Citrus Sinensis ID: 022195
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 301 | ||||||
| 359494012 | 302 | PREDICTED: uncharacterized protein LOC10 | 0.936 | 0.933 | 0.697 | 1e-114 | |
| 388513049 | 301 | unknown [Lotus japonicus] | 0.923 | 0.923 | 0.651 | 1e-107 | |
| 224055541 | 299 | predicted protein [Populus trichocarpa] | 0.953 | 0.959 | 0.636 | 1e-105 | |
| 356571315 | 276 | PREDICTED: uncharacterized protein LOC10 | 0.883 | 0.963 | 0.683 | 1e-104 | |
| 255567365 | 301 | heat shock protein binding protein, puta | 0.956 | 0.956 | 0.631 | 1e-103 | |
| 449450080 | 301 | PREDICTED: uncharacterized protein LOC10 | 0.960 | 0.960 | 0.612 | 2e-92 | |
| 148909157 | 460 | unknown [Picea sitchensis] | 0.787 | 0.515 | 0.588 | 2e-83 | |
| 359494021 | 284 | PREDICTED: uncharacterized protein LOC10 | 0.767 | 0.813 | 0.611 | 5e-78 | |
| 242095856 | 302 | hypothetical protein SORBIDRAFT_10g01781 | 0.837 | 0.834 | 0.542 | 5e-73 | |
| 302757113 | 409 | hypothetical protein SELMODRAFT_403442 [ | 0.790 | 0.581 | 0.509 | 1e-72 |
| >gi|359494012|ref|XP_003634709.1| PREDICTED: uncharacterized protein LOC100854700 [Vitis vinifera] gi|297735977|emb|CBI23951.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 417 bits (1073), Expect = e-114, Method: Compositional matrix adjust.
Identities = 205/294 (69%), Positives = 237/294 (80%), Gaps = 12/294 (4%)
Query: 7 LSYHHVSGYVNPNKS------SLRARWGQRCSVIRCCNGRAGERASKKKNYYELLGVSVE 60
+S HH S PN S +L RW + + +RC + G+ A +K+YYELLGVSV+
Sbjct: 6 VSLHHFSL---PNSSQFDIPNNLTTRWRHKFTSVRCSSRSDGQSARTRKSYYELLGVSVD 62
Query: 61 ANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRFHF 120
+N QEIKEAYRKLQKKYHPD+AGQKGHE++L+LNEAY+VL R DLR++YDASIG+MR F
Sbjct: 63 SNPQEIKEAYRKLQKKYHPDVAGQKGHEYSLMLNEAYRVLAREDLRREYDASIGKMRVGF 122
Query: 121 GTNASAGFSRSSWKGPPRPEALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGD 180
G S G S+WKGP RP+ALFVDEN CIGCRECVHHA NTFVMD+A GCARVKVQYGD
Sbjct: 123 GGIFS-GMGYSAWKGPLRPQALFVDENKCIGCRECVHHAGNTFVMDDALGCARVKVQYGD 181
Query: 181 SDQNIEVSVDSCPVNCIHWVDREELPVLEFLIQPQPKKGYGVFGGGWERPANVFMAAKAF 240
D+ IEVSVDSCPVNCIHWVDREEL +LEFLIQPQPK+GYGVFGGGWERPANVFMAAKAF
Sbjct: 182 DDKKIEVSVDSCPVNCIHWVDREELAILEFLIQPQPKEGYGVFGGGWERPANVFMAAKAF 241
Query: 241 NKQLQQQAAGGSNPRTAQSTADKETPAQAEARASASMKIKMERFSIIWNFFKQV 294
NKQL+QQA + R A T ++ETPAQAEARA+ASMKIKMER S IWN+ K+V
Sbjct: 242 NKQLKQQA--DHHQRNASRTVEEETPAQAEARANASMKIKMERLSRIWNWVKEV 293
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|388513049|gb|AFK44586.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224055541|ref|XP_002298530.1| predicted protein [Populus trichocarpa] gi|222845788|gb|EEE83335.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356571315|ref|XP_003553824.1| PREDICTED: uncharacterized protein LOC100776887 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255567365|ref|XP_002524662.1| heat shock protein binding protein, putative [Ricinus communis] gi|223536023|gb|EEF37681.1| heat shock protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449450080|ref|XP_004142792.1| PREDICTED: uncharacterized protein LOC101222804 [Cucumis sativus] gi|449483772|ref|XP_004156687.1| PREDICTED: uncharacterized LOC101222804 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|148909157|gb|ABR17679.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|359494021|ref|XP_003634711.1| PREDICTED: uncharacterized protein LOC100855066 [Vitis vinifera] gi|297735976|emb|CBI23950.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|242095856|ref|XP_002438418.1| hypothetical protein SORBIDRAFT_10g017810 [Sorghum bicolor] gi|241916641|gb|EER89785.1| hypothetical protein SORBIDRAFT_10g017810 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|302757113|ref|XP_002961980.1| hypothetical protein SELMODRAFT_403442 [Selaginella moellendorffii] gi|300170639|gb|EFJ37240.1| hypothetical protein SELMODRAFT_403442 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 301 | ||||||
| TAIR|locus:2166968 | 465 | AT5G23240 [Arabidopsis thalian | 0.774 | 0.501 | 0.364 | 7.4e-34 | |
| TAIR|locus:2052426 | 344 | AT2G42750 [Arabidopsis thalian | 0.691 | 0.604 | 0.298 | 4e-19 | |
| UNIPROTKB|Q55980 | 133 | sll0662 "Ferredoxin (Bacterial | 0.249 | 0.563 | 0.453 | 7e-15 | |
| TAIR|locus:5019474746 | 244 | AT3G05345 "AT3G05345" [Arabido | 0.598 | 0.737 | 0.273 | 6.1e-12 | |
| UNIPROTKB|F1NNE0 | 393 | DNAJA3 "Uncharacterized protei | 0.322 | 0.246 | 0.446 | 5.5e-10 | |
| UNIPROTKB|J9P8P4 | 453 | DNAJA3 "Uncharacterized protei | 0.305 | 0.203 | 0.45 | 9.7e-10 | |
| UNIPROTKB|Q96EY1 | 480 | DNAJA3 "DnaJ homolog subfamily | 0.305 | 0.191 | 0.45 | 1.1e-09 | |
| UNIPROTKB|Q8WW22 | 397 | DNAJA4 "DnaJ homolog subfamily | 0.269 | 0.204 | 0.421 | 1.2e-09 | |
| UNIPROTKB|Q864B5 | 397 | DNAJA4 "PDJA1 chaperone" [Sus | 0.269 | 0.204 | 0.421 | 1.5e-09 | |
| UNIPROTKB|F1PP91 | 399 | DNAJA4 "Uncharacterized protei | 0.269 | 0.203 | 0.421 | 1.5e-09 |
| TAIR|locus:2166968 AT5G23240 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 368 (134.6 bits), Expect = 7.4e-34, P = 7.4e-34
Identities = 89/244 (36%), Positives = 132/244 (54%)
Query: 37 CNGRAGERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTLLLNEA 96
C + + + Y+LLG+ ++ +IK AYR LQK+ HPDIAG GH+ ++LNEA
Sbjct: 37 CRATSSSSSITDFDLYDLLGIDRSSDKSQIKSAYRALQKRCHPDIAGDPGHDMAIILNEA 96
Query: 97 YKVLMRGDLRKDYDASIGQMRFHFGTNASAGFSRSSWKGPPRPE-ALFVDENACIGCREC 155
Y++L R+ YD ++ G +S W GP + A FVDE C+GC +C
Sbjct: 97 YQLLSDPISRQAYDKEQAKLEELRGYTGKPIYS--VWCGPETEQRAAFVDEVKCVGCLKC 154
Query: 156 VHHASNTFVMDEATGCARVKVQYGDSDQNIEVSVDSCPVNCIHWVDREELPVLEFLIQPQ 215
A TF ++ A G ARV Q+ D + I+ ++++CPV+CI V+R +L LEFL+ Q
Sbjct: 155 ALCAEKTFAIETAYGRARVVAQWADPESKIKEAIEACPVDCISMVERSDLAPLEFLMSKQ 214
Query: 216 PKKGY--GVFGGGWERPANVFMAAKAFNKQLQQQAAGGSNPRTAQSTADKETPAQA-EAR 272
P+ GV ER +NVF+ K F Q++ A + RT + T+ +E A EA
Sbjct: 215 PRGNVRIGVGNTVGERVSNVFVDVKKF----QERYAKAMS-RTTKETSQREVQISAVEAI 269
Query: 273 ASAS 276
S S
Sbjct: 270 RSIS 273
|
|
| TAIR|locus:2052426 AT2G42750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q55980 sll0662 "Ferredoxin (Bacterial type ferredoxin family)" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:5019474746 AT3G05345 "AT3G05345" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NNE0 DNAJA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P8P4 DNAJA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96EY1 DNAJA3 "DnaJ homolog subfamily A member 3, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WW22 DNAJA4 "DnaJ homolog subfamily A member 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q864B5 DNAJA4 "PDJA1 chaperone" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PP91 DNAJA4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 301 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 6e-19 | |
| pfam13459 | 60 | pfam13459, Fer4_15, 4Fe-4S single cluster domain | 2e-18 | |
| PRK14296 | 372 | PRK14296, PRK14296, chaperone protein DnaJ; Provis | 6e-17 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 1e-16 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 2e-15 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 3e-15 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 4e-15 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 1e-14 | |
| PRK14281 | 397 | PRK14281, PRK14281, chaperone protein DnaJ; Provis | 1e-14 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 1e-13 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 2e-13 | |
| PRK14293 | 374 | PRK14293, PRK14293, chaperone protein DnaJ; Provis | 3e-13 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 4e-13 | |
| PRK14283 | 378 | PRK14283, PRK14283, chaperone protein DnaJ; Provis | 4e-13 | |
| PRK10767 | 371 | PRK10767, PRK10767, chaperone protein DnaJ; Provis | 2e-12 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 2e-12 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 2e-12 | |
| COG2214 | 237 | COG2214, CbpA, DnaJ-class molecular chaperone [Pos | 3e-12 | |
| pfam13370 | 58 | pfam13370, Fer4_13, 4Fe-4S single cluster domain | 9e-12 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 1e-11 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 3e-11 | |
| PRK14301 | 373 | PRK14301, PRK14301, chaperone protein DnaJ; Provis | 3e-11 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 3e-11 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 5e-11 | |
| PRK14295 | 389 | PRK14295, PRK14295, chaperone protein DnaJ; Provis | 2e-10 | |
| PRK10266 | 306 | PRK10266, PRK10266, curved DNA-binding protein Cbp | 9e-10 | |
| PRK14279 | 392 | PRK14279, PRK14279, chaperone protein DnaJ; Provis | 1e-09 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 2e-09 | |
| PRK14289 | 386 | PRK14289, PRK14289, chaperone protein DnaJ; Provis | 3e-09 | |
| PRK14294 | 366 | PRK14294, PRK14294, chaperone protein DnaJ; Provis | 3e-09 | |
| PRK14285 | 365 | PRK14285, PRK14285, chaperone protein DnaJ; Provis | 4e-09 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 7e-09 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 1e-08 | |
| COG1141 | 68 | COG1141, Fer, Ferredoxin [Energy production and co | 2e-08 | |
| PRK14300 | 372 | PRK14300, PRK14300, chaperone protein DnaJ; Provis | 3e-08 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 4e-08 | |
| PTZ00037 | 421 | PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov | 5e-08 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 9e-08 | |
| PRK14288 | 369 | PRK14288, PRK14288, chaperone protein DnaJ; Provis | 4e-07 | |
| PRK09430 | 267 | PRK09430, djlA, Dna-J like membrane chaperone prot | 2e-06 | |
| TIGR01944 | 165 | TIGR01944, rnfB, electron transport complex, RnfAB | 1e-05 | |
| PTZ00341 | 1136 | PTZ00341, PTZ00341, Ring-infected erythrocyte surf | 1e-05 | |
| PRK05113 | 191 | PRK05113, PRK05113, electron transport complex pro | 4e-05 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 9e-05 | |
| COG2878 | 198 | COG2878, COG2878, Predicted NADH:ubiquinone oxidor | 5e-04 | |
| PRK06991 | 270 | PRK06991, PRK06991, ferredoxin; Provisional | 0.003 | |
| PRK05014 | 171 | PRK05014, hscB, co-chaperone HscB; Provisional | 0.004 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 78.3 bits (194), Expect = 6e-19
Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
Query: 50 NYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQKGHEHTL--LLNEAYKVLMRGDLRK 107
+YYE+LGV +A+ +EIK+AYRKL KYHPD +NEAY+VL + R
Sbjct: 1 DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60
Query: 108 DYD 110
YD
Sbjct: 61 IYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|222145 pfam13459, Fer4_15, 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222081 pfam13370, Fer4_13, 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224064 COG1141, Fer, Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235347 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179914 PRK05014, hscB, co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 301 | |||
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 100.0 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 100.0 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 100.0 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.98 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.97 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.97 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.97 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.97 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.96 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.96 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.96 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.96 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.93 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.92 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.88 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.87 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.75 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.69 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.68 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.66 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.63 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.62 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.61 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.6 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.58 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.58 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.57 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.51 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.48 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.47 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.42 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.39 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 99.36 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.35 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 99.34 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.34 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.27 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.27 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.23 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 99.2 | |
| PHA02624 | 647 | large T antigen; Provisional | 99.14 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.03 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 99.01 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.85 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.78 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.59 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 98.33 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.23 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.09 | |
| PF13459 | 65 | Fer4_15: 4Fe-4S single cluster domain | 97.94 | |
| PF13370 | 58 | Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A | 97.88 | |
| COG1141 | 68 | Fer Ferredoxin [Energy production and conversion] | 97.88 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 97.17 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 96.04 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 95.02 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 94.93 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 94.9 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 94.75 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 94.66 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 94.63 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 94.54 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 94.45 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 94.36 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 94.34 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 94.23 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 93.87 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 93.8 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 93.69 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 93.67 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 93.65 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 93.51 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 93.27 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 93.06 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 93.01 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 92.92 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 92.82 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 92.82 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 92.68 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 92.68 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 92.56 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 92.49 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 92.4 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 91.78 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 91.67 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 91.47 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 91.46 | |
| PF12797 | 22 | Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 | 90.07 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 89.84 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 89.58 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 89.32 | |
| PF06902 | 64 | Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: | 88.32 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 87.8 | |
| PF13446 | 62 | RPT: A repeated domain in UCH-protein | 85.2 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 80.76 | |
| PF11833 | 194 | DUF3353: Protein of unknown function (DUF3353); In | 80.27 |
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-41 Score=319.67 Aligned_cols=207 Identities=24% Similarity=0.295 Sum_probs=163.0
Q ss_pred CCccCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCC-C-cchHHHHHHHHHHhhhhccccccccccccccccc--ccc
Q 022195 46 SKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAG-Q-KGHEHTLLLNEAYKVLMRGDLRKDYDASIGQMRF--HFG 121 (301)
Q Consensus 46 ~~~~d~Y~iLgv~~~as~~eIk~ayr~l~~~~HPD~~~-~-~~~~~f~~i~~AY~vL~d~~~R~~YD~~~~~~~~--~~~ 121 (301)
++.+|||+||||+++||.+|||+|||+||++||||+|+ + +++++|++|++||||||||++|++||+++..... +++
T Consensus 1 ~~~~dyYeiLGV~k~As~~EIKkAYRkLA~kyHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG~~~~~~gg~g 80 (371)
T COG0484 1 MAKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFGHAGFKAGGFG 80 (371)
T ss_pred CCccchhhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccCccccccCCcC
Confidence 35789999999999999999999999999999999999 3 4778999999999999999999999999854421 222
Q ss_pred c---c------------CCCCccc--ccCCCCCCCCccccc-----------------ccccccCCCCCcc------ccc
Q 022195 122 T---N------------ASAGFSR--SSWKGPPRPEALFVD-----------------ENACIGCRECVHH------ASN 161 (301)
Q Consensus 122 ~---~------------~f~g~g~--~~~~gp~r~~difvd-----------------e~~CigC~~C~g~------ap~ 161 (301)
. + +|+|.+. ..-..+.++.|+..+ ..+-..|..|.++ .+.
T Consensus 81 g~g~~~fgg~~~DIF~~~FgGg~~~~~~~~~~~rG~Dl~~~l~isleEa~~G~~~~i~~~~~~~C~~C~GsGak~gt~~~ 160 (371)
T COG0484 81 GFGFGGFGGDFGDIFEDFFGGGGGGRRRPNRPRRGADLRYNLEITLEEAVFGVKKEIRVTRSVTCSTCHGSGAKPGTDPK 160 (371)
T ss_pred CCCcCCCCCCHHHHHHHhhcCCCcccCCCCCcccCCceEEEEEeEhhhhccCceeeEecceeeECCcCCCCCCCCCCCCC
Confidence 1 1 1111111 111234456666543 2234556666655 678
Q ss_pred eeeeeCCcceEEEEEeeCCccccccccccCCCc----------ceeeceeeccccEEEEEeCCCCCCCcEEecCC-----
Q 022195 162 TFVMDEATGCARVKVQYGDSDQNIEVSVDSCPV----------NCIHWVDREELPVLEFLIQPQPKKGYGVFGGG----- 226 (301)
Q Consensus 162 tf~~c~g~G~~~v~~q~g~~~~~iq~aC~~Cpg----------~Cig~~~~~e~k~LeV~Ip~G~~dG~~I~g~G----- 226 (301)
+|..|+|.|..+..++. +..+++++|+.|.| .|.|.+.+.+.+.|+|.||+|+.+|++|+..|
T Consensus 161 tC~tC~G~G~v~~~~~~--g~~~~~~~C~~C~G~G~~i~~pC~~C~G~G~v~~~~~i~V~IPaGv~~g~~ir~~g~G~~g 238 (371)
T COG0484 161 TCPTCNGSGQVRTVQRT--GFFSFQQTCPTCNGTGKIIKDPCGKCKGKGRVKKKKSISVNIPAGVDDGDRIRLSGEGEAG 238 (371)
T ss_pred cCCCCCCcCeEEEEEee--eEEEEEEECCCCccceeECCCCCCCCCCCCeEeeeeEEEEECCCCCccCCEEEEecCcccC
Confidence 99999999999888877 67788999999998 79999999999999999999999999996444
Q ss_pred --CCCCCceehhhHHHHHHHHHHhhCCCCC
Q 022195 227 --WERPANVFMAAKAFNKQLQQQAAGGSNP 254 (301)
Q Consensus 227 --~~~~~~vfv~~~~~~~~~~~~~~~~~~~ 254 (301)
++.++|+||.+.+..+..++|..+||+-
T Consensus 239 ~~Ggp~GDLyv~i~v~~h~~F~R~g~dL~~ 268 (371)
T COG0484 239 PNGGPAGDLYVFVHVKPHPIFERDGDDLYC 268 (371)
T ss_pred CCCCCCccEEEEEEeecCCCeEECCCceEe
Confidence 4557999999988777777777777775
|
|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13459 Fer4_15: 4Fe-4S single cluster domain | Back alignment and domain information |
|---|
| >PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A | Back alignment and domain information |
|---|
| >COG1141 Fer Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF06902 Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: IPR010693 This entry represents bacterial ferredoxins such Ferredoxin-1, -2 and -soy from Streptomyces griseolus and Ferredoxin fas2 from Rhodococcus fascians, plus several bacterial hypothetical proteins that contain three highly conserved cysteine residues | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF13446 RPT: A repeated domain in UCH-protein | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 301 | ||||
| 1fxr_A | 64 | Crystal Structure Of The Ferredoxin I From Desulfov | 1e-08 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 2e-08 | ||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 4e-08 | ||
| 2dn9_A | 79 | Solution Structure Of J-Domain From The Dnaj Homolo | 3e-07 | ||
| 2dmx_A | 92 | Solution Structure Of The J Domain Of Dnaj Homolog | 1e-06 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 2e-06 | ||
| 1xbl_A | 107 | Nmr Structure Of The J-Domain (Residues 2-76) In Th | 2e-06 | ||
| 1bq0_A | 103 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-06 | ||
| 1bqz_A | 77 | J-Domain (Residues 1-77) Of The Escherichia Coli N- | 2e-06 | ||
| 3lz8_A | 329 | Structure Of A Putative Chaperone Dnaj From Klebsie | 2e-06 | ||
| 2ctp_A | 78 | Solution Structure Of J-Domain From Human Dnaj Subf | 3e-06 | ||
| 2cug_A | 88 | Solution Structure Of The J Domain Of The Pseudo Dn | 4e-06 | ||
| 2ctr_A | 88 | Solution Structure Of J-Domain From Human Dnaj Subf | 8e-06 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 1e-05 | ||
| 2kqx_A | 73 | Nmr Structure Of The J-Domain (Residues 2-72) In Th | 2e-05 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 4e-05 | ||
| 2ej7_A | 82 | Solution Structure Of The Dnaj Domain Of The Human | 1e-04 | ||
| 1hdj_A | 77 | Human Hsp40 (Hdj-1), Nmr Length = 77 | 1e-04 | ||
| 2y4t_A | 450 | Crystal Structure Of The Human Co-Chaperone P58(Ipk | 2e-04 | ||
| 2y4u_A | 450 | Crystal Structure Of Human P58(Ipk) In Space Group | 3e-04 |
| >pdb|1FXR|A Chain A, Crystal Structure Of The Ferredoxin I From Desulfovibrio Africanus At 2.3 Angstroms Resolution Length = 64 | Back alignment and structure |
|
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
| >pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 | Back alignment and structure |
| >pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 | Back alignment and structure |
| >pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 | Back alignment and structure |
| >pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 | Back alignment and structure |
| >pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 | Back alignment and structure |
| >pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 | Back alignment and structure |
| >pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 | Back alignment and structure |
| >pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
| >pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 | Back alignment and structure |
| >pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 | Back alignment and structure |
| >pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 | Back alignment and structure |
| >pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 301 | |||
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 6e-27 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 5e-26 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 5e-20 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 1e-18 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 2e-18 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 7e-18 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 7e-17 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 1e-16 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 1e-16 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 1e-16 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 2e-16 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 2e-16 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 2e-16 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 2e-16 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 4e-16 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 4e-16 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 5e-16 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 8e-16 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-15 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 2e-15 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 2e-15 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 4e-15 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 4e-15 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 6e-15 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 7e-15 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 7e-15 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 2e-14 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 3e-14 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 5e-13 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 5e-13 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 6e-13 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 9e-13 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 2e-11 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-10 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 8e-10 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 8e-09 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 1e-07 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 | Back alignment and structure |
|---|
Score = 99.4 bits (248), Expect = 6e-27
Identities = 26/61 (42%), Positives = 34/61 (55%)
Query: 141 ALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSDQNIEVSVDSCPVNCIHWV 200
+VD++ CI C CV A F MD A VK G S + +E ++D+CPV CIHW
Sbjct: 3 KFYVDQDECIACESCVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQCIHWE 62
Query: 201 D 201
D
Sbjct: 63 D 63
|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Length = 59 | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Length = 60 | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Length = 66 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Length = 81 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 301 | |||
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.9 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.81 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.81 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.81 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.81 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.81 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.81 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.8 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.8 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.79 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.79 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.78 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.78 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.76 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.76 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.76 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.72 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.72 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.72 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.72 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.7 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.69 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.67 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.67 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.65 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.65 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.63 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.63 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.62 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.61 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.6 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.58 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.47 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 99.27 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.93 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.87 | |
| 3agx_A | 181 | DNAJ homolog subfamily B member 1; chaperone; 1.85 | 97.89 | |
| 2q2g_A | 180 | HSP40 protein, heat shock 40 kDa protein, putative | 97.03 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 97.01 | |
| 1c3g_A | 170 | Heat shock protein 40; beta sheets, short helices, | 96.76 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 93.62 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 92.98 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 92.3 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 90.63 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 90.47 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 88.69 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 88.49 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 87.49 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 86.54 | |
| 3i38_A | 109 | Putative chaperone DNAJ; structural genomics, prot | 83.05 |
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
Probab=99.90 E-value=2.9e-26 Score=215.68 Aligned_cols=195 Identities=21% Similarity=0.280 Sum_probs=45.3
Q ss_pred CCCCCccCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc-chHHHHHHHHHHhhhhcccccccccccccccc-ccc
Q 022195 43 ERASKKKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQK-GHEHTLLLNEAYKVLMRGDLRKDYDASIGQMR-FHF 120 (301)
Q Consensus 43 ~~~~~~~d~Y~iLgv~~~as~~eIk~ayr~l~~~~HPD~~~~~-~~~~f~~i~~AY~vL~d~~~R~~YD~~~~~~~-~~~ 120 (301)
++.+...|||+||||+++|+.+|||+|||+|+++||||+++++ +.++|++|++||++|+||.+|..||+++.... .++
T Consensus 22 ~~~m~~~d~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~~~~~~~~~~ 101 (329)
T 3lz8_A 22 SNAMELKDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRAEYDQLWQHRNDPGF 101 (329)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred cccccccCHHHHcCcCCCCCHHHHHHHHHHHHHHHCCCCCCChHHHHHHHHHHHHHHHhhhhhhhcccchhhccccCCCc
Confidence 4456678999999999999999999999999999999998764 56799999999999999999999999853321 111
Q ss_pred cccCCC--CcccccCCCCCCCCcccccccccccCCC---CCccccc-----eeeeeC-CcceEEEEEeeCCccccccccc
Q 022195 121 GTNASA--GFSRSSWKGPPRPEALFVDENACIGCRE---CVHHASN-----TFVMDE-ATGCARVKVQYGDSDQNIEVSV 189 (301)
Q Consensus 121 ~~~~f~--g~g~~~~~gp~r~~difvde~~CigC~~---C~g~ap~-----tf~~c~-g~G~~~v~~q~g~~~~~iq~aC 189 (301)
+.. +. +.++. .....|+|-+.+--.+-+. ....+.. .+...+ -.|.... +....
T Consensus 102 ~~~-~~~~~~~f~----~~~f~diF~~~Fg~~g~~~~~~~~~~g~Dl~~~l~vsleea~~G~~k~----------i~i~~ 166 (329)
T 3lz8_A 102 GRQ-RQTHEQSYS----QQDFDDIFSSMFGQQAHQRRRQHAARGHDLEIEVAVFLEETLAEQTRT----------ISYNL 166 (329)
T ss_dssp ----------------------------------------CCCCCCEEEEECCCTTGGGSCEEEE----------EEEEE
T ss_pred ccc-cccccCCcC----CCchhhhhHhhhcCcCCCCCCCCcCCCCCEEEEEecchhhhhhccceE----------EEEEE
Confidence 110 00 00110 0011233322110000000 0000000 000000 0121111 11111
Q ss_pred cCCCcceeeceeeccccEEEEEeCCCCCCCcEEecCC-------CCCCCceehhhHHHHHHHHHHhhCCCCC
Q 022195 190 DSCPVNCIHWVDREELPVLEFLIQPQPKKGYGVFGGG-------WERPANVFMAAKAFNKQLQQQAAGGSNP 254 (301)
Q Consensus 190 ~~Cpg~Cig~~~~~e~k~LeV~Ip~G~~dG~~I~g~G-------~~~~~~vfv~~~~~~~~~~~~~~~~~~~ 254 (301)
+.|.+ .+...+...+.|+|.||+|+++|++|+..| ++.+||+|+..+...+..++++.+||+-
T Consensus 167 ~v~~g--~G~v~~~~~~~l~V~IP~Gv~~G~~Irl~G~G~~g~~gg~~GDL~v~I~v~~h~~F~R~G~DL~~ 236 (329)
T 3lz8_A 167 PVYNV--FGMIESETPKTLNVKIPAGVVDGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGHNLEI 236 (329)
T ss_dssp EECCS--CC-CCEEEEEEEEEEECTTCCTTCEEEESSCSCCC---CCCCCEEEEECCCCCSSCEEETTEEEE
T ss_pred EeecC--CeEEEEecceEEEEeCCCCCCCCCEEEEcccccCCCCCCCCCcEEEEEEEecCCccEEcCCcEEE
Confidence 11211 233344445689999999999999997554 2457899999977666666677766654
|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3agx_A DNAJ homolog subfamily B member 1; chaperone; 1.85A {Homo sapiens} PDB: 3agy_A 3agz_A 2qld_A | Back alignment and structure |
|---|
| >2q2g_A HSP40 protein, heat shock 40 kDa protein, putative (fragment); malaria, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1c3g_A Heat shock protein 40; beta sheets, short helices, chaperone; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 PDB: 2b26_A | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >3i38_A Putative chaperone DNAJ; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 301 | ||||
| d1fxra_ | 64 | d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte | 8e-14 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 7e-13 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 4e-12 | |
| d1iqza_ | 81 | d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyt | 7e-12 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 1e-11 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 2e-11 | |
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 3e-11 | |
| d1fxda_ | 58 | d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [T | 1e-10 | |
| d1iura_ | 88 | a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human | 2e-10 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 2e-09 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 7e-09 | |
| d1sj1a_ | 66 | d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus | 2e-08 | |
| d1vjwa_ | 59 | d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [T | 5e-06 | |
| d3c8ya3 | 83 | d.58.1.5 (A:127-209) Fe-only hydrogenase, second d | 0.003 |
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: 4Fe-4S ferredoxins family: Single 4Fe-4S cluster ferredoxin domain: Ferredoxin I species: Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]
Score = 62.9 bits (152), Expect = 8e-14
Identities = 26/62 (41%), Positives = 34/62 (54%)
Query: 141 ALFVDENACIGCRECVHHASNTFVMDEATGCARVKVQYGDSDQNIEVSVDSCPVNCIHWV 200
+VD++ CI C CV A F MD A VK G S + +E ++D+CPV CIHW
Sbjct: 3 KFYVDQDECIACESCVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQCIHWE 62
Query: 201 DR 202
D
Sbjct: 63 DE 64
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Length = 81 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Length = 58 | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Length = 66 | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Length = 59 | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 301 | |||
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.85 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.8 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.79 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.7 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.65 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.6 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.59 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 98.39 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 97.36 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 97.2 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 97.03 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 96.49 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 96.47 | |
| d1c3ga1 | 80 | Heat shock protein 40 Sis1 {Baker's yeast (Sacchar | 96.38 | |
| d1nlta1 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 95.96 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 91.6 |
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: DnaJ chaperone, N-terminal (J) domain species: Escherichia coli [TaxId: 562]
Probab=99.85 E-value=3.9e-22 Score=147.01 Aligned_cols=68 Identities=40% Similarity=0.632 Sum_probs=62.1
Q ss_pred ccCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCc--chHHHHHHHHHHhhhhcccccccccccccc
Q 022195 48 KKNYYELLGVSVEANGQEIKEAYRKLQKKYHPDIAGQK--GHEHTLLLNEAYKVLMRGDLRKDYDASIGQ 115 (301)
Q Consensus 48 ~~d~Y~iLgv~~~as~~eIk~ayr~l~~~~HPD~~~~~--~~~~f~~i~~AY~vL~d~~~R~~YD~~~~~ 115 (301)
..|||+||||+++||.+|||+|||+|++++|||+++.+ ..+.|..|++||+||+||.+|..||.+|..
T Consensus 2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~ 71 (75)
T d1xbla_ 2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA 71 (75)
T ss_dssp CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence 57999999999999999999999999999999998753 456899999999999999999999998643
|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta1 b.4.1.1 (A:110-138,A:213-257) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|