Citrus Sinensis ID: 022221
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 300 | ||||||
| 224057168 | 304 | predicted protein [Populus trichocarpa] | 0.986 | 0.973 | 0.763 | 1e-124 | |
| 225435608 | 301 | PREDICTED: zinc finger CCCH domain-conta | 0.973 | 0.970 | 0.801 | 1e-124 | |
| 224076054 | 315 | predicted protein [Populus trichocarpa] | 0.973 | 0.926 | 0.733 | 1e-122 | |
| 356536568 | 297 | PREDICTED: zinc finger CCCH domain-conta | 0.966 | 0.976 | 0.776 | 1e-119 | |
| 225450321 | 296 | PREDICTED: zinc finger CCCH domain-conta | 0.98 | 0.993 | 0.766 | 1e-118 | |
| 358248424 | 297 | uncharacterized protein LOC100818781 [Gl | 0.966 | 0.976 | 0.762 | 1e-118 | |
| 225441425 | 297 | PREDICTED: zinc finger CCCH domain-conta | 0.963 | 0.973 | 0.702 | 1e-114 | |
| 356504859 | 295 | PREDICTED: zinc finger CCCH domain-conta | 0.96 | 0.976 | 0.681 | 1e-113 | |
| 356504857 | 295 | PREDICTED: zinc finger CCCH domain-conta | 0.96 | 0.976 | 0.681 | 1e-111 | |
| 255634442 | 295 | unknown [Glycine max] | 0.96 | 0.976 | 0.677 | 1e-111 |
| >gi|224057168|ref|XP_002299153.1| predicted protein [Populus trichocarpa] gi|222846411|gb|EEE83958.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 449 bits (1156), Expect = e-124, Method: Compositional matrix adjust.
Identities = 232/304 (76%), Positives = 255/304 (83%), Gaps = 8/304 (2%)
Query: 1 MELGGG-RKRGRHDGASNGNGGFKKSKQEMENFPTGIGSKSKPCTKFFSTSGCPFGEGCH 59
ME GGG RKR R+D A NGNGG KK++QEME+F TGIGSKSKPCTKFFSTSGCPFGEGCH
Sbjct: 1 MEFGGGHRKRTRNDAAFNGNGGHKKNRQEMESFSTGIGSKSKPCTKFFSTSGCPFGEGCH 60
Query: 60 FLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPP-SFPDGSSPPAVKSRLCNKYNSAE 118
FLHYVPGGFKAVSQMLN+GG+PA PP RN G P S+ D SSPP+VKSRLCNKYN+ E
Sbjct: 61 FLHYVPGGFKAVSQMLNVGGSPA-LPPASRNQGVPTLSYQDRSSPPSVKSRLCNKYNTVE 119
Query: 119 GCKFGDKCHFAHGEWELGRPT-VPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGAS 177
GCKFGDKCHFAHGEWELG+ + PSYEDPRAM GP+ GRM +E P Q GAAASFG+S
Sbjct: 120 GCKFGDKCHFAHGEWELGKASAAPSYEDPRAM-GPIPGRMSRHMEHPHQGHGAAASFGSS 178
Query: 178 ATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQA 237
AT KISIDA LAGAIIGKNGVNSK ICR+TGAKLSIRDHE DP R+IELEG+FDQI QA
Sbjct: 179 ATTKISIDASLAGAIIGKNGVNSKHICRVTGAKLSIRDHEADPKKRSIELEGSFDQISQA 238
Query: 238 SAMVRELIVNVGSGSGHSMKS---NSSSQSNNFKTKLCENFAKGSCTFGDRCHFAHGSEE 294
S MVR+LI NVG SG +K+ +SS SNNFKTK+CENF KGSCTFGDRCHFAHG+EE
Sbjct: 239 SDMVRQLISNVGQASGPPIKNQAMHSSGGSNNFKTKICENFNKGSCTFGDRCHFAHGAEE 298
Query: 295 LRKS 298
LRKS
Sbjct: 299 LRKS 302
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225435608|ref|XP_002285629.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224076054|ref|XP_002304891.1| predicted protein [Populus trichocarpa] gi|222842323|gb|EEE79870.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356536568|ref|XP_003536809.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225450321|ref|XP_002273052.1| PREDICTED: zinc finger CCCH domain-containing protein 14 [Vitis vinifera] gi|147768909|emb|CAN75883.1| hypothetical protein VITISV_024456 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|358248424|ref|NP_001240135.1| uncharacterized protein LOC100818781 [Glycine max] gi|255636715|gb|ACU18693.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225441425|ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356504859|ref|XP_003521212.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504857|ref|XP_003521211.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255634442|gb|ACU17586.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 300 | ||||||
| TAIR|locus:2170169 | 240 | AT5G06770 [Arabidopsis thalian | 0.4 | 0.5 | 0.601 | 1.6e-63 | |
| TAIR|locus:2099292 | 248 | AT3G12130 [Arabidopsis thalian | 0.646 | 0.782 | 0.433 | 4.4e-36 | |
| UNIPROTKB|G3V2D5 | 176 | ZFP36L1 "Zinc finger protein 3 | 0.1 | 0.170 | 0.516 | 3.7e-08 | |
| TAIR|locus:2028306 | 384 | AT1G32360 [Arabidopsis thalian | 0.116 | 0.091 | 0.542 | 4e-08 | |
| UNIPROTKB|G3V2P5 | 207 | ZFP36L1 "Zinc finger protein 3 | 0.1 | 0.144 | 0.516 | 9e-08 | |
| TAIR|locus:2090669 | 386 | AT3G19360 [Arabidopsis thalian | 0.11 | 0.085 | 0.588 | 1.9e-07 | |
| UNIPROTKB|Q7ZXW9 | 363 | zfp36l2-A "Zinc finger protein | 0.106 | 0.088 | 0.484 | 5e-07 | |
| UNIPROTKB|A7MB98 | 338 | ZFP36L1 "Uncharacterized prote | 0.1 | 0.088 | 0.516 | 5.5e-07 | |
| UNIPROTKB|E2R2W0 | 338 | ZFP36L1 "Uncharacterized prote | 0.1 | 0.088 | 0.516 | 5.5e-07 | |
| UNIPROTKB|Q07352 | 338 | ZFP36L1 "Zinc finger protein 3 | 0.1 | 0.088 | 0.516 | 5.5e-07 |
| TAIR|locus:2170169 AT5G06770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 364 (133.2 bits), Expect = 1.6e-63, Sum P(2) = 1.6e-63
Identities = 74/123 (60%), Positives = 89/123 (72%)
Query: 181 KISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAM 240
KIS+DA LAGAIIGK G++SKQICR TGAKLSI+DHE DPNL+ IELEGTF+QI AS M
Sbjct: 117 KISVDASLAGAIIGKGGIHSKQICRETGAKLSIKDHERDPNLKIIELEGTFEQINVASGM 176
Query: 241 VRELIV---NVXXXXXXXXXXXXXXXXXXFKTKLCENFAKGSCTFGDRCHFAHGSEELRK 297
VRELI +V +KTK+C+ ++KG+CT+GDRCHFAHG ELR+
Sbjct: 177 VRELIGRLGSVKKPQGIGGPEGKPHPGSNYKTKICDRYSKGNCTYGDRCHFAHGESELRR 236
Query: 298 SVI 300
S I
Sbjct: 237 SGI 239
|
|
| TAIR|locus:2099292 AT3G12130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V2D5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028306 AT1G32360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V2P5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090669 AT3G19360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7ZXW9 zfp36l2-A "Zinc finger protein 36, C3H1 type-like 2-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MB98 ZFP36L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R2W0 ZFP36L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q07352 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 300 | |||
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 9e-14 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 1e-12 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 5e-12 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 8e-08 | |
| smart00356 | 27 | smart00356, ZnF_C3H1, zinc finger | 7e-07 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 1e-06 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 2e-06 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 2e-04 | |
| TIGR03665 | 172 | TIGR03665, arCOG04150, arCOG04150 universal archae | 3e-04 | |
| pfam00642 | 27 | pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t | 7e-04 | |
| COG5063 | 351 | COG5063, CTH1, CCCH-type Zn-finger protein [Genera | 0.002 | |
| PRK13763 | 180 | PRK13763, PRK13763, putative RNA-processing protei | 0.004 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
Score = 64.5 bits (158), Expect = 9e-14
Identities = 20/63 (31%), Positives = 34/63 (53%)
Query: 179 TAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQAS 238
T ++ + + L G IIGK G K+I TGAK+ I D R + + GT + +++A
Sbjct: 1 TERVLVPSSLVGRIIGKGGSTIKEIREETGAKIKIPDSGSGSEERIVTITGTPEAVEKAK 60
Query: 239 AMV 241
++
Sbjct: 61 ELI 63
|
KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64 |
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) | Back alignment and domain information |
|---|
| >gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 99.62 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 99.6 | |
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 99.06 | |
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 98.97 | |
| KOG1595 | 528 | consensus CCCH-type Zn-finger protein [General fun | 98.91 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 98.86 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.83 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 98.81 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 98.66 | |
| KOG1595 | 528 | consensus CCCH-type Zn-finger protein [General fun | 98.64 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 98.54 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 98.54 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 98.46 | |
| KOG1040 | 325 | consensus Polyadenylation factor I complex, subuni | 98.45 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 98.45 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 98.45 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 98.44 | |
| KOG2333 | 614 | consensus Uncharacterized conserved protein [Gener | 98.33 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 98.31 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 98.31 | |
| KOG2494 | 331 | consensus C3H1-type Zn-finger protein [Transcripti | 98.0 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 97.89 | |
| PF13014 | 43 | KH_3: KH domain | 97.88 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 97.85 | |
| KOG2494 | 331 | consensus C3H1-type Zn-finger protein [Transcripti | 97.77 | |
| KOG1492 | 377 | consensus C3H1-type Zn-finger protein [General fun | 97.77 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 97.74 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 97.72 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 97.67 | |
| KOG1763 | 343 | consensus Uncharacterized conserved protein, conta | 97.66 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 97.51 | |
| KOG1040 | 325 | consensus Polyadenylation factor I complex, subuni | 97.44 | |
| COG5252 | 299 | Uncharacterized conserved protein, contains CCCH-t | 97.26 | |
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 97.17 | |
| KOG0336 | 629 | consensus ATP-dependent RNA helicase [RNA processi | 97.16 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 97.14 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 96.95 | |
| KOG4791 | 667 | consensus Uncharacterized conserved protein [Funct | 96.94 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 96.94 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 96.81 | |
| KOG2185 | 486 | consensus Predicted RNA-processing protein, contai | 96.77 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 96.67 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 96.2 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 96.16 | |
| KOG2190 | 485 | consensus PolyC-binding proteins alphaCP-1 and rel | 96.16 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.12 | |
| KOG2192 | 390 | consensus PolyC-binding hnRNP-K protein HRB57A/hnR | 96.1 | |
| KOG2185 | 486 | consensus Predicted RNA-processing protein, contai | 95.85 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 95.76 | |
| KOG2333 | 614 | consensus Uncharacterized conserved protein [Gener | 95.37 | |
| KOG1492 | 377 | consensus C3H1-type Zn-finger protein [General fun | 95.31 | |
| COG5084 | 285 | YTH1 Cleavage and polyadenylation specificity fact | 95.29 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 95.2 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.19 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.17 | |
| KOG2202 | 260 | consensus U2 snRNP splicing factor, small subunit, | 95.16 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 93.48 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.98 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 92.64 | |
| KOG1763 | 343 | consensus Uncharacterized conserved protein, conta | 91.93 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.48 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 91.17 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 90.78 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 90.56 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 90.52 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.78 | |
| COG5252 | 299 | Uncharacterized conserved protein, contains CCCH-t | 89.37 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 87.21 | |
| KOG4791 | 667 | consensus Uncharacterized conserved protein [Funct | 86.3 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 84.42 | |
| PF10650 | 23 | zf-C3H1: Putative zinc-finger domain; InterPro: IP | 83.94 | |
| KOG2279 | 608 | consensus Kinase anchor protein AKAP149, contains | 82.59 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 81.98 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 81.4 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 80.67 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 80.65 |
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.62 E-value=4.3e-16 Score=145.08 Aligned_cols=75 Identities=27% Similarity=0.567 Sum_probs=58.2
Q ss_pred ccccccccccccCCCCCCCCCCCCCCCCcchhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccccCcCC
Q 022221 41 KPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNKYNSAEGC 120 (300)
Q Consensus 41 ~lC~~y~~~g~C~~G~~C~F~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kt~~C~~~~~~~~C 120 (300)
..|..|...+.|.++..|+|.|........+.. .......+..|||.+|.+|.+.+.|
T Consensus 87 ~~~~~~~~~~~~~~~s~~~~~~p~~~~~~~~~~----------------------~~~~~~~p~~~kt~lc~~~~~~g~c 144 (332)
T KOG1677|consen 87 GDCSAYLRTGVCGYGSSCRYNHPDLRLRPRPVR----------------------RSRGERKPERYKTPLCRSFRKSGTC 144 (332)
T ss_pred cccccccccCCCCCCCCCCccCcccccccCCcc----------------------ccccccCcccccCCcceeeecCccc
Confidence 789999999999999999999975332111100 0112234578999999999999999
Q ss_pred CC-CCCCccCCCccccCC
Q 022221 121 KF-GDKCHFAHGEWELGR 137 (300)
Q Consensus 121 ~~-g~~C~f~H~~~~~~~ 137 (300)
+| |++|+|+|+.++++.
T Consensus 145 ~y~ge~crfah~~~e~r~ 162 (332)
T KOG1677|consen 145 KYRGEQCRFAHGLEELRL 162 (332)
T ss_pred cccCchhhhcCCcccccc
Confidence 99 999999999988884
|
|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2333 consensus Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2494 consensus C3H1-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2494 consensus C3H1-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG4791 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2333 consensus Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG4791 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger | Back alignment and domain information |
|---|
| >KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 300 | |||
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 8e-22 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 4e-20 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-18 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-17 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 1e-16 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 1e-16 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 6e-16 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 1e-14 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 9e-14 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 1e-13 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 3e-13 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 5e-08 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 1e-06 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 3e-06 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 3e-04 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 3e-13 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 8e-12 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 4e-10 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 9e-12 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 2e-10 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-11 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 1e-10 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 2e-11 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 4e-11 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 3e-11 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 4e-11 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 9e-10 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 5e-10 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-09 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 1e-09 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 4e-08 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 5e-04 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 5e-08 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 6e-08 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-07 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 3e-07 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 1e-06 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 4e-04 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 4e-06 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 8e-06 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-05 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 3e-04 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 3e-04 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 6e-04 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 8e-04 |
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
Score = 86.2 bits (214), Expect = 8e-22
Identities = 25/74 (33%), Positives = 39/74 (52%)
Query: 172 ASFGASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTF 231
+ G T +++I LAG+IIGK G KQI +GA + I + R I + GT
Sbjct: 1 GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQ 60
Query: 232 DQIKQASAMVRELI 245
DQI+ A +++ +
Sbjct: 61 DQIQNAQYLLQNSV 74
|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 99.72 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 99.66 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 99.38 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 99.31 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 99.26 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 99.06 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 99.01 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 98.99 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 98.98 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 98.98 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 98.98 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 98.97 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 98.96 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 98.94 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 98.94 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 98.91 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 98.89 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 98.88 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 98.86 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 98.85 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 98.83 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 98.79 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 98.78 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 98.77 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 98.75 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 98.75 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 98.64 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 98.63 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 98.62 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 98.48 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 98.47 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 98.4 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 98.39 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 98.37 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.34 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 98.34 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 98.31 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 98.3 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 98.29 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 98.27 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 98.26 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 98.25 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 98.24 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 98.24 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 98.19 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 98.06 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 98.03 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 97.97 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 97.96 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 97.87 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 97.8 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 97.6 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 97.23 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 97.12 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 97.1 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 97.09 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.01 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 96.47 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 96.37 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 96.31 | |
| 3u9g_A | 229 | Zinc finger CCCH-type antiviral protein 1; zinc fi | 96.3 | |
| 2fc6_A | 50 | Nuclear, target of EGR1, member 1; structure genom | 96.26 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 96.11 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 96.01 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 95.97 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 95.79 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 95.57 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 93.64 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 93.64 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 91.63 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 88.03 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 84.55 | |
| 3v33_A | 223 | Ribonuclease ZC3H12A; rossmann-like sandwich fold, | 82.31 | |
| 3v33_A | 223 | Ribonuclease ZC3H12A; rossmann-like sandwich fold, | 81.99 |
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
Probab=99.72 E-value=1.7e-18 Score=126.11 Aligned_cols=71 Identities=30% Similarity=0.667 Sum_probs=30.5
Q ss_pred CCCccccccccccccccccCCCCCCCCCCCCCCCCcchhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccc
Q 022221 34 TGIGSKSKPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNK 113 (300)
Q Consensus 34 ~~~~~Kt~lC~~y~~~g~C~~G~~C~F~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kt~~C~~ 113 (300)
....|||+||++|+.+|.|++|++|+|+|+..+++.. ...+.+||++|++
T Consensus 6 ~~~~~kt~~C~~f~~~G~C~~G~~C~f~H~~~e~~~~------------------------------~~~~~~k~~~C~~ 55 (77)
T 1m9o_A 6 TSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQA------------------------------NRHPKYKTELCHK 55 (77)
T ss_dssp CSSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGT------------------------------C------------
T ss_pred CCCCccchhCHHhhhCCCcCCCCCccCCCCChhhccc------------------------------cccccccCCcccc
Confidence 3467999999888789999999999999998765311 0124678999998
Q ss_pred cccCcCCCCCCCCccCCCccc
Q 022221 114 YNSAEGCKFGDKCHFAHGEWE 134 (300)
Q Consensus 114 ~~~~~~C~~g~~C~f~H~~~~ 134 (300)
|...|.|++|++|+|+|+..|
T Consensus 56 f~~~G~C~~G~~C~f~H~~~e 76 (77)
T 1m9o_A 56 FKLQGRCPYGSRCHFIHNPTE 76 (77)
T ss_dssp ---------------------
T ss_pred hhhCcCCCCcCcCCCCCCCCC
Confidence 888888999999999998765
|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 300 | ||||
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-16 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 6e-15 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 1e-14 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-14 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 2e-14 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-14 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 4e-14 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 4e-14 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 7e-13 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 8e-13 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 9e-13 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 3e-09 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 4e-04 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 2e-12 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 3e-12 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 4e-12 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 9e-09 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 3e-04 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 9e-12 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 7e-11 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 3e-10 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 5e-10 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 3e-09 | |
| d1rgoa2 | 34 | g.66.1.1 (A:187-220) Butyrate response factor 2 (T | 8e-05 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 2e-07 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 2e-07 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 3e-07 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 9e-06 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 2e-05 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 6e-05 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 1e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 0.001 |
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Far upstream binding element, FBP species: Mouse (Mus musculus) [TaxId: 10090]
Score = 70.6 bits (173), Expect = 2e-16
Identities = 15/70 (21%), Positives = 33/70 (47%)
Query: 176 ASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIK 235
+ T + + + G IIG+ G +I + +G K+ I R+ L GT + ++
Sbjct: 6 SVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQ 65
Query: 236 QASAMVRELI 245
A ++ +++
Sbjct: 66 SAKRLLDQIV 75
|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 99.48 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.48 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 99.37 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.33 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.29 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 99.26 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.09 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.09 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.04 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 98.94 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 98.92 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 98.9 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 98.85 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 98.81 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 98.74 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 98.6 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.57 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.46 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.45 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.36 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 98.34 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 98.29 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 98.24 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 98.18 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.16 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 97.76 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 97.62 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 97.61 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 97.13 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 97.09 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 96.97 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 96.05 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 91.63 | |
| d2fc6a1 | 37 | Target of EGR1 protein 1, TOE1 {Human (Homo sapien | 89.93 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 88.51 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 87.27 |
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: CCCH zinc finger superfamily: CCCH zinc finger family: CCCH zinc finger domain: Tristetraproline (ttp, tis11, nup475) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.48 E-value=8e-15 Score=90.35 Aligned_cols=35 Identities=46% Similarity=1.109 Sum_probs=32.9
Q ss_pred CCCcccccccccc-cccccCCCCCcCCCCcchhccc
Q 022221 264 SNNFKTKLCENFA-KGSCTFGDRCHFAHGSEELRKS 298 (300)
Q Consensus 264 ~~~ykt~~C~~~~-~G~C~~G~~C~faH~~~el~~~ 298 (300)
+++|||+||.+|. .|.|+||++|+|||+++|||.+
T Consensus 4 ~~~yKT~lC~~~~~~g~C~~G~~C~FAHg~~ELr~~ 39 (40)
T d1m9oa_ 4 SSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQA 39 (40)
T ss_dssp SSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGT
T ss_pred CCccccccChhhhcCCcCCCCCCCCCCCCHHHhcCC
Confidence 4789999999998 7999999999999999999986
|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|