.67
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	86.13
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	85.4
PRK06126		545	hypothetical protein; Provisional	84.48
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	84.18
PRK14989		847	nitrite reductase subunit NirD; Provisional	84.15
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	83.47
KOG2404		477	consensus Fumarate reductase, flavoprotein subunit	82.9
PRK09564		444	coenzyme A disulfide reductase; Reviewed	82.89
PRK07538		413	hypothetical protein; Provisional	82.8
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	82.2
PLN02661		357	Putative thiazole synthesis	82.01
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	81.94
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	81.82
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	81.39
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	81.07
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	80.98
PLN02985		514	squalene monooxygenase	80.57
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	80.5
KOG1346		659	consensus Programmed cell death 8 (apoptosis-induc	80.5
PRK02106		560	choline dehydrogenase; Validated	80.25
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	80.2
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	80.05

>PLN02612 phytoene desaturase	Back alignment and domain information

Probab=100.00  E-value=9e-39  Score=301.87  Aligned_cols=297  Identities=88%  Similarity=1.384  Sum_probs=245.8

Q ss_pred             CccccCCCCccccHHHHHHHHHHHhhccCCceEeeecCCCcccchHHHHHHHHHcCcEEEecceeeEEEecCCCcEEEEE
Q 022185            2 SKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFL   81 (301)
Q Consensus         2 ~~~~~~~~~e~~sa~~~~~~~~~~~~~~~~~~~~~~~GG~~~~l~~~l~~~l~~~g~~I~l~~~V~~I~~~~~g~v~~V~   81 (301)
                      +.+++|.+++++|+.+++..+.+++....++...+++|+..++|.++|++.|++.|++|++|++|++|+.++++++++|+
T Consensus       267 ~~~~~~~~p~~~S~~~~l~~l~~~l~~~~gs~~~~~~G~~~~~l~~~l~~~l~~~G~~I~l~~~V~~I~~~~~g~v~~v~  346 (567)
T PLN02612        267 SKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDHFQSLGGEVRLNSRIKKIELNDDGTVKHFL  346 (567)
T ss_pred             HHHhcCCCHHHhhHHHHHHHHHHHHhccCCceEeeecCCchHHHHHHHHHHHHhcCCEEEeCCeeeEEEECCCCcEEEEE
Confidence            34677999999999999988887766667788899988854789999999999999999999999999987677666688


Q ss_pred             EeCCcEEecCEEEEccChhhHhhcCCchhhhcHHHHHHhhcCCcCeEEEEEEecccCCCccceeeeecCccchhhhhccc
Q 022185           82 LTNGNVIDGDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSL  161 (301)
Q Consensus        82 ~~~g~~~~ad~VI~a~p~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~s~  161 (301)
                      +.+|++++||+||+|+|+..+.+|+++...+.+..++++++.+.++++++++|++++|...++++++..+...++.++|.
T Consensus       347 ~~~G~~~~ad~VI~a~p~~~l~~Ll~~~~~~~~~~~~l~~l~~~~v~~v~l~~dr~~~~~~~~~~~~~~~~~~~~~d~S~  426 (567)
T PLN02612        347 LTNGSVVEGDVYVSATPVDILKLLLPDQWKEIPYFKKLDKLVGVPVINVHIWFDRKLKNTYDHLLFSRSPLLSVYADMST  426 (567)
T ss_pred             ECCCcEEECCEEEECCCHHHHHHhCcchhcCcHHHHHHHhcCCCCeEEEEEEECcccCCCCCceeecCCCCceeehhhhh
Confidence            87888899999999999999998887643334566677778888999999999999876555667765554445556665


Q ss_pred             ccccccCCCCcEEEEEecCCCccCCCChHHHHHHHHHHHHHhCCCCccccccCceEEEEEEeecCCcceecCCCCCCCCC
Q 022185          162 TCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCRP  241 (301)
Q Consensus       162 ~~~~~~~~g~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~  241 (301)
                      .+.++++++.+++.+++.++.+|.+++++++++.++++|+++||+...++....+++.+.+.++|++.|...|+...++|
T Consensus       427 ~~~~~~~~~~~ll~~~~~~a~~~~~~sdeei~e~vl~~L~~lfp~~~~~~~~~~~i~~~~~v~~P~a~~~~~pg~~~~rp  506 (567)
T PLN02612        427 TCKEYYDPNKSMLELVFAPAEEWISRSDEDIIDATMKELAKLFPDEISADQSKAKILKYHVVKTPRSVYKTVPNCEPCRP  506 (567)
T ss_pred             cchhhcCCCCeEEEEEEEcChhhhcCCHHHHHHHHHHHHHHHCCcccccccCCceEEEEEEeccCCceEEeCCCCcccCc
Confidence            55666676667777667777889999999999999999999999864322234577888999999999887788777888


Q ss_pred             CCCCCCCCeEEeeccccCCCCCchhHHHHHHHHHHHHHHHHhhhhhhcCCCcccccC
Q 022185          242 LQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQDYVLLAARGKGRLAEAS  298 (301)
Q Consensus       242 ~~~~p~~~l~~aGd~~~~~~~~~v~gA~~SG~~aA~~i~~~~~~~~~~~~~~~~~~~  298 (301)
                      .+.+|++||||||||+.++|+++++||+.||++||++|+++++........++++++
T Consensus       507 ~~~tPi~~l~lAGd~t~~~~~~smeGAv~SG~~AA~~I~~~~~~~~~~~~~~~~~~~  563 (567)
T PLN02612        507 LQRSPIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIVQDYELLAARGPRKLSEAT  563 (567)
T ss_pred             cccCccCCEEEeecceeCCchhhHHHHHHHHHHHHHHHHHHhccccccccccccccc
Confidence            889999999999999999998999999999999999999999887777777777765

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>TIGR03467 HpnE squalene-associated FAD-dependent desaturase	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism]	Back alignment and domain information

>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion]	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms]	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		301
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	1e-32
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	4e-22
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	2e-16
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	4e-15
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	9e-14
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	2e-13
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	2e-13
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	4e-13
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	2e-12
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	2e-12
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	6e-12
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	3e-11
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	8e-11
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	4e-10
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	4e-09
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	1e-07
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	1e-06
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	5e-06
2e1m_C		181	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	3e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-04
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	6e-04

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421	Back alignment and structure

 Score =  123 bits (311), Expect = 1e-32
 Identities = 26/232 (11%), Positives = 73/232 (31%), Gaps = 24/232 (10%)

Query: 49  IVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVIDGDAYVFATPVDILKLQLPE 108
           +   I    G++     V +I + ++  V      +      D  +    V      +  
Sbjct: 195 LERIIMENKGKILTRKEVVEINI-EEKKVY---TRDNEEYSFDVAISNVGVRETVKLIGR 250

Query: 109 NWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRSSLLSVYADMSLTCKEYYN 168
           ++ +  Y K+++ +     I  ++    + +     ++F+   +++ + + S   K    
Sbjct: 251 DYFDRDYLKQVDSIEPSEGIKFNLAVPGEPRIGN-TIVFTPGLMINGFNEPSALDKSLAR 309

Query: 169 PNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRS 228
              +++    A     +     + I+   +EL ++FP+                    + 
Sbjct: 310 EGYTLIMAHMALKNGNVK----KAIEKGWEELLEIFPEGE--------------PLLAQV 351

Query: 229 VYKTIP-NCEPCRPLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAI 279
                P N          P+    + GD  +      ++G  L      + +
Sbjct: 352 YRDGNPVNRTRAGLHIEWPLNEVLVVGDGYRPPGGIEVDGIALGVMKALEKL 403

PyMOL of 3nrn

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342	Back alignment and structure

>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		301
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	99.96
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	99.94
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	99.94
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	99.92
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	99.92
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	99.92
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	99.9
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	99.9
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	99.9
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	99.89
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	99.89
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	99.89
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	99.88
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	99.88
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	99.87
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	99.87
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	99.86
4gut_A		776	Lysine-specific histone demethylase 1B; histone de	99.86
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	99.83
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	99.83
3ayj_A		721	Pro-enzyme of L-phenylalanine oxidase; amino acid	99.82
4dsg_A		484	UDP-galactopyranose mutase; rossmann fold, flavin	99.79
4gde_A		513	UDP-galactopyranose mutase; flavin adenine dinucle	99.79
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	99.68
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	99.62
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	99.14
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	99.07
1v0j_A		399	UDP-galactopyranose mutase; flavoprotein, isomeras	98.97
2e1m_C		181	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	98.96
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	98.9
1vg0_A		650	RAB proteins geranylgeranyltransferase component A	98.9
1i8t_A		367	UDP-galactopyranose mutase; rossman fold, FAD, con	98.8
2bi7_A		384	UDP-galactopyranose mutase; FAD, flavoprotein, iso	98.57
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	98.19
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	98.15
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	98.09
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	98.07
2e1m_B		130	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	98.01
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	97.99
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	97.92
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	97.84
3dme_A		369	Conserved exported protein; structural genomics, P	97.81
3atr_A		453	Conserved archaeal protein; saturating double bond	97.6
3kkj_A		336	Amine oxidase, flavin-containing; oxidoreductase,	97.44
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	97.22
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	97.19
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	97.13
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	97.05
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	96.99
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	96.99
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	96.98
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	96.93
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	96.87
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	96.87
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	96.71
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	96.62
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	96.52
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	96.51
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	96.46
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	96.42
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	96.42
2e1m_A		376	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	96.36
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	96.35
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	96.34
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	96.32
1fec_A		490	Trypanothione reductase; redox-active center, oxid	96.3
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	96.29
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	96.2
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	96.2
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	96.16
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	96.15
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	96.14
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	96.13
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	96.11
2cul_A		232	Glucose-inhibited division protein A-related PROT	96.1
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	96.09
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	96.07
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	96.05
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	96.05
4dna_A		463	Probable glutathione reductase; structural genomic	96.03
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	96.02
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	96.01
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	96.0
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	95.92
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	95.91
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	95.87
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	95.84
2wdq_A		588	Succinate dehydrogenase flavoprotein subunit; succ	95.83
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	95.79
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	95.78
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	95.7
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	95.7
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	95.66
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	95.58
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	95.49
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	95.35
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	95.35
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	95.28
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	95.19
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	95.17
2zxi_A		637	TRNA uridine 5-carboxymethylaminomethyl modificat	95.08
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	95.07
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	95.04
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	95.04
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	94.92
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	94.89
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	94.88
3g3e_A		351	D-amino-acid oxidase; FAD, flavoprotein, oxidoredu	94.87
2bs2_A		660	Quinol-fumarate reductase flavoprotein subunit A;	94.86
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	94.84
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	94.84
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	94.82
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	94.79
2h88_A		621	Succinate dehydrogenase flavoprotein subunit; comp	94.78
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	94.77
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	94.65
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	94.65
3ces_A		651	MNMG, tRNA uridine 5-carboxymethylaminomethyl modi	94.62
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	94.61
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	94.61
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	94.58
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	94.56
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	94.55
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	94.51
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	94.47
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	94.46
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	94.44
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	94.43
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	94.41
3r9u_A		315	Thioredoxin reductase; structural genomics, center	94.4
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	94.26
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	94.23
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	94.18
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	94.18
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	94.04
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	94.04
1kf6_A		602	Fumarate reductase flavoprotein; respiration, fuma	94.04
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	94.03
1ojt_A		482	Surface protein; redox-active center, glycolysis,	94.01
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	93.99
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	93.99
4hb9_A		412	Similarities with probable monooxygenase; flavin,	93.95
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	93.94
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	93.9
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	93.83
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	93.76
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	93.74
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	93.62
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	93.56
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	93.53
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	93.48
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	93.33
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	93.26
4g6h_A		502	Rotenone-insensitive NADH-ubiquinone oxidoreducta	93.25
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	93.24
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	93.22
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	93.18
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	93.1
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	93.02
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	93.01
3cp8_A		641	TRNA uridine 5-carboxymethylaminomethyl modificati	93.01
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	92.86
3h28_A		430	Sulfide-quinone reductase; monotopic membrane prot	92.77
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	92.71
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	92.69
2bry_A		497	NEDD9 interacting protein with calponin homology a	92.68
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	92.58
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	92.56
3vrd_B		401	FCCB subunit, flavocytochrome C flavin subunit; su	92.55
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	92.48
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	92.35
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	92.33
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	92.18
1jnr_A		643	Adenylylsulfate reductase; oxidoreductase; HET: FA	92.01
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	91.92
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	91.78
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	91.73
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	91.71
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	91.63
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	91.55
3gyx_A		662	Adenylylsulfate reductase; oxidoreductase; HET: FA	91.51
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	91.35
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	91.27
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	91.25
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	91.23
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	91.19
4fk1_A		304	Putative thioredoxin reductase; structural genomic	91.1
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	91.1
1c0p_A		363	D-amino acid oxidase; alpha-beta-alpha motif, flav	90.85
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	90.76
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	90.75
3fpz_A		326	Thiazole biosynthetic enzyme; FAD, mitochondrion,	90.51
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	90.48
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	90.38
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	89.49
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	89.45
3sx6_A		437	Sulfide-quinone reductase, putative; sulfide:quino	89.44
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	89.43
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	89.19
4gcm_A		312	TRXR, thioredoxin reductase; FAD/NAD-linked reduct	88.97
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	88.96
4fk1_A		304	Putative thioredoxin reductase; structural genomic	88.92
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	88.73
1cjc_A		460	Protein (adrenodoxin reductase); flavoenzyme, MAD	88.35
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	88.33
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	88.32
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	88.23
2jbv_A		546	Choline oxidase; alcohol oxidation, flavoenyzme ox	88.18
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	88.1
2gag_A		965	Heterotetrameric sarcosine oxidase alpha-subunit;	87.97
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	86.87
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	86.58
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	86.11
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	86.04
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	85.86
3l8k_A		466	Dihydrolipoyl dehydrogenase; redox-active center,	85.22
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	85.0
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	84.87
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	84.75
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	84.6
1ps9_A		671	2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel	84.55
4a5l_A		314	Thioredoxin reductase; oxidoreductase, redox metab	83.92
2cul_A		232	Glucose-inhibited division protein A-related PROT	82.86
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	82.55
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	81.89
3r9u_A		315	Thioredoxin reductase; structural genomics, center	81.61
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	81.24
1lqt_A		456	FPRA; NADP+ derivative, oxidoreductase, structural	81.01
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	80.95
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	80.61
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	80.53

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

Probab=99.96  E-value=8.3e-27  Score=213.15  Aligned_cols=257  Identities=17%  Similarity=0.218  Sum_probs=188.0

Q ss_pred             cCCCCccccHHHHHHHHHHHhhccCCceEeeecCCCcccchHHHHHHHHHcCcEEEecceeeEEEecCCCcEEEEEEeCC
Q 022185            6 NFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNG   85 (301)
Q Consensus         6 ~~~~~e~~sa~~~~~~~~~~~~~~~~~~~~~~~GG~~~~l~~~l~~~l~~~g~~I~l~~~V~~I~~~~~g~v~~V~~~~g   85 (301)
                      +..+++++|+..++..+..+... .  ...+++||+ +.++++|++.++++|++|+++++|++|..+ ++++++|++ +|
T Consensus       163 ~~~~~~~~s~~~~~~~~~~~~~~-~--~~~~~~gG~-~~l~~~l~~~~~~~G~~i~~~~~V~~i~~~-~~~~~gv~~-~g  236 (425)
T 3ka7_A          163 LSLKSDEVPVEEVFEIIENMYRF-G--GTGIPEGGC-KGIIDALETVISANGGKIHTGQEVSKILIE-NGKAAGIIA-DD  236 (425)
T ss_dssp             HSSCGGGSBHHHHHHHHHHHHHH-C--SCEEETTSH-HHHHHHHHHHHHHTTCEEECSCCEEEEEEE-TTEEEEEEE-TT
T ss_pred             hCCCcccchHHHHHHHHHHHHhc-C--CccccCCCH-HHHHHHHHHHHHHcCCEEEECCceeEEEEE-CCEEEEEEE-CC
Confidence            45788999998776666653211 1  357899996 999999999999999999999999999985 566766777 57


Q ss_pred             cEEecCEEEEccChhhHhhcCCch-hh--hcHHHHHHhhcCCcCeEEEEEEecccCCCccceeeeecC--ccchhhhhcc
Q 022185           86 NVIDGDAYVFATPVDILKLQLPEN-WK--EMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSRS--SLLSVYADMS  160 (301)
Q Consensus        86 ~~~~ad~VI~a~p~~~l~~l~~~~-~~--~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~--~~~~~~~~~s  160 (301)
                      ++++||.||+|+|++.+.+|+++. ..  +.++.++++++.+++.++++++++++++.. ..+++..+  .+.+ +...|
T Consensus       237 ~~~~ad~VV~a~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~~~~~-~~~~~~~~~~~~~~-~~~~s  314 (425)
T 3ka7_A          237 RIHDADLVISNLGHAATAVLCSEALSKEADAAYFKMVGTLQPSAGIKICLAADEPLVGH-TGVLLTPYTRRING-VNEVT  314 (425)
T ss_dssp             EEEECSEEEECSCHHHHHHHTTTTCCTTTTHHHHHHHHHCCCBEEEEEEEEESSCSSCS-SSEEECCSSSSEEE-EECGG
T ss_pred             EEEECCEEEECCCHHHHHHhcCCcccccCCHHHHHHhhCcCCCceEEEEeecCCCccCc-CEEEECCChhhcce-EEecc
Confidence            789999999999999998888642 11  345677788889888889999999887643 34444332  2221 22445


Q ss_pred             cccccccCCCCcEEEEEecCCCccCCCChHHHHHHHHHHHHHhCCCCccccccCceEEEEEEeecCCcceecCCCCCCCC
Q 022185          161 LTCKEYYNPNQSMLELVFAPAEEWISCSDSEIIDATMKELAKLFPDEISADQSKAKIVKYHVVKTPRSVYKTIPNCEPCR  240 (301)
Q Consensus       161 ~~~~~~~~~g~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~  240 (301)
                      ..+++++|+|++++.+.+....+..+. +++.++.++++|++++|+..      .+++  .+.+|+.+.+.+.++. ..+
T Consensus       315 ~~~p~~ap~G~~~l~~~~~~~~~~~~~-~~~~~~~~~~~l~~~~p~~~------~~~~--~v~~~~~~~P~~~~~~-~~~  384 (425)
T 3ka7_A          315 QADPELAPPGKHLTMCHQYVAPENVKN-LESEIEMGLEDLKEIFPGKR------YEVL--LIQSYHDEWPVNRAAS-GTD  384 (425)
T ss_dssp             GTCGGGSCTTCEEEEEEEEECGGGGGG-HHHHHHHHHHHHHHHSTTCC------EEEE--EEEEEBTTBCSBSSCT-TCC
T ss_pred             CCCCCcCCCCCeEEEEEeccccccccc-hHHHHHHHHHHHHHhCCCCc------eEEE--EEEEECCCcccccccc-CCC
Confidence            567888999988876654322111122 34567999999999999842      2333  4456666655555553 345


Q ss_pred             CCCCCCCCCeEEeeccccCCCCCchhHHHHHHHHHHHHHH
Q 022185          241 PLQRSPVEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIV  280 (301)
Q Consensus       241 ~~~~~p~~~l~~aGd~~~~~~~~~v~gA~~SG~~aA~~i~  280 (301)
                      +...+|++|||+||||+.+.++.+|++|+.||+.+|++|+
T Consensus       385 ~~~~~p~~gL~laG~~~~~~gg~gv~~~~~s~~~~~~~i~  424 (425)
T 3ka7_A          385 PGNETPFSGLYVVGDGAKGKGGIEVEGVALGVMSVMEKVL  424 (425)
T ss_dssp             CCSBCSSBTEEECSTTSCCTTCCHHHHHHHHHHHHHHC--
T ss_pred             CCCCCCcCCeEEeCCccCCCCCCccHHHHHHHHHHHHHhh
Confidence            6778899999999999998665799999999999999886

PyMOL of 3ka7

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens}	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A*	Back alignment and structure

>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A*	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*	Back alignment and structure

>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A*	Back alignment and structure

>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A*	Back alignment and structure

>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A*	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A*	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G*	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R*	Back alignment and structure

>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7	Back alignment and structure

>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A*	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A*	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A*	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A*	Back alignment and structure

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A*	Back alignment and structure

>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A*	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ...	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A*	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A*	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum}	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii}	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C*	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae}	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa}	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A*	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp}	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A*	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C*	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A*	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A*	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A*	Back alignment and structure

>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ...	Back alignment and structure

>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1	Back alignment and structure

>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A*	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A*	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		301
d2dw4a2		449	c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist	1e-17
d2bcgg1		297	c.3.1.3 (G:5-301) Guanine nucleotide dissociation	2e-05
d1b5qa1		347	c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai	7e-05
d1gesa2		116	c.3.1.5 (A:147-262) Glutathione reductase {Escheri	4e-04
d1seza1		373	c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox	0.004

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 80.7 bits (197), Expect = 1e-17
 Identities = 37/262 (14%), Positives = 82/262 (31%), Gaps = 21/262 (8%)

Query: 30  HGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNFLLTNGNVID 89
                 FL  +    L     E+ +    + +L  ++Q++E N    V         +  
Sbjct: 199 RDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDW 258

Query: 90  GDAYVFATPVDILKLQLPENWKEMAYFKRLEKLVGVPVINIHIWFDRKLKNTYDHLLFSR 149
             A +       L     ++W +   F                     ++N Y  +  + 
Sbjct: 259 HFANLEFANATPLSTLSLKHWDQDDDF-------------EFTGSHLTVRNGYSCVPVAL 305

Query: 150 SSLLSVYADMSLTCKEYYNPNQSMLELVFA-PAEEWISCSDSEIIDATMKELAKLFPDEI 208
           +  L +  + ++    Y      ++ +     ++ +I   D+ +    +  L +  P   
Sbjct: 306 AEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQ 365

Query: 209 SADQSK-------AKIVKYHVVKTPRSVYKTIPNCEPCRPLQRSPVEGFYLAGDYTKQKY 261
                         ++V          +        P  P    P+   + AG++T + Y
Sbjct: 366 FVPPLPEWKTSAVQRMVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNY 425

Query: 262 LASMEGAVLSGKLCAQAIVQDY 283
            A++ GA+LSG   A  I   +
Sbjct: 426 PATVHGALLSGLREAGRIADQF 447

PyMOL of d2dw4a2

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		301
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	98.99
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	98.88
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	98.56
d2dw4a2		449	Lysine-specific histone demethylase 1, LSD1 {Human	98.51
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	98.44
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	98.41
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	98.31
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	98.27
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	98.07
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	98.03
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	97.9
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	97.9
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	97.8
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	97.77
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	97.7
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	97.68
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	97.56
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	97.56
d2ivda2		108	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	97.53
d2v5za2		112	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	97.47
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	97.45
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	97.42
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	97.41
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	97.37
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	97.37
d1vg0a1		491	Rab escort protein 1 {Rat (Rattus norvegicus) [Tax	97.28
d1seza2		112	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	97.28
d2dw4a3		109	Lysine-specific histone demethylase 1, LSD1 {Human	97.23
d2iida2		113	L-aminoacid oxidase {Malayan pit viper (Calloselas	97.21
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	97.2
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	97.16
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	97.01
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	96.95
d1y0pa2		308	Flavocytochrome c3 (respiratory fumarate reductase	96.9
d1b5qa2		112	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	96.89
d1d4ca2		322	Flavocytochrome c3 (respiratory fumarate reductase	96.69
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	96.66
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	96.64
d1qo8a2		317	Flavocytochrome c3 (respiratory fumarate reductase	96.52
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	96.5
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	96.1
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	96.0
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	95.35
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	95.17
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	94.72
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	94.58
d2cula1		230	GidA-related protein TTHA1897 {Thermus thermophilu	93.95
d2bs2a2		336	Fumarate reductase {Wolinella succinogenes [TaxId:	93.19
d1n4wa1		367	Cholesterol oxidase of GMC family {Streptomyces sp	92.25
d1kf6a2		311	Fumarate reductase {Escherichia coli [TaxId: 562]}	92.24
d1ps9a2		162	2,4-dienoyl-CoA reductase, C-terminal domain {Esch	91.62
d3coxa1		370	Cholesterol oxidase of GMC family {Brevibacterium	91.29
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	91.02
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	90.39
d1trba2		126	Thioredoxin reductase {Escherichia coli [TaxId: 56	90.18
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	90.14
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	90.12
d1fcda2		141	Flavocytochrome c sulfide dehydrogenase, FCSD, fla	87.59
d2gjca1		311	Thiazole biosynthetic enzyme Thi4 {Baker's yeast (	86.79
d2voua1		265	Dihydroxypyridine hydroxylase DhpH {Arthrobacter n	86.54
d1djqa2		156	Trimethylamine dehydrogenase, C-terminal domain {M	84.73
d1ebda1		223	Dihydrolipoamide dehydrogenase {Bacillus stearothe	84.65
d1kdga1		360	Flavoprotein domain of flavocytochrome cellobiose	83.87
d1neka2		330	Succinate dehydogenase {Escherichia coli [TaxId: 5	83.36
d2f5va1		379	Pyranose 2-oxidase {White-rot fungus (Peniophora s	82.85
d3grsa1		221	Glutathione reductase {Human (Homo sapiens) [TaxId	82.79
d1h6va1		235	Mammalian thioredoxin reductase {Rat (Rattus norve	81.34
d2gmha1		380	Electron transfer flavoprotein-ubiquinone oxidored	81.15
d1ojta1		229	Dihydrolipoamide dehydrogenase {Neisseria meningit	81.12

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monoamine oxidase B
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.99  E-value=1.6e-09  Score=93.29  Aligned_cols=93  Identities=17%  Similarity=0.203  Sum_probs=67.3

Q ss_pred             CCCCccccHHHHHHHHHHH------hhccCCceEeeecCCCcccchHHHHHHHHHcCcEEEecceeeEEEecCCCcEEEE
Q 022185            7 FINPDELSMQCILIALNRF------LQEKHGSKMAFLDGNPPERLCLPIVEHIQSLGGEVRLNSRVQKIELNDDGTVKNF   80 (301)
Q Consensus         7 ~~~~e~~sa~~~~~~~~~~------~~~~~~~~~~~~~GG~~~~l~~~l~~~l~~~g~~I~l~~~V~~I~~~~~g~v~~V   80 (301)
                      ...+...++...+......      ...........+.+|+ +.+++++++.   .|++|++|++|++|..+++ .|. |
T Consensus       169 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~l~~~---~g~~i~~~~~v~~I~~~~~-~v~-v  242 (383)
T d2v5za1         169 TAETHEVSALWFLWYVKQCGGTTRIISTTNGGQERKFVGGS-GQVSERIMDL---LGDRVKLERPVIYIDQTRE-NVL-V  242 (383)
T ss_dssp             SSCTTTSBHHHHHHHHHTTTCHHHHHCSTTSTTSEEETTCT-HHHHHHHHHH---HGGGEEESCCEEEEECSSS-SEE-E
T ss_pred             ccccchhhHHHHHHHHHhhcccccccccccCcceeeeccch-hHHHHHHHHH---cCCeEEecCcceEEEecCC-eEE-E
Confidence            4556666766655443321      1122233446678885 8898888765   4899999999999998644 474 8


Q ss_pred             EEeCCcEEecCEEEEccChhhHhhc
Q 022185           81 LLTNGNVIDGDAYVFATPVDILKLQ  105 (301)
Q Consensus        81 ~~~~g~~~~ad~VI~a~p~~~l~~l  105 (301)
                      ++.||++++||+||+|+|+.++.++
T Consensus       243 ~~~~g~~~~ad~vI~a~p~~~~~~~  267 (383)
T d2v5za1         243 ETLNHEMYEAKYVISAIPPTLGMKI  267 (383)
T ss_dssp             EETTSCEEEESEEEECSCGGGGGGS
T ss_pred             EECCCCEEECCEEEECCCHHHHhhC
Confidence            8889999999999999998776654

PyMOL of d2v5za1

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]}	Back information, alignment and structure

>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}	Back information, alignment and structure

>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure