Citrus Sinensis ID: 022221


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MELGGGRKRGRHDGASNGNGGFKKSKQEMENFPTGIGSKSKPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNKYNSAEGCKFGDKCHFAHGEWELGRPTVPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAMVRELIVNVGSGSGHSMKSNSSSQSNNFKTKLCENFAKGSCTFGDRCHFAHGSEELRKSVI
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEccccccccccccHHccccEEEcccccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHcccccccccccccccccccccHHHHHcccc
ccccccccccccccccccccccccccccHHHccccccccccccHHHcccccccccccccEEEccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEEEHHHHHHHHcccccccHHHHHHcccEEEEEccccccccccEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccHHHHHcccc
melgggrkrgrhdgasngnggfkkskqemenfptgigskskpctkffstsgcpfgegchflhyvpggFKAVSQMLnlggtpahppppprnsgappsfpdgssppavkSRLCnkynsaegckfgdkchfahgewelgrptvpsyedpramggpmhgrmggrlepppqslgaaasfgasATAKISIDAKLAGaiigkngvnsKQICRLtgaklsirdhevdpnlrnielegtFDQIKQASAMVRELIVNVgsgsghsmksnsssqsnnFKTKLCEnfakgsctfgdrchfahgsEELRKSVI
melgggrkrgrhdgasngnggfkkskQEMENFPtgigskskpcTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNKYNSAEGCKFGDKCHFAHGEWELGRPTVPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGASATAKISIDAKLAGAiigkngvnskQICRLTgaklsirdhevdpnlrnielEGTFDQIKQASAMVRELIVNVGSGSGHSMKSNSSSQSNNFKTKLCENFAKGSCTFgdrchfahgseelrksvi
MELGGGRKRGRHDGASNGNGGFKKSKQEMENFPTGIGSKSKPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTpahppppprnsgappsfpDGSSPPAVKSRLCNKYNSAEGCKFGDKCHFAHGEWELGRPTVPSYEDPramggpmhgrmggrLEPPPQSLgaaasfgasataKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAMVRELIVNVgsgsghsmksnsssqsnnFKTKLCENFAKGSCTFGDRCHFAHGSEELRKSVI
******************************************CTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQML**********************************LCNKYNSAEGCKFGDKCHFAHGEWELG*****************************************ATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAMVRELIVNV*********************KLCENFAKGSCTFGDRCHFA***********
******************************************CTKFFSTSGCPFGEGCHFLHY***************************************************************HFAHGEWELGRPTVPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGASATAKISIDAKLA*******************A******************EGTFDQIKQASAMVRELIVNVGSGSGHSMKSNSSSQSNNFKTKLCENFAKGSCTFGDRCHFAHGSEEL*****
***********HDGASNGNGGFKKSKQEMENFPTGIGSKSKPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNKYNSAEGCKFGDKCHFAHGEWELGRPTVPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAMVRELIVNVGS****************FKTKLCENFAKGSCTFGDRCHFAHGS********
***************************************SKPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQ********************************VKSRLCNKYNSAEGCKFGDKCHFAHGEWELGRPTVPSYEDPRAMGG*MHGRMGGRLEPPPQSLGAA*SFGASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAMVRELIVNVGSG**************NFKTKLCENFAKGSCTFGDRCHFAHG*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELGGGRKRGRHDGASNGNGGFKKSKQEMENFPTGIGSKSKPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNKYNSAEGCKFGDKCHFAHGEWELGRPTVPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAMVRELIVNVGSGSGHSMKSNSSSQSNNFKTKLCENFAKGSCTFGDRCHFAHGSEELRKSVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query300 2.2.26 [Sep-21-2011]
Q7F8R0300 Zinc finger CCCH domain-c yes no 0.973 0.973 0.639 7e-96
Q7XPK1309 Zinc finger CCCH domain-c no no 0.956 0.928 0.582 6e-84
Q69XQ3295 Zinc finger CCCH domain-c no no 0.94 0.955 0.557 2e-82
Q9C7C3248 Zinc finger CCCH domain-c yes no 0.77 0.931 0.491 5e-65
Q9FG30240 Zinc finger CCCH domain-c no no 0.63 0.787 0.521 2e-45
Q9LT81386 Zinc finger CCCH domain-c no no 0.313 0.243 0.314 2e-07
Q84UQ3367 Zinc finger CCCH domain-c no no 0.33 0.269 0.336 6e-06
>sp|Q7F8R0|C3H14_ORYSJ Zinc finger CCCH domain-containing protein 14 OS=Oryza sativa subsp. japonica GN=Os02g0194200 PE=2 SV=1 Back     alignment and function desciption
 Score =  350 bits (898), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 195/305 (63%), Positives = 223/305 (73%), Gaps = 13/305 (4%)

Query: 1   MELGGGRKRGRHDGASNGNGGFKKSKQEMENFPTGIGSKSKPCTKFFSTSGCPFGEGCHF 60
           ME+GG RKRG+ DGA NG GG  K  +E E+F TG+GSKSKPCTKFFSTSGCPFGEGCHF
Sbjct: 1   MEVGG-RKRGKPDGA-NGAGG--KRARESESFQTGVGSKSKPCTKFFSTSGCPFGEGCHF 56

Query: 61  LHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNKYNSAEGC 120
           LH+ PGG++AV++M NLGG PA  PPP R      + PDG   P VK+RLCNKYN+AEGC
Sbjct: 57  LHHFPGGYQAVAKMTNLGG-PAIAPPPGRMPMGN-AVPDGPPTPTVKTRLCNKYNTAEGC 114

Query: 121 KFGDKCHFAHGEWELGRPTVPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGASATA 180
           K+GDKCHFAHGE ELG+P +     P  MG    G       P   ++   ASFGASATA
Sbjct: 115 KWGDKCHFAHGERELGKPMLMDSSMPPPMGPRPTGHFAPPPMPS-PAMSTPASFGASATA 173

Query: 181 KISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAM 240
           KIS+DA LAG IIG+ GVN+KQI R+TGAKL+IRDHE D NL+NIELEGTFDQIK ASAM
Sbjct: 174 KISVDASLAGGIIGRGGVNTKQISRVTGAKLAIRDHESDTNLKNIELEGTFDQIKNASAM 233

Query: 241 VRELIVNVGSGSGHSMK------SNSSSQSNNFKTKLCENFAKGSCTFGDRCHFAHGSEE 294
           VRELIV++G G+    K             +NFKTKLCENF KGSCTFGDRCHFAHG  E
Sbjct: 234 VRELIVSIGGGAPPQGKKPVGGSHRGGGPGSNFKTKLCENFTKGSCTFGDRCHFAHGENE 293

Query: 295 LRKSV 299
           LRKS 
Sbjct: 294 LRKSA 298





Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q7XPK1|C3H31_ORYSJ Zinc finger CCCH domain-containing protein 31 OS=Oryza sativa subsp. japonica GN=Os04g0665700 PE=2 SV=1 Back     alignment and function description
>sp|Q69XQ3|C3H44_ORYSJ Zinc finger CCCH domain-containing protein 44 OS=Oryza sativa subsp. japonica GN=Os06g0618100 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7C3|C3H36_ARATH Zinc finger CCCH domain-containing protein 36 OS=Arabidopsis thaliana GN=At3g12130 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG30|C3H52_ARATH Zinc finger CCCH domain-containing protein 52 OS=Arabidopsis thaliana GN=At5g06770 PE=2 SV=1 Back     alignment and function description
>sp|Q9LT81|C3H39_ARATH Zinc finger CCCH domain-containing protein 39 OS=Arabidopsis thaliana GN=At3g19360 PE=2 SV=1 Back     alignment and function description
>sp|Q84UQ3|C3H56_ORYSJ Zinc finger CCCH domain-containing protein 56 OS=Oryza sativa subsp. japonica GN=Os08g0159800 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
224057168304 predicted protein [Populus trichocarpa] 0.986 0.973 0.763 1e-124
225435608301 PREDICTED: zinc finger CCCH domain-conta 0.973 0.970 0.801 1e-124
224076054315 predicted protein [Populus trichocarpa] 0.973 0.926 0.733 1e-122
356536568297 PREDICTED: zinc finger CCCH domain-conta 0.966 0.976 0.776 1e-119
225450321296 PREDICTED: zinc finger CCCH domain-conta 0.98 0.993 0.766 1e-118
358248424297 uncharacterized protein LOC100818781 [Gl 0.966 0.976 0.762 1e-118
225441425297 PREDICTED: zinc finger CCCH domain-conta 0.963 0.973 0.702 1e-114
356504859295 PREDICTED: zinc finger CCCH domain-conta 0.96 0.976 0.681 1e-113
356504857295 PREDICTED: zinc finger CCCH domain-conta 0.96 0.976 0.681 1e-111
255634442295 unknown [Glycine max] 0.96 0.976 0.677 1e-111
>gi|224057168|ref|XP_002299153.1| predicted protein [Populus trichocarpa] gi|222846411|gb|EEE83958.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/304 (76%), Positives = 255/304 (83%), Gaps = 8/304 (2%)

Query: 1   MELGGG-RKRGRHDGASNGNGGFKKSKQEMENFPTGIGSKSKPCTKFFSTSGCPFGEGCH 59
           ME GGG RKR R+D A NGNGG KK++QEME+F TGIGSKSKPCTKFFSTSGCPFGEGCH
Sbjct: 1   MEFGGGHRKRTRNDAAFNGNGGHKKNRQEMESFSTGIGSKSKPCTKFFSTSGCPFGEGCH 60

Query: 60  FLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPP-SFPDGSSPPAVKSRLCNKYNSAE 118
           FLHYVPGGFKAVSQMLN+GG+PA  PP  RN G P  S+ D SSPP+VKSRLCNKYN+ E
Sbjct: 61  FLHYVPGGFKAVSQMLNVGGSPA-LPPASRNQGVPTLSYQDRSSPPSVKSRLCNKYNTVE 119

Query: 119 GCKFGDKCHFAHGEWELGRPT-VPSYEDPRAMGGPMHGRMGGRLEPPPQSLGAAASFGAS 177
           GCKFGDKCHFAHGEWELG+ +  PSYEDPRAM GP+ GRM   +E P Q  GAAASFG+S
Sbjct: 120 GCKFGDKCHFAHGEWELGKASAAPSYEDPRAM-GPIPGRMSRHMEHPHQGHGAAASFGSS 178

Query: 178 ATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQA 237
           AT KISIDA LAGAIIGKNGVNSK ICR+TGAKLSIRDHE DP  R+IELEG+FDQI QA
Sbjct: 179 ATTKISIDASLAGAIIGKNGVNSKHICRVTGAKLSIRDHEADPKKRSIELEGSFDQISQA 238

Query: 238 SAMVRELIVNVGSGSGHSMKS---NSSSQSNNFKTKLCENFAKGSCTFGDRCHFAHGSEE 294
           S MVR+LI NVG  SG  +K+   +SS  SNNFKTK+CENF KGSCTFGDRCHFAHG+EE
Sbjct: 239 SDMVRQLISNVGQASGPPIKNQAMHSSGGSNNFKTKICENFNKGSCTFGDRCHFAHGAEE 298

Query: 295 LRKS 298
           LRKS
Sbjct: 299 LRKS 302




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225435608|ref|XP_002285629.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224076054|ref|XP_002304891.1| predicted protein [Populus trichocarpa] gi|222842323|gb|EEE79870.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356536568|ref|XP_003536809.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] Back     alignment and taxonomy information
>gi|225450321|ref|XP_002273052.1| PREDICTED: zinc finger CCCH domain-containing protein 14 [Vitis vinifera] gi|147768909|emb|CAN75883.1| hypothetical protein VITISV_024456 [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248424|ref|NP_001240135.1| uncharacterized protein LOC100818781 [Glycine max] gi|255636715|gb|ACU18693.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225441425|ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356504859|ref|XP_003521212.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] Back     alignment and taxonomy information
>gi|356504857|ref|XP_003521211.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] Back     alignment and taxonomy information
>gi|255634442|gb|ACU17586.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
TAIR|locus:2170169240 AT5G06770 [Arabidopsis thalian 0.4 0.5 0.601 1.6e-63
TAIR|locus:2099292248 AT3G12130 [Arabidopsis thalian 0.646 0.782 0.433 4.4e-36
UNIPROTKB|G3V2D5176 ZFP36L1 "Zinc finger protein 3 0.1 0.170 0.516 3.7e-08
TAIR|locus:2028306384 AT1G32360 [Arabidopsis thalian 0.116 0.091 0.542 4e-08
UNIPROTKB|G3V2P5207 ZFP36L1 "Zinc finger protein 3 0.1 0.144 0.516 9e-08
TAIR|locus:2090669386 AT3G19360 [Arabidopsis thalian 0.11 0.085 0.588 1.9e-07
UNIPROTKB|Q7ZXW9 363 zfp36l2-A "Zinc finger protein 0.106 0.088 0.484 5e-07
UNIPROTKB|A7MB98 338 ZFP36L1 "Uncharacterized prote 0.1 0.088 0.516 5.5e-07
UNIPROTKB|E2R2W0 338 ZFP36L1 "Uncharacterized prote 0.1 0.088 0.516 5.5e-07
UNIPROTKB|Q07352 338 ZFP36L1 "Zinc finger protein 3 0.1 0.088 0.516 5.5e-07
TAIR|locus:2170169 AT5G06770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 1.6e-63, Sum P(2) = 1.6e-63
 Identities = 74/123 (60%), Positives = 89/123 (72%)

Query:   181 KISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQASAM 240
             KIS+DA LAGAIIGK G++SKQICR TGAKLSI+DHE DPNL+ IELEGTF+QI  AS M
Sbjct:   117 KISVDASLAGAIIGKGGIHSKQICRETGAKLSIKDHERDPNLKIIELEGTFEQINVASGM 176

Query:   241 VRELIV---NVXXXXXXXXXXXXXXXXXXFKTKLCENFAKGSCTFGDRCHFAHGSEELRK 297
             VRELI    +V                  +KTK+C+ ++KG+CT+GDRCHFAHG  ELR+
Sbjct:   177 VRELIGRLGSVKKPQGIGGPEGKPHPGSNYKTKICDRYSKGNCTYGDRCHFAHGESELRR 236

Query:   298 SVI 300
             S I
Sbjct:   237 SGI 239


GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2099292 AT3G12130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G3V2D5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2028306 AT1G32360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G3V2P5 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2090669 AT3G19360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7ZXW9 zfp36l2-A "Zinc finger protein 36, C3H1 type-like 2-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|A7MB98 ZFP36L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2W0 ZFP36L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q07352 ZFP36L1 "Zinc finger protein 36, C3H1 type-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7F8R0C3H14_ORYSJNo assigned EC number0.63930.97330.9733yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 9e-14
smart0032268 smart00322, KH, K homology RNA-binding domain 1e-12
pfam0001359 pfam00013, KH_1, KH domain 5e-12
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 8e-08
smart0035627 smart00356, ZnF_C3H1, zinc finger 7e-07
pfam1301442 pfam13014, KH_3, KH domain 1e-06
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 2e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 2e-04
TIGR03665172 TIGR03665, arCOG04150, arCOG04150 universal archae 3e-04
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 7e-04
COG5063351 COG5063, CTH1, CCCH-type Zn-finger protein [Genera 0.002
PRK13763180 PRK13763, PRK13763, putative RNA-processing protei 0.004
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
 Score = 64.5 bits (158), Expect = 9e-14
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 179 TAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIKQAS 238
           T ++ + + L G IIGK G   K+I   TGAK+ I D       R + + GT + +++A 
Sbjct: 1   TERVLVPSSLVGRIIGKGGSTIKEIREETGAKIKIPDSGSGSEERIVTITGTPEAVEKAK 60

Query: 239 AMV 241
            ++
Sbjct: 61  ELI 63


KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64

>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|211858 TIGR03665, arCOG04150, arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|227395 COG5063, CTH1, CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|237494 PRK13763, PRK13763, putative RNA-processing protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 300
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 99.62
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 99.6
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 99.06
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 98.97
KOG1595 528 consensus CCCH-type Zn-finger protein [General fun 98.91
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 98.86
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.83
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.81
KOG1676 600 consensus K-homology type RNA binding proteins [RN 98.66
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 98.64
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 98.54
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 98.54
smart0035627 ZnF_C3H1 zinc finger. 98.46
KOG1040325 consensus Polyadenylation factor I complex, subuni 98.45
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.45
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.45
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.44
KOG2333 614 consensus Uncharacterized conserved protein [Gener 98.33
smart0035627 ZnF_C3H1 zinc finger. 98.31
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 98.31
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 98.0
KOG1676 600 consensus K-homology type RNA binding proteins [RN 97.89
PF1301443 KH_3: KH domain 97.88
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 97.85
KOG2494 331 consensus C3H1-type Zn-finger protein [Transcripti 97.77
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 97.77
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 97.74
smart0032269 KH K homology RNA-binding domain. 97.72
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 97.67
KOG1763343 consensus Uncharacterized conserved protein, conta 97.66
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 97.51
KOG1040325 consensus Polyadenylation factor I complex, subuni 97.44
COG5252299 Uncharacterized conserved protein, contains CCCH-t 97.26
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 97.17
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 97.16
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 97.14
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 96.95
KOG4791 667 consensus Uncharacterized conserved protein [Funct 96.94
PRK13763180 putative RNA-processing protein; Provisional 96.94
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.81
KOG2185 486 consensus Predicted RNA-processing protein, contai 96.77
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 96.67
PRK13763180 putative RNA-processing protein; Provisional 96.2
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.16
KOG2190485 consensus PolyC-binding proteins alphaCP-1 and rel 96.16
COG5152259 Uncharacterized conserved protein, contains RING a 96.12
KOG2192 390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 96.1
KOG2185486 consensus Predicted RNA-processing protein, contai 95.85
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 95.76
KOG2333 614 consensus Uncharacterized conserved protein [Gener 95.37
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 95.31
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 95.29
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 95.2
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 95.19
COG5152259 Uncharacterized conserved protein, contains RING a 95.17
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 95.16
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 93.48
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 92.98
KOG0119 554 consensus Splicing factor 1/branch point binding p 92.64
KOG1763 343 consensus Uncharacterized conserved protein, conta 91.93
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 91.48
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 91.17
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 90.78
KOG2113 394 consensus Predicted RNA binding protein, contains 90.56
COG1094194 Predicted RNA-binding protein (contains KH domains 90.52
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.78
COG5252 299 Uncharacterized conserved protein, contains CCCH-t 89.37
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 87.21
KOG4791 667 consensus Uncharacterized conserved protein [Funct 86.3
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 84.42
PF1065023 zf-C3H1: Putative zinc-finger domain; InterPro: IP 83.94
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 82.59
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 81.98
PRK00106 535 hypothetical protein; Provisional 81.4
PRK12704 520 phosphodiesterase; Provisional 80.67
COG5176269 MSL5 Splicing factor (branch point binding protein 80.65
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
Probab=99.62  E-value=4.3e-16  Score=145.08  Aligned_cols=75  Identities=27%  Similarity=0.567  Sum_probs=58.2

Q ss_pred             ccccccccccccCCCCCCCCCCCCCCCCcchhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccccCcCC
Q 022221           41 KPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNKYNSAEGC  120 (300)
Q Consensus        41 ~lC~~y~~~g~C~~G~~C~F~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kt~~C~~~~~~~~C  120 (300)
                      ..|..|...+.|.++..|+|.|........+..                      .......+..|||.+|.+|.+.+.|
T Consensus        87 ~~~~~~~~~~~~~~~s~~~~~~p~~~~~~~~~~----------------------~~~~~~~p~~~kt~lc~~~~~~g~c  144 (332)
T KOG1677|consen   87 GDCSAYLRTGVCGYGSSCRYNHPDLRLRPRPVR----------------------RSRGERKPERYKTPLCRSFRKSGTC  144 (332)
T ss_pred             cccccccccCCCCCCCCCCccCcccccccCCcc----------------------ccccccCcccccCCcceeeecCccc
Confidence            789999999999999999999975332111100                      0112234578999999999999999


Q ss_pred             CC-CCCCccCCCccccCC
Q 022221          121 KF-GDKCHFAHGEWELGR  137 (300)
Q Consensus       121 ~~-g~~C~f~H~~~~~~~  137 (300)
                      +| |++|+|+|+.++++.
T Consensus       145 ~y~ge~crfah~~~e~r~  162 (332)
T KOG1677|consen  145 KYRGEQCRFAHGLEELRL  162 (332)
T ss_pred             cccCchhhhcCCcccccc
Confidence            99 999999999988884



>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG4791 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG4791 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 8e-22
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 4e-20
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 4e-18
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 1e-17
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-16
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-16
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 6e-16
1x4n_A92 FAR upstream element binding protein 1; KH domain, 1e-14
1x4m_A94 FAR upstream element binding protein 1; KH domain, 9e-14
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-13
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 3e-13
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 5e-08
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 1e-06
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 3e-06
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 3e-04
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 3e-13
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 8e-12
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 4e-10
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 9e-12
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-10
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-11
1j4w_A174 FUSE binding protein; single-stranded DNA binding 1e-10
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-11
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 4e-11
1we8_A104 Tudor and KH domain containing protein; structural 3e-11
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-11
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 9e-10
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 5e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 1e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 1e-09
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 4e-08
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 5e-04
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 5e-08
2dgr_A83 Ring finger and KH domain-containing protein 1; st 6e-08
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-07
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 3e-07
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 1e-06
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 4e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 4e-06
1tua_A191 Hypothetical protein APE0754; structural genomics, 8e-06
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-05
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 3e-04
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 3e-04
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 6e-04
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 8e-04
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
 Score = 86.2 bits (214), Expect = 8e-22
 Identities = 25/74 (33%), Positives = 39/74 (52%)

Query: 172 ASFGASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTF 231
            + G   T +++I   LAG+IIGK G   KQI   +GA + I +       R I + GT 
Sbjct: 1   GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQ 60

Query: 232 DQIKQASAMVRELI 245
           DQI+ A  +++  +
Sbjct: 61  DQIQNAQYLLQNSV 74


>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.72
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.66
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 99.38
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 99.31
2rhk_C72 Cleavage and polyadenylation specificity factor su 99.26
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 99.06
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 99.01
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 98.99
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 98.98
1x4n_A92 FAR upstream element binding protein 1; KH domain, 98.98
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 98.98
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 98.97
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 98.96
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 98.94
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 98.94
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.91
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 98.89
2rhk_C72 Cleavage and polyadenylation specificity factor su 98.88
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 98.86
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 98.85
1x4m_A94 FAR upstream element binding protein 1; KH domain, 98.83
2dgr_A83 Ring finger and KH domain-containing protein 1; st 98.79
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 98.78
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 98.77
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 98.75
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 98.75
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 98.64
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 98.63
1we8_A104 Tudor and KH domain containing protein; structural 98.62
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 98.48
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 98.47
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 98.4
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 98.39
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.37
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.34
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.34
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 98.31
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.3
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.29
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.27
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.26
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.25
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 98.24
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.24
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.19
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 98.06
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 98.03
2cpq_A91 FragIle X mental retardation syndrome related prot 97.97
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 97.96
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 97.87
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 97.8
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 97.6
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 97.23
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 97.12
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 97.1
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 97.09
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.01
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 96.47
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 96.37
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 96.31
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 96.3
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 96.26
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 96.11
1tua_A191 Hypothetical protein APE0754; structural genomics, 96.01
3n89_A376 Defective in GERM LINE development protein 3, ISO; 95.97
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 95.79
1tua_A191 Hypothetical protein APE0754; structural genomics, 95.57
3u1l_A 240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 93.64
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 93.64
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 91.63
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 88.03
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 84.55
3v33_A223 Ribonuclease ZC3H12A; rossmann-like sandwich fold, 82.31
3v33_A223 Ribonuclease ZC3H12A; rossmann-like sandwich fold, 81.99
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
Probab=99.72  E-value=1.7e-18  Score=126.11  Aligned_cols=71  Identities=30%  Similarity=0.667  Sum_probs=30.5

Q ss_pred             CCCccccccccccccccccCCCCCCCCCCCCCCCCcchhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccc
Q 022221           34 TGIGSKSKPCTKFFSTSGCPFGEGCHFLHYVPGGFKAVSQMLNLGGTPAHPPPPPRNSGAPPSFPDGSSPPAVKSRLCNK  113 (300)
Q Consensus        34 ~~~~~Kt~lC~~y~~~g~C~~G~~C~F~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kt~~C~~  113 (300)
                      ....|||+||++|+.+|.|++|++|+|+|+..+++..                              ...+.+||++|++
T Consensus         6 ~~~~~kt~~C~~f~~~G~C~~G~~C~f~H~~~e~~~~------------------------------~~~~~~k~~~C~~   55 (77)
T 1m9o_A            6 TSSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQA------------------------------NRHPKYKTELCHK   55 (77)
T ss_dssp             CSSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGT------------------------------C------------
T ss_pred             CCCCccchhCHHhhhCCCcCCCCCccCCCCChhhccc------------------------------cccccccCCcccc
Confidence            3467999999888789999999999999998765311                              0124678999998


Q ss_pred             cccCcCCCCCCCCccCCCccc
Q 022221          114 YNSAEGCKFGDKCHFAHGEWE  134 (300)
Q Consensus       114 ~~~~~~C~~g~~C~f~H~~~~  134 (300)
                      |...|.|++|++|+|+|+..|
T Consensus        56 f~~~G~C~~G~~C~f~H~~~e   76 (77)
T 1m9o_A           56 FKLQGRCPYGSRCHFIHNPTE   76 (77)
T ss_dssp             ---------------------
T ss_pred             hhhCcCCCCcCcCCCCCCCCC
Confidence            888888999999999998765



>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 300
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 2e-16
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 6e-15
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 1e-14
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 2e-14
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 2e-14
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-14
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 4e-14
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 4e-14
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 7e-13
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 8e-13
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 9e-13
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 3e-09
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 4e-04
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-12
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-12
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 4e-12
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 9e-09
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 3e-04
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 9e-12
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 7e-11
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 3e-10
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 5e-10
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 3e-09
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 8e-05
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 2e-07
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-07
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 3e-07
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 9e-06
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 2e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 6e-05
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 1e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 0.001
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Far upstream binding element, FBP
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 70.6 bits (173), Expect = 2e-16
 Identities = 15/70 (21%), Positives = 33/70 (47%)

Query: 176 ASATAKISIDAKLAGAIIGKNGVNSKQICRLTGAKLSIRDHEVDPNLRNIELEGTFDQIK 235
           +  T +  +   + G IIG+ G    +I + +G K+ I         R+  L GT + ++
Sbjct: 6   SVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQ 65

Query: 236 QASAMVRELI 245
            A  ++ +++
Sbjct: 66  SAKRLLDQIV 75


>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 99.48
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.48
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 99.37
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.33
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.29
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.26
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.09
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.04
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 98.94
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 98.92
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 98.9
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 98.85
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 98.81
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 98.74
d2cpqa178 Fragile X mental retardation syndrome related prot 98.6
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.51
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.45
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.36
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 98.34
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.29
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.24
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 98.18
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.16
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 97.89
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 97.76
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 97.62
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 97.61
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 97.13
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 97.09
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 96.97
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 96.05
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 91.63
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 89.93
d2asba367 Transcription factor NusA, C-terminal domains {Myc 88.51
d1hh2p368 Transcription factor NusA, C-terminal domains {The 87.27
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: CCCH zinc finger
superfamily: CCCH zinc finger
family: CCCH zinc finger
domain: Tristetraproline (ttp, tis11, nup475)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.48  E-value=8e-15  Score=90.35  Aligned_cols=35  Identities=46%  Similarity=1.109  Sum_probs=32.9

Q ss_pred             CCCcccccccccc-cccccCCCCCcCCCCcchhccc
Q 022221          264 SNNFKTKLCENFA-KGSCTFGDRCHFAHGSEELRKS  298 (300)
Q Consensus       264 ~~~ykt~~C~~~~-~G~C~~G~~C~faH~~~el~~~  298 (300)
                      +++|||+||.+|. .|.|+||++|+|||+++|||.+
T Consensus         4 ~~~yKT~lC~~~~~~g~C~~G~~C~FAHg~~ELr~~   39 (40)
T d1m9oa_           4 SSRYKTELCRTYSESGRCRYGAKCQFAHGLGELRQA   39 (40)
T ss_dssp             SSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCCGGGT
T ss_pred             CCccccccChhhhcCCcCCCCCCCCCCCCHHHhcCC
Confidence            4789999999998 7999999999999999999986



>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure