Citrus Sinensis ID: 022278
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 300 | ||||||
| 449463234 | 309 | PREDICTED: uncharacterized protein LOC10 | 0.98 | 0.951 | 0.778 | 1e-137 | |
| 51971771 | 298 | unknown protein [Arabidopsis thaliana] | 0.976 | 0.983 | 0.778 | 1e-135 | |
| 22328740 | 298 | ureidoglycine aminohydrolase [Arabidopsi | 0.976 | 0.983 | 0.778 | 1e-135 | |
| 297804480 | 298 | transcription factor [Arabidopsis lyrata | 0.976 | 0.983 | 0.764 | 1e-134 | |
| 51969886 | 298 | unknown protein [Arabidopsis thaliana] | 0.976 | 0.983 | 0.774 | 1e-134 | |
| 312281791 | 298 | unnamed protein product [Thellungiella h | 0.976 | 0.983 | 0.774 | 1e-133 | |
| 384482500 | 266 | Chain A, Crystal Structure Of (S)-Ureido | 0.876 | 0.988 | 0.817 | 1e-126 | |
| 356510942 | 294 | PREDICTED: uncharacterized protein LOC10 | 0.906 | 0.925 | 0.757 | 1e-124 | |
| 356563399 | 293 | PREDICTED: uncharacterized protein LOC10 | 0.916 | 0.938 | 0.745 | 1e-123 | |
| 255637347 | 294 | unknown [Glycine max] | 0.906 | 0.925 | 0.746 | 1e-122 |
| >gi|449463234|ref|XP_004149339.1| PREDICTED: uncharacterized protein LOC101218090 [Cucumis sativus] gi|449521758|ref|XP_004167896.1| PREDICTED: uncharacterized protein LOC101230608 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 494 bits (1271), Expect = e-137, Method: Compositional matrix adjust.
Identities = 229/294 (77%), Positives = 261/294 (88%)
Query: 7 LLVLSVTLSLVTIGATDGGFCSAPSILDRETSSKPMYWKVTNPTLSPSHLQDLPGFTRSV 66
LL+L T SL+ GFCSAPS++D + SK +Y+KVTNPTLSPSHLQDLPGFTRSV
Sbjct: 13 LLILFATSSLLGFAFGGEGFCSAPSVVDSDADSKALYYKVTNPTLSPSHLQDLPGFTRSV 72
Query: 67 YKRDHALITPESHVLSPLPEWTNTLGAYLITPAMGSHFVMYLANMQENARSALPPHDVER 126
YKRDHALITPES V SPLPEWTNTLGAYLITPA+GSHFVMYLA M+E ++S LPP DVER
Sbjct: 73 YKRDHALITPESQVFSPLPEWTNTLGAYLITPALGSHFVMYLAQMKEKSKSGLPPTDVER 132
Query: 127 FIFVVQGSAMLTNASGVSSKLMVDSYTYLPPNFAHSLRAEGSATLVVFERRYASLENHIT 186
F+FV+QG+ LTN+SG+S KL VDS+ YLPPNF HS+ ++ SATLVVFERRYASL +H T
Sbjct: 133 FLFVIQGAVKLTNSSGISEKLTVDSFAYLPPNFDHSVMSDSSATLVVFERRYASLVDHHT 192
Query: 187 EQIVGSTDKQPLLETPGEVFQLRKLLPQAVPFDFNIHIMDFQPGDFLNVKEVHYNQHGLL 246
+QIVGSTDKQPLLETPGEVFQLRKLLP ++P+DFN+HIMDF+PG+FLNVKEVHYNQHGLL
Sbjct: 193 KQIVGSTDKQPLLETPGEVFQLRKLLPMSMPYDFNVHIMDFEPGEFLNVKEVHYNQHGLL 252
Query: 247 LLEGQGIYRLGDSWYPVQAGDVLWMAPFVPQWYAALGKTRTRYLLYKDVNRNPL 300
LLEGQGIYRLGD WYPVQ+GD +WMAPFVPQWYAALGKTR+RYLLYKD+NRNPL
Sbjct: 253 LLEGQGIYRLGDYWYPVQSGDAIWMAPFVPQWYAALGKTRSRYLLYKDMNRNPL 306
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|51971771|dbj|BAD44550.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22328740|ref|NP_193438.2| ureidoglycine aminohydrolase [Arabidopsis thaliana] gi|26451095|dbj|BAC42652.1| unknown protein [Arabidopsis thaliana] gi|296248910|gb|ADH04164.1| ureidoglycine aminohydrolase [Arabidopsis thaliana] gi|332658443|gb|AEE83843.1| ureidoglycine aminohydrolase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297804480|ref|XP_002870124.1| transcription factor [Arabidopsis lyrata subsp. lyrata] gi|297315960|gb|EFH46383.1| transcription factor [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|51969886|dbj|BAD43635.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|312281791|dbj|BAJ33761.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|384482500|pdb|4E2Q|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482501|pdb|4E2Q|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482502|pdb|4E2Q|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482503|pdb|4E2Q|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482504|pdb|4E2Q|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482505|pdb|4E2Q|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482506|pdb|4E2Q|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482507|pdb|4E2Q|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482508|pdb|4E2Q|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482509|pdb|4E2Q|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482510|pdb|4E2Q|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482511|pdb|4E2Q|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482512|pdb|4E2Q|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482513|pdb|4E2Q|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482514|pdb|4E2Q|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482515|pdb|4E2Q|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana gi|384482516|pdb|4E2S|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482517|pdb|4E2S|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482518|pdb|4E2S|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482519|pdb|4E2S|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482520|pdb|4E2S|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482521|pdb|4E2S|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482522|pdb|4E2S|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482523|pdb|4E2S|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482524|pdb|4E2S|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482525|pdb|4E2S|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482526|pdb|4E2S|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482527|pdb|4E2S|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482528|pdb|4E2S|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482529|pdb|4E2S|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482530|pdb|4E2S|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine gi|384482531|pdb|4E2S|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana In Complex With Its Substrate, (S)-Ureidoglycine | Back alignment and taxonomy information |
|---|
| >gi|356510942|ref|XP_003524192.1| PREDICTED: uncharacterized protein LOC100800098 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356563399|ref|XP_003549951.1| PREDICTED: uncharacterized protein LOC100781644 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255637347|gb|ACU19003.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 300 | ||||||
| TAIR|locus:2130459 | 298 | UGLYAH "AT4G17050" [Arabidopsi | 0.93 | 0.936 | 0.802 | 1e-123 | |
| UNIPROTKB|P75713 | 261 | allE "S-ureidoglycine aminohyd | 0.77 | 0.885 | 0.302 | 1.2e-26 | |
| UNIPROTKB|Q5LV26 | 275 | SPO0876 "Uncharacterized prote | 0.78 | 0.850 | 0.326 | 7.6e-25 | |
| TIGR_CMR|SPO_0876 | 275 | SPO_0876 "conserved hypothetic | 0.78 | 0.850 | 0.326 | 7.6e-25 | |
| UNIPROTKB|Q4KA30 | 278 | PFL_3803 "Uncharacterized prot | 0.723 | 0.780 | 0.320 | 6.8e-24 |
| TAIR|locus:2130459 UGLYAH "AT4G17050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1216 (433.1 bits), Expect = 1.0e-123, P = 1.0e-123
Identities = 224/279 (80%), Positives = 244/279 (87%)
Query: 22 TDGGFCSAPSILDRETSSKPMYWKVTNPTLSPSHLQDLPGFTRSVYKRDHALITPESHVL 81
+D GFCSAPSI++ + + P+YWK TNPTLSPSHLQDLPGFTRSVYKRDHALITPESHV
Sbjct: 20 SDDGFCSAPSIVESDEKTNPIYWKATNPTLSPSHLQDLPGFTRSVYKRDHALITPESHVY 79
Query: 82 SPLPEWTNTLGAYLITPAMGSHFVMYLANMQENARSALPPHDVERFIFVVQGSAMLTNAS 141
SPLP+WTNTLGAYLITPA GSHFVMYLA M+E + S LPP D+ER IFVV+G+ LTN S
Sbjct: 80 SPLPDWTNTLGAYLITPATGSHFVMYLAKMKEMSSSGLPPQDIERLIFVVEGAVTLTNTS 139
Query: 142 GVSSKLMVDSYTYLPPNFAHSLRAEGSATLVVFERRYASLENHITEQIVGSTDKQPLLET 201
S KL VDSY YLPPNF HSL SATLVVFERRY L +H TE IVGSTDKQPLLET
Sbjct: 140 SSSKKLTVDSYAYLPPNFHHSLDCVESATLVVFERRYEYLGSHTTELIVGSTDKQPLLET 199
Query: 202 PGEVFQLRKLLPQAVPFDFNIHIMDFQPGDFLNVKEVHYNQHGLLLLEGQGIYRLGDSWY 261
PGEVF+LRKLLP +V +DFNIH MDFQPG+FLNVKEVHYNQHGLLLLEGQGIYRLGD+WY
Sbjct: 200 PGEVFELRKLLPMSVAYDFNIHTMDFQPGEFLNVKEVHYNQHGLLLLEGQGIYRLGDNWY 259
Query: 262 PVQAGDVLWMAPFVPQWYAALGKTRTRYLLYKDVNRNPL 300
PVQAGDV+WMAPFVPQWYAALGKTR+RYLLYKDVNRNPL
Sbjct: 260 PVQAGDVIWMAPFVPQWYAALGKTRSRYLLYKDVNRNPL 298
|
|
| UNIPROTKB|P75713 allE "S-ureidoglycine aminohydrolase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LV26 SPO0876 "Uncharacterized protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0876 SPO_0876 "conserved hypothetical protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4KA30 PFL_3803 "Uncharacterized protein" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 300 | |||
| PRK11171 | 266 | PRK11171, PRK11171, hypothetical protein; Provisio | 4e-83 | |
| TIGR03214 | 252 | TIGR03214, ura-cupin, putative allantoin catabolis | 2e-60 | |
| COG3257 | 264 | COG3257, GlxB, Uncharacterized protein, possibly i | 7e-56 | |
| pfam07883 | 70 | pfam07883, Cupin_2, Cupin domain | 1e-04 | |
| COG1917 | 131 | COG1917, COG1917, Uncharacterized conserved protei | 3e-04 | |
| COG3837 | 161 | COG3837, COG3837, Uncharacterized conserved protei | 0.004 |
| >gnl|CDD|183011 PRK11171, PRK11171, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Score = 250 bits (642), Expect = 4e-83
Identities = 93/252 (36%), Positives = 129/252 (51%), Gaps = 9/252 (3%)
Query: 57 QDLPGFTRSVYKRDHALITPESHVLSPLPEWTNTLGAYLITPAMGSHFVMYLANMQENAR 116
Q TR+V +A+I P+ V S LP W NT L P +G+ F YL ++
Sbjct: 14 QTDLLTTRAVVTEAYAVIPPDDIVTSVLPGWENTRAWVLARPGLGATFSQYLVEVEPGGG 73
Query: 117 S--ALPPHDVERFIFVVQGSAMLTNASGVSSKLMVDSYTYLPPNFAHSLRAEGS--ATLV 172
S P E F+FVV+G LT G + L Y YLPP +LR G+ A
Sbjct: 74 SDQPEPDEGAETFLFVVEGEITLT-LEGKTHALSEGGYAYLPPGSDWTLRNAGAEDARFH 132
Query: 173 VFERRYASLENHIT-EQIVGS---TDKQPLLETPGEVFQLRKLLPQAVPFDFNIHIMDFQ 228
+RY +E H E VG+ + P+ T G R + P+ + FD +++I+ F+
Sbjct: 133 WIRKRYEPVEGHEAPEAFVGNESDIEPIPMPGTDGVWATTRLVDPEDLRFDMHVNIVTFE 192
Query: 229 PGDFLNVKEVHYNQHGLLLLEGQGIYRLGDSWYPVQAGDVLWMAPFVPQWYAALGKTRTR 288
PG + E H +HGL +LEG+G+YRL + W V+AGD +WM + PQ A G R
Sbjct: 193 PGASIPFVETHVMEHGLYVLEGKGVYRLNNDWVEVEAGDFIWMRAYCPQACYAGGPGPFR 252
Query: 289 YLLYKDVNRNPL 300
YLLYKDVNR+P
Sbjct: 253 YLLYKDVNRHPE 264
|
Length = 266 |
| >gnl|CDD|200251 TIGR03214, ura-cupin, putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >gnl|CDD|225796 COG3257, GlxB, Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain | Back alignment and domain information |
|---|
| >gnl|CDD|224829 COG1917, COG1917, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226357 COG3837, COG3837, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 100.0 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 100.0 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 100.0 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 99.93 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 99.9 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 99.69 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 99.59 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 99.56 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 99.55 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 99.48 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 99.44 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 99.39 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 99.38 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 99.35 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 99.32 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 99.31 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 99.29 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 99.28 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 99.27 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.27 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 99.22 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 99.22 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 99.21 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 99.2 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 99.2 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 99.18 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.1 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 99.07 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 99.05 | |
| PLN00212 | 493 | glutelin; Provisional | 99.0 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 98.99 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 98.94 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 98.92 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 98.84 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 98.81 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 98.81 | |
| PF04962 | 261 | KduI: KduI/IolB family; InterPro: IPR021120 The Kd | 98.73 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 98.72 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 98.69 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 98.68 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 98.67 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 98.65 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.65 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 98.63 | |
| PLN00212 | 493 | glutelin; Provisional | 98.62 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 98.62 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 98.62 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 98.6 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 98.58 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 98.56 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 98.48 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 98.34 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 98.29 | |
| PRK00924 | 276 | 5-keto-4-deoxyuronate isomerase; Provisional | 98.24 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 98.23 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 98.22 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 98.21 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 98.16 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 98.16 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 98.11 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 98.05 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 98.05 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 98.01 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 98.0 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 97.99 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 97.96 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 97.95 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 97.94 | |
| COG3718 | 270 | IolB Uncharacterized enzyme involved in inositol m | 97.89 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 97.89 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 97.88 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 97.86 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 97.8 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 97.8 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 97.79 | |
| COG1482 | 312 | ManA Phosphomannose isomerase [Carbohydrate transp | 97.78 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 97.73 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 97.72 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 97.69 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 97.66 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 97.62 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 97.59 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 97.59 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 97.58 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 97.57 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 97.56 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 97.45 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 97.4 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 97.4 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 97.33 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 97.31 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 97.26 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 97.22 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 97.18 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 97.18 | |
| COG1741 | 276 | Pirin-related protein [General function prediction | 97.03 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 97.03 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 97.02 | |
| PF05962 | 184 | HutD: HutD; InterPro: IPR010282 This entry contain | 96.97 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 96.91 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 96.82 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 96.82 | |
| PHA01976 | 67 | helix-turn-helix protein | 96.62 | |
| TIGR03070 | 58 | couple_hipB transcriptional regulator, y4mF family | 96.6 | |
| PF12844 | 64 | HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ | 96.59 | |
| TIGR02684 | 89 | dnstrm_HI1420 probable addiction module antidote p | 96.57 | |
| PRK13890 | 120 | conjugal transfer protein TrbA; Provisional | 96.55 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 96.53 | |
| KOG3995 | 279 | consensus 3-hydroxyanthranilate oxygenase HAAO [Am | 96.49 | |
| TIGR00270 | 154 | conserved hypothetical protein TIGR00270. | 96.36 | |
| PF01381 | 55 | HTH_3: Helix-turn-helix; InterPro: IPR001387 This | 96.32 | |
| PRK08359 | 176 | transcription factor; Validated | 96.31 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 96.26 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 96.25 | |
| PRK06424 | 144 | transcription factor; Provisional | 96.15 | |
| TIGR02612 | 150 | mob_myst_A mobile mystery protein A. Members of th | 96.13 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 96.06 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 96.03 | |
| PF13560 | 64 | HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ | 95.99 | |
| PF05118 | 163 | Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl | 95.94 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 95.9 | |
| PRK09726 | 88 | antitoxin HipB; Provisional | 95.81 | |
| PF02678 | 107 | Pirin: Pirin; InterPro: IPR003829 This entry repre | 95.55 | |
| PF12852 | 186 | Cupin_6: Cupin | 95.46 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 95.41 | |
| PF12852 | 186 | Cupin_6: Cupin | 95.38 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 95.32 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 95.31 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 95.15 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 95.13 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 95.07 | |
| PRK09706 | 135 | transcriptional repressor DicA; Reviewed | 95.01 | |
| COG1482 | 312 | ManA Phosphomannose isomerase [Carbohydrate transp | 94.99 | |
| PF04962 | 261 | KduI: KduI/IolB family; InterPro: IPR021120 The Kd | 94.9 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 94.85 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 94.69 | |
| PRK10579 | 94 | hypothetical protein; Provisional | 94.29 | |
| COG3717 | 278 | KduI 5-keto 4-deoxyuronate isomerase [Carbohydrate | 94.28 | |
| PLN02288 | 394 | mannose-6-phosphate isomerase | 94.27 | |
| PF06865 | 94 | DUF1255: Protein of unknown function (DUF1255); In | 94.16 | |
| smart00530 | 56 | HTH_XRE Helix-turn-helix XRE-family like proteins. | 93.99 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 93.96 | |
| TIGR02607 | 78 | antidote_HigA addiction module antidote protein, H | 93.96 | |
| PF05118 | 163 | Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxyl | 93.06 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 92.98 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 92.72 | |
| COG1476 | 68 | Predicted transcriptional regulators [Transcriptio | 92.52 | |
| PF14525 | 172 | AraC_binding_2: AraC-binding-like domain | 92.36 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 92.3 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 92.3 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 92.3 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 92.2 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 92.15 | |
| COG1741 | 276 | Pirin-related protein [General function prediction | 92.09 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 92.07 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 91.31 | |
| PF14525 | 172 | AraC_binding_2: AraC-binding-like domain | 91.06 | |
| PRK10072 | 96 | putative transcriptional regulator; Provisional | 90.48 | |
| PRK11396 | 191 | hypothetical protein; Provisional | 90.38 | |
| PF06865 | 94 | DUF1255: Protein of unknown function (DUF1255); In | 89.47 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 88.98 | |
| PRK00924 | 276 | 5-keto-4-deoxyuronate isomerase; Provisional | 88.98 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 88.91 | |
| COG3508 | 427 | HmgA Homogentisate 1,2-dioxygenase [Secondary meta | 88.74 | |
| PRK04140 | 317 | hypothetical protein; Provisional | 88.73 | |
| PF07847 | 200 | DUF1637: Protein of unknown function (DUF1637); In | 87.77 | |
| COG5553 | 191 | Predicted metal-dependent enzyme of the double-str | 87.69 | |
| cd00093 | 58 | HTH_XRE Helix-turn-helix XRE-family like proteins. | 87.56 | |
| PF13443 | 63 | HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3 | 87.53 | |
| PF11142 | 63 | DUF2917: Protein of unknown function (DUF2917); In | 87.13 | |
| PRK10579 | 94 | hypothetical protein; Provisional | 87.01 | |
| PRK02866 | 147 | cyanate hydratase; Validated | 86.83 | |
| TIGR03830 | 127 | CxxCG_CxxCG_HTH putative zinc finger/helix-turn-he | 86.64 | |
| PF13744 | 80 | HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_ | 86.61 | |
| COG3123 | 94 | Uncharacterized protein conserved in bacteria [Fun | 86.24 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 86.19 | |
| TIGR00673 | 150 | cynS cyanate hydratase. Alternate names include cy | 86.17 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 85.63 | |
| PF05962 | 184 | HutD: HutD; InterPro: IPR010282 This entry contain | 85.51 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 85.08 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 84.74 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 83.89 | |
| cd01392 | 52 | HTH_LacI Helix-turn-helix (HTH) DNA binding domain | 82.21 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 80.92 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 80.8 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 80.67 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 80.55 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 80.55 |
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.4e-68 Score=487.97 Aligned_cols=243 Identities=35% Similarity=0.618 Sum_probs=230.2
Q ss_pred hcccCCcceeeeeeeeEeCCCCeeeccCCCCCcceEEEEecCCCC--CcEEEEEEEEcCCCcCCCC-CCCc-eEEEEEEE
Q 022278 57 QDLPGFTRSVYKRDHALITPESHVLSPLPEWTNTLGAYLITPAMG--SHFVMYLANMQENARSALP-PHDV-ERFIFVVQ 132 (300)
Q Consensus 57 ~~~lg~trs~f~~~~av~~~e~~~~~~~p~~~~~~~~~L~sp~~g--~~f~~~lv~l~PG~~~~~~-~h~g-EEf~yVLe 132 (300)
++.|.+|||+++++|||++|++.+.+.+|+|++++.++|++|..| ++|++++++++||+.+..+ .|.+ |||+||++
T Consensus 9 ~~~~~~~r~~~~~~~a~i~p~~~~~~~vp~~~~~~~~~l~~P~~g~~~~f~~~~v~l~pgg~~~~~~~~~g~ee~iyVl~ 88 (260)
T TIGR03214 9 QKQLLTTRAVVHGNYAVITPDGLVSNIVPGFENTDIWILSRPKLGFAATFVQYIVEVHPGGGNTTGFGGEGIETFLFVIS 88 (260)
T ss_pred hhhcccceEEEEcceEEECCcceecccCCCCcccEEEEEcCCCCCCCCcEEEEEEEECCCCcCCCCCCCCceEEEEEEEe
Confidence 567889999999999999999999999999999999999999999 8999999999999877544 4555 99999999
Q ss_pred CEEEEEEcCCcEEEeccCcEEEeCCCCceEEee--CCeEEEEEEEeeccccCC-CCcceeeccCCCCCCcccCC-ceeEE
Q 022278 133 GSAMLTNASGVSSKLMVDSYTYLPPNFAHSLRA--EGSATLVVFERRYASLEN-HITEQIVGSTDKQPLLETPG-EVFQL 208 (300)
Q Consensus 133 G~v~l~v~gg~~~~L~~Gds~yfpa~~~H~~~N--~~~a~vl~v~~~y~~~~g-~~p~~~~~~~~d~~~~~~~g-~~~~~ 208 (300)
|++++++ +|+++.|++||++|||++.+|+++| +++|+++||.|+|+|++| .+|.++++|++|++..+++| +++.+
T Consensus 89 G~l~v~~-~g~~~~L~~Gd~~y~pa~~~H~~~N~~~~~a~~l~v~k~y~~~~g~~~~~~vvg~~~dv~~~~~~g~~~~~~ 167 (260)
T TIGR03214 89 GEVNVTA-EGETHELREGGYAYLPPGSKWTLANAQAEDARFFLYKKRYQPVEGLHAPELVVGNEKDIEPEPYEGMDDVIL 167 (260)
T ss_pred CEEEEEE-CCEEEEECCCCEEEECCCCCEEEEECCCCCEEEEEEEeeeEEcCCCCCCCeeecCHHHCCccccCCCCcEEE
Confidence 9999999 9999999999999999999999999 679999999999999999 88999999999999999987 77788
Q ss_pred EEeeCCCCCcceEEEEEEecCCcccCcceeeccceEEEEEEeeEEEEeCCEEEEccCCcEEEeCCCCceeEEecCCccEE
Q 022278 209 RKLLPQAVPFDFNIHIMDFQPGDFLNVKEVHYNQHGLLLLEGQGIYRLGDSWYPVQAGDVLWMAPFVPQWYAALGKTRTR 288 (300)
Q Consensus 209 ~~l~p~~~~~~~~~~~~tl~PG~~~p~~~~H~~eh~~~iL~G~G~~~~~g~~~~v~~GD~i~~~~~~~H~~~n~G~e~~~ 288 (300)
+.|+|++.+++|+|++++|+||+++|+||||+|||++|||+|+|+|++||+|++|++||+|||+|||+||++|+|+++++
T Consensus 168 ~~llp~~~~~~~~~~~~~~~PG~~~~~~~~H~~eh~~yiL~G~G~~~~~g~~~~V~~GD~i~i~~~~~h~~~~~G~~~~~ 247 (260)
T TIGR03214 168 TTLLPKELAFDMNVHILSFEPGASHPYIETHVMEHGLYVLEGKGVYNLDNNWVPVEAGDYIWMGAYCPQACYAGGRGEFR 247 (260)
T ss_pred EEeCchhcCCCcEEEEEEECCCcccCCcccccceeEEEEEeceEEEEECCEEEEecCCCEEEECCCCCEEEEecCCCcEE
Confidence 88778788889999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEeecCCCCC
Q 022278 289 YLLYKDVNRNPL 300 (300)
Q Consensus 289 fi~~kd~nr~~~ 300 (300)
||+||||||||.
T Consensus 248 ~l~ykd~nr~~~ 259 (260)
T TIGR03214 248 YLLYKDMNRHVK 259 (260)
T ss_pred EEEEccccCCCC
Confidence 999999999984
|
This model represents a protein containing a tandem arrangement of cupin domains (N-terminal part of pfam07883 and C-terminal more distantly related to pfam00190). This protein is found in the vicinity of genes involved in the catabolism of allantoin, a breakdown product of urate and sometimes of urate iteslf. The distribution of pathway components in the genomes in which this family is observed suggests that the function is linked to the allantoate catabolism to glyoxylate pathway (GenProp0686) since it is sometimes found in genomes lacking any elements of the xanthine-to-allantoin pathways (e.g. in Enterococcus faecalis). |
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PRK00924 5-keto-4-deoxyuronate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >COG3718 IolB Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >COG1741 Pirin-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >PF05962 HutD: HutD; InterPro: IPR010282 This entry contains proteins of unknown function, which include HutD from Pseudomonas fluorescens and Ves from Escherichia coli K12 | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PHA01976 helix-turn-helix protein | Back alignment and domain information |
|---|
| >TIGR03070 couple_hipB transcriptional regulator, y4mF family | Back alignment and domain information |
|---|
| >PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B | Back alignment and domain information |
|---|
| >TIGR02684 dnstrm_HI1420 probable addiction module antidote protein | Back alignment and domain information |
|---|
| >PRK13890 conjugal transfer protein TrbA; Provisional | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG3995 consensus 3-hydroxyanthranilate oxygenase HAAO [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00270 conserved hypothetical protein TIGR00270 | Back alignment and domain information |
|---|
| >PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) | Back alignment and domain information |
|---|
| >PRK08359 transcription factor; Validated | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PRK06424 transcription factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02612 mob_myst_A mobile mystery protein A | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A | Back alignment and domain information |
|---|
| >PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PRK09726 antitoxin HipB; Provisional | Back alignment and domain information |
|---|
| >PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >PRK09706 transcriptional repressor DicA; Reviewed | Back alignment and domain information |
|---|
| >COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK10579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3717 KduI 5-keto 4-deoxyuronate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02288 mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length | Back alignment and domain information |
|---|
| >smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >TIGR02607 antidote_HigA addiction module antidote protein, HigA family | Back alignment and domain information |
|---|
| >PF05118 Asp_Arg_Hydrox: Aspartyl/Asparaginyl beta-hydroxylase; InterPro: IPR007803 The alpha-ketoglutarate-dependent dioxygenase aspartyl (asparaginyl) beta-hydroxylase (1 | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >COG1476 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF14525 AraC_binding_2: AraC-binding-like domain | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >COG1741 Pirin-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF14525 AraC_binding_2: AraC-binding-like domain | Back alignment and domain information |
|---|
| >PRK10072 putative transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11396 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06865 DUF1255: Protein of unknown function (DUF1255); InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >PRK00924 5-keto-4-deoxyuronate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK04140 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07847 DUF1637: Protein of unknown function (DUF1637); InterPro: IPR012864 This entry represents cysteamine dioxygenase, which is a non-heme iron protein that is involved in the biosynthesis of taurine | Back alignment and domain information |
|---|
| >COG5553 Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd00093 HTH_XRE Helix-turn-helix XRE-family like proteins | Back alignment and domain information |
|---|
| >PF13443 HTH_26: Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A | Back alignment and domain information |
|---|
| >PF11142 DUF2917: Protein of unknown function (DUF2917); InterPro: IPR021317 This bacterial family of proteins appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >PRK10579 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02866 cyanate hydratase; Validated | Back alignment and domain information |
|---|
| >TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family | Back alignment and domain information |
|---|
| >PF13744 HTH_37: Helix-turn-helix domain; PDB: 2A6C_B 2O38_A | Back alignment and domain information |
|---|
| >COG3123 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00673 cynS cyanate hydratase | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PF05962 HutD: HutD; InterPro: IPR010282 This entry contains proteins of unknown function, which include HutD from Pseudomonas fluorescens and Ves from Escherichia coli K12 | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >cd01392 HTH_LacI Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 300 | ||||
| 4e2q_A | 266 | Crystal Structure Of (S)-Ureidoglycine Aminohydrola | 1e-128 | ||
| 1sfn_A | 246 | Crystal Structure Of Protein Dr1152 From Deinococcu | 6e-43 | ||
| 1sef_A | 274 | Crystal Structure Of Cupin Domain Protein Ef2996 Fr | 4e-29 | ||
| 1rc6_A | 261 | Crystal Structure Of Protein Ylba From E. Coli, Pfa | 2e-24 | ||
| 1sq4_A | 278 | Crystal Structure Of The Putative Glyoxylate Induce | 1e-23 |
| >pdb|4E2Q|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From Arabidopsis Thaliana Length = 266 | Back alignment and structure |
|
| >pdb|1SFN|A Chain A, Crystal Structure Of Protein Dr1152 From Deinococcus Radiodurans R1, Pfam Duf861 Length = 246 | Back alignment and structure |
| >pdb|1SEF|A Chain A, Crystal Structure Of Cupin Domain Protein Ef2996 From Enterococcus Faecalis Length = 274 | Back alignment and structure |
| >pdb|1RC6|A Chain A, Crystal Structure Of Protein Ylba From E. Coli, Pfam Duf861 Length = 261 | Back alignment and structure |
| >pdb|1SQ4|A Chain A, Crystal Structure Of The Putative Glyoxylate Induced Protein From Pseudomonas Aeruginosa, Northeast Structural Genomics Target Par14 Length = 278 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 300 | |||
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 1e-113 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 7e-89 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 1e-83 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 5e-83 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 2e-74 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 7e-04 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 7e-12 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 3e-11 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 5e-09 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 9e-08 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 2e-06 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 5e-07 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 1e-06 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 2e-05 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 4e-06 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 5e-06 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 9e-06 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 3e-05 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 7e-05 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 3e-04 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 4e-04 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 8e-04 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 8e-04 |
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Length = 266 | Back alignment and structure |
|---|
Score = 326 bits (836), Expect = e-113
Identities = 215/263 (81%), Positives = 231/263 (87%)
Query: 38 SSKPMYWKVTNPTLSPSHLQDLPGFTRSVYKRDHALITPESHVLSPLPEWTNTLGAYLIT 97
+ P+YWK TNPTLSPSHLQDLPGFTRSVYKRDHALITPESHV SPLP+WTNTLGAYLIT
Sbjct: 4 KTNPIYWKATNPTLSPSHLQDLPGFTRSVYKRDHALITPESHVYSPLPDWTNTLGAYLIT 63
Query: 98 PAMGSHFVMYLANMQENARSALPPHDVERFIFVVQGSAMLTNASGVSSKLMVDSYTYLPP 157
PA GSHFVMYLA M+E + S LPP D+ER IFVV+G+ LTN S S KL VDSY YLPP
Sbjct: 64 PATGSHFVMYLAKMKEMSSSGLPPQDIERLIFVVEGAVTLTNTSSSSKKLTVDSYAYLPP 123
Query: 158 NFAHSLRAEGSATLVVFERRYASLENHITEQIVGSTDKQPLLETPGEVFQLRKLLPQAVP 217
NF HSL SATLVVFERRY L +H TE IVGSTDKQPLLETPGEVF+LRKLLP +V
Sbjct: 124 NFHHSLDCVESATLVVFERRYEYLGSHTTELIVGSTDKQPLLETPGEVFELRKLLPMSVA 183
Query: 218 FDFNIHIMDFQPGDFLNVKEVHYNQHGLLLLEGQGIYRLGDSWYPVQAGDVLWMAPFVPQ 277
+DFNIH MDFQPG+FLNVKEVHYNQHGLLLLEGQGIYRLGD+WYPVQAGDV+WMAPFVPQ
Sbjct: 184 YDFNIHTMDFQPGEFLNVKEVHYNQHGLLLLEGQGIYRLGDNWYPVQAGDVIWMAPFVPQ 243
Query: 278 WYAALGKTRTRYLLYKDVNRNPL 300
WYAALGKTR+RYLLYKDVNRNPL
Sbjct: 244 WYAALGKTRSRYLLYKDVNRNPL 266
|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Length = 246 | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Length = 261 | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Length = 274 | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Length = 278 | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Length = 278 | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Length = 166 | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Length = 156 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Length = 227 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Length = 126 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Length = 125 | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Length = 167 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Length = 145 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Length = 105 | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Length = 192 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Length = 113 | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Length = 162 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Length = 243 | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Length = 163 | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Length = 125 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 100.0 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 100.0 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 100.0 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 100.0 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 100.0 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 99.96 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.95 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 99.95 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 99.92 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 99.92 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 99.9 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 99.89 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 99.89 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.89 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 99.85 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 99.81 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 99.74 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 99.73 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 99.71 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 99.7 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 99.7 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 99.7 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 99.69 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 99.68 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 99.68 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 99.68 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 99.67 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 99.66 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 99.64 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 99.63 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 99.62 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 99.6 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 99.6 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 99.57 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 99.56 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 99.53 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 99.53 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 99.52 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 99.51 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 99.51 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 99.51 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 99.5 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 99.5 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 99.49 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 99.49 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 99.49 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 99.48 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 99.48 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 99.48 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 99.48 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 99.48 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 99.47 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 99.47 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 99.46 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 99.46 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 99.46 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 99.46 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 99.46 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 99.46 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 99.45 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 99.45 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 99.45 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 99.45 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 99.45 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 99.44 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 99.44 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 99.43 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 99.43 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 99.43 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 99.43 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 99.43 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 99.42 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 99.42 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 99.42 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.42 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 99.42 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 99.42 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 99.42 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 99.41 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 99.4 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 99.4 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 99.4 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 99.4 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 99.39 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 99.38 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 99.38 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 99.38 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 99.37 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 99.36 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 99.36 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 99.36 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 99.35 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 99.35 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 99.35 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 99.34 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 99.34 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 99.34 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 99.33 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 99.33 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 99.33 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 99.32 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.31 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.31 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 99.31 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 99.3 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 99.28 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 99.28 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 99.27 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 99.25 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 99.25 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 99.24 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 99.24 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 99.22 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 99.22 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 99.21 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 99.21 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 99.21 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.21 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.18 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 99.17 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 99.17 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 99.17 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 99.17 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 99.17 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 99.16 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 99.16 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 99.15 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 99.15 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 99.14 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 99.13 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 99.12 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 99.12 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 99.12 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 99.08 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.07 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 99.07 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 99.06 | |
| 2qdr_A | 303 | Uncharacterized protein; double-stranded beta-heli | 99.04 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 99.04 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 99.03 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 99.02 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 98.98 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 98.97 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.96 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 98.94 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.93 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.93 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 98.91 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 98.81 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 98.77 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 98.76 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 98.76 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 98.73 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.72 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 98.72 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 98.71 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.62 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.59 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 98.53 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 98.52 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 98.51 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 98.42 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 98.41 | |
| 1xru_A | 282 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; | 98.39 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 98.38 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 98.37 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 98.37 | |
| 1ywk_A | 289 | 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer | 98.36 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 98.35 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.35 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 98.31 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 98.31 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 98.31 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 98.26 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 98.26 | |
| 1j1l_A | 290 | Pirin; beta sandwich, cupin, iron, metatl binding | 98.23 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 98.17 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 98.14 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 98.14 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 98.13 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 98.05 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 97.95 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 97.95 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 97.89 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 97.87 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 97.85 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 97.85 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 97.84 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 97.81 | |
| 3g7d_A | 443 | PHPD; non heme Fe(II) dioxygenase, cupin, biosynth | 97.72 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 97.71 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 97.7 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 97.7 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 97.6 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 97.54 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 97.47 | |
| 3qwg_A | 123 | ESX-1 secretion-associated regulator ESPR; N-termi | 97.35 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 97.31 | |
| 3r1f_A | 135 | ESX-1 secretion-associated regulator ESPR; helix-t | 97.2 | |
| 4ghj_A | 101 | Probable transcriptional regulator; structural gen | 97.19 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 97.1 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 97.09 | |
| 3omt_A | 73 | Uncharacterized protein; structural genomics, PSI- | 97.03 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 96.99 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 96.98 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 96.98 | |
| 2ewt_A | 71 | BLDD, putative DNA-binding protein; the DNA-bindin | 96.97 | |
| 2k9q_A | 77 | Uncharacterized protein; all helix, helix-turn-hel | 96.91 | |
| 3s8q_A | 82 | R-M controller protein; protein-DNA complex, helix | 96.91 | |
| 3qq6_A | 78 | HTH-type transcriptional regulator SINR; helix-tur | 96.85 | |
| 2ofy_A | 86 | Putative XRE-family transcriptional regulator; tra | 96.84 | |
| 1y7y_A | 74 | C.AHDI; helix-turn-helix, DNA-binding protein, tra | 96.81 | |
| 3kz3_A | 80 | Repressor protein CI; five helix bundle, DNA-bindi | 96.81 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 96.81 | |
| 3g5g_A | 99 | Regulatory protein; transcriptional regulator, hel | 96.78 | |
| 3t76_A | 88 | VANU, transcriptional regulator vanug; structural | 96.76 | |
| 1neq_A | 74 | DNA-binding protein NER; NMR {Enterobacteria phage | 96.71 | |
| 3f6w_A | 83 | XRE-family like protein; helix-turn-helix, DNA bin | 96.65 | |
| 2wus_R | 112 | RODZ, putative uncharacterized protein; structural | 96.64 | |
| 3vk0_A | 114 | NHTF, transcriptional regulator; HTH motif, XRE tr | 96.63 | |
| 2xi8_A | 66 | Putative transcription regulator; HTH DNA-binding | 96.63 | |
| 3eus_A | 86 | DNA-binding protein; structural genomics, PSI2,MCS | 96.62 | |
| 3b7h_A | 78 | Prophage LP1 protein 11; structural genomics, PSI2 | 96.56 | |
| 2r1j_L | 68 | Repressor protein C2; protein-DNA complex, helix-t | 96.54 | |
| 1lmb_3 | 92 | Protein (lambda repressor); protein-DNA complex, d | 96.52 | |
| 2b5a_A | 77 | C.BCLI; helix-turn-helix motif, gene regulation; 1 | 96.51 | |
| 1adr_A | 76 | P22 C2 repressor; transcription regulation; NMR {E | 96.5 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 96.48 | |
| 3mlf_A | 111 | Transcriptional regulator; structural genomics, he | 96.47 | |
| 3f52_A | 117 | CLP gene regulator (CLGR); helix-turn-helix motif, | 96.47 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 96.41 | |
| 4ich_A | 311 | Transcriptional regulator; structural genomics, PS | 96.41 | |
| 3fym_A | 130 | Putative uncharacterized protein; HTH DNA binding, | 96.4 | |
| 3lfp_A | 98 | CSP231I C protein; transcriptional regulator, DNA | 96.4 | |
| 3ivp_A | 126 | Putative transposon-related DNA-binding protein; A | 96.37 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 96.35 | |
| 1j1l_A | 290 | Pirin; beta sandwich, cupin, iron, metatl binding | 96.33 | |
| 2o38_A | 120 | Hypothetical protein; alpha-beta, helix-turn-helix | 96.33 | |
| 2a6c_A | 83 | Helix-turn-helix motif; putative transcriptional r | 96.31 | |
| 3bs3_A | 76 | Putative DNA-binding protein; XRE-family, structur | 96.31 | |
| 3trb_A | 104 | Virulence-associated protein I; mobIle and extrach | 96.25 | |
| 2kpj_A | 94 | SOS-response transcriptional repressor, LEXA; NESG | 96.24 | |
| 1x57_A | 91 | Endothelial differentiation-related factor 1; HMBF | 96.23 | |
| 2wiu_B | 88 | HTH-type transcriptional regulator HIPB; transfera | 96.2 | |
| 3op9_A | 114 | PLI0006 protein; structural genomics, PSI-2, prote | 96.19 | |
| 1zug_A | 71 | Phage 434 CRO protein; gene regulating protein, tr | 96.04 | |
| 1r69_A | 69 | Repressor protein CI; gene regulating protein; 2.0 | 96.02 | |
| 3kxa_A | 141 | NGO0477 protein, putative uncharacterized protein; | 95.96 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 95.96 | |
| 2l49_A | 99 | C protein; P2 bacteriophage, P2 C, direct repeats, | 95.93 | |
| 2p5t_A | 158 | Putative transcriptional regulator PEZA; postsegre | 95.92 | |
| 3fmy_A | 73 | HTH-type transcriptional regulator MQSA (YGIT/B302 | 95.9 | |
| 1b0n_A | 111 | Protein (SINR protein); transcription regulator, a | 95.68 | |
| 3cec_A | 104 | Putative antidote protein of plasmid maintenance; | 95.65 | |
| 3rcq_A | 197 | Aspartyl/asparaginyl beta-hydroxylase; structural | 95.63 | |
| 2eby_A | 113 | Putative HTH-type transcriptional regulator YBAQ; | 95.46 | |
| 2ef8_A | 84 | C.ECOT38IS, putative transcription factor; helix-t | 95.43 | |
| 3pxp_A | 292 | Helix-turn-helix domain protein; DNA-binding, basi | 95.43 | |
| 1nr3_A | 122 | MTH0916, DNA-binding protein TFX; northeast struct | 95.42 | |
| 1yll_A | 200 | PA5104, conserved hypothetical protein; structural | 95.31 | |
| 2jvl_A | 107 | TRMBF1; coactivator, helix-turn-helix, Pro binding | 95.31 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 95.3 | |
| 2oyz_A | 94 | UPF0345 protein VPA0057; unknown function, structu | 95.29 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 95.29 | |
| 3bd1_A | 79 | CRO protein; transcription factor, helix-turn-heli | 95.21 | |
| 2ict_A | 94 | Antitoxin HIGA; helix-turn-helix, structural genom | 94.95 | |
| 2awi_A | 317 | PRGX; repressor, pheromone, DNA binding, regulator | 94.91 | |
| 2ppx_A | 99 | AGR_C_3184P, uncharacterized protein ATU1735; HTH- | 94.77 | |
| 2l1p_A | 83 | DNA-binding protein SATB1; PSI-biology, NESG, stru | 94.75 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 94.57 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 94.54 | |
| 3hqx_A | 111 | UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC | 94.37 | |
| 3esg_A | 193 | HUTD, putative uncharacterized protein; beta barre | 94.21 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 94.03 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 94.02 | |
| 1e5r_A | 290 | Proline oxidase; oxidoreductase, oxygenase, 2-oxog | 93.97 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 93.71 | |
| 3eo6_A | 106 | Protein of unknown function (DUF1255); AFE_2634, s | 93.62 | |
| 3bdn_A | 236 | Lambda repressor; repressor, allostery; HET: DNA; | 93.57 | |
| 3rcq_A | 197 | Aspartyl/asparaginyl beta-hydroxylase; structural | 93.56 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 93.45 | |
| 3of1_A | 246 | CAMP-dependent protein kinase regulatory subunit; | 93.42 | |
| 3o9x_A | 133 | Uncharacterized HTH-type transcriptional regulato; | 92.96 | |
| 1e5r_A | 290 | Proline oxidase; oxidoreductase, oxygenase, 2-oxog | 92.64 | |
| 2qdr_A | 303 | Uncharacterized protein; double-stranded beta-heli | 92.11 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 92.01 | |
| 2oyz_A | 94 | UPF0345 protein VPA0057; unknown function, structu | 91.98 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 91.73 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 91.68 | |
| 2fjr_A | 189 | Repressor protein CI; genetic switch, regulation, | 91.67 | |
| 2wfp_A | 394 | Mannose-6-phosphate isomerase; APO-structure, meta | 91.52 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 91.39 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 91.35 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 91.21 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 90.93 | |
| 3eo6_A | 106 | Protein of unknown function (DUF1255); AFE_2634, s | 90.55 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 90.03 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 89.97 | |
| 1dw9_A | 156 | Cyanate lyase; cyanate degradation, structural gen | 89.74 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 89.65 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 89.51 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 89.12 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 89.11 | |
| 3bpz_A | 202 | Potassium/sodium hyperpolarization-activated cycli | 89.08 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 88.98 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 88.91 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 88.82 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 88.77 | |
| 3hqx_A | 111 | UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MC | 88.69 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 88.0 | |
| 1yll_A | 200 | PA5104, conserved hypothetical protein; structural | 87.94 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 87.9 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 87.9 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 87.76 | |
| 3tnp_B | 416 | CAMP-dependent protein kinase type II-beta regula | 87.69 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 87.66 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 87.14 | |
| 2ypd_A | 392 | Probable JMJC domain-containing histone demethyla | 86.32 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 86.11 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 85.44 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 85.24 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 85.17 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 84.97 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 84.77 | |
| 1ywk_A | 289 | 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomer | 84.29 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 84.01 | |
| 3dl3_A | 119 | Tellurite resistance protein B; X-RAY NESG VFR98 Q | 83.52 | |
| 1rzs_A | 61 | Antirepressor, regulatory protein CRO; helix-turn- | 83.32 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 83.27 | |
| 2d93_A | 134 | RAP guanine nucleotide exchange factor 6; CNMP_bin | 82.81 | |
| 3ocp_A | 139 | PRKG1 protein; serine/threonine kinase, TF2I and I | 82.35 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 82.32 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 82.23 | |
| 4f8a_A | 160 | Potassium voltage-gated channel subfamily H membe; | 81.92 | |
| 3g7d_A | 443 | PHPD; non heme Fe(II) dioxygenase, cupin, biosynth | 81.86 | |
| 3pna_A | 154 | CAMP-dependent protein kinase type I-alpha regula | 81.63 | |
| 2qcs_B | 291 | CAMP-dependent protein kinase type I-alpha regula | 81.08 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 80.54 | |
| 2pij_A | 67 | Prophage PFL 6 CRO; transcription factor, helix-tu | 80.04 |
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-81 Score=575.51 Aligned_cols=262 Identities=82% Similarity=1.352 Sum_probs=253.4
Q ss_pred CCCcceeeecCCCCChhhhhcccCCcceeeeeeeeEeCCCCeeeccCCCCCcceEEEEecCCCCCcEEEEEEEEcCCCcC
Q 022278 38 SSKPMYWKVTNPTLSPSHLQDLPGFTRSVYKRDHALITPESHVLSPLPEWTNTLGAYLITPAMGSHFVMYLANMQENARS 117 (300)
Q Consensus 38 lsk~~~Sqver~~~sps~I~~~lg~trs~f~~~~av~~~e~~~~~~~p~~~~~~~~~L~sp~~g~~f~~~lv~l~PG~~~ 117 (300)
.|++.+|++.|++.|||+++++||.|||+|+++||||++++++.+.+|+|++++.++|++|..|++|++++++++||+++
T Consensus 4 ~~~~~~~~~~~~~~~~~~~~~~~g~~r~~~~~~~avI~~~~iv~s~lPg~~~~~~~vL~sP~~G~~f~~~lv~l~PGg~s 83 (266)
T 4e2q_A 4 KTNPIYWKATNPTLSPSHLQDLPGFTRSVYKRDHALITPESHVYSPLPDWTNTLGAYLITPATGSHFVMYLAKMKEMSSS 83 (266)
T ss_dssp ---CTTGGGTSCSSCGGGGTTSTTCCCCEECSSEEEECGGGCCCEECTTSSSEEEEEEECGGGTCSSEEEEEEECSSEEC
T ss_pred ccCccchhccCcccChhhhhcccCcccEEEEcCeEEECccceEEeeCCCCcCEEEEEEcCCCCCCcEEEEEEEECcCCcC
Confidence 36889999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred CCCCCCceEEEEEEECEEEEEEcC-CcEEEeccCcEEEeCCCCceEEeeCCeEEEEEEEeeccccCCCCcceeeccCCCC
Q 022278 118 ALPPHDVERFIFVVQGSAMLTNAS-GVSSKLMVDSYTYLPPNFAHSLRAEGSATLVVFERRYASLENHITEQIVGSTDKQ 196 (300)
Q Consensus 118 ~~~~h~gEEf~yVLeG~v~l~v~g-g~~~~L~~Gds~yfpa~~~H~~~N~~~a~vl~v~~~y~~~~g~~p~~~~~~~~d~ 196 (300)
+.+.|++|||+|||+|++++++ + |++++|++||++|||++.+|+++|+++|+++||.++|+|++|.+|+++++|++|+
T Consensus 84 ~~~~h~~EEfiyVleG~l~l~l-~~g~~~~L~~Gds~y~p~~~~H~~~N~~~Ar~l~V~k~y~~~~g~~p~~~v~~~~dv 162 (266)
T 4e2q_A 84 GLPPQDIERLIFVVEGAVTLTN-TSSSSKKLTVDSYAYLPPNFHHSLDCVESATLVVFERRYEYLGSHTTELIVGSTDKQ 162 (266)
T ss_dssp CCCCTTEEEEEEEEEECEEEEC---CCCEEECTTEEEEECTTCCCEEEESSCEEEEEEEEECCCCTTCCCCCEEEEGGGS
T ss_pred CCCCCCCeEEEEEEEEEEEEEE-CCCcEEEEcCCCEEEECCCCCEEEEeCCCEEEEEEEeEeeeCCCCCCceeeCcHhHC
Confidence 7788999999999999999999 8 9999999999999999999999999999999999999999999999999999999
Q ss_pred CCcccCCceeEEEEeeCCCCCcceEEEEEEecCCcccCcceeeccceEEEEEEeeEEEEeCCEEEEccCCcEEEeCCCCc
Q 022278 197 PLLETPGEVFQLRKLLPQAVPFDFNIHIMDFQPGDFLNVKEVHYNQHGLLLLEGQGIYRLGDSWYPVQAGDVLWMAPFVP 276 (300)
Q Consensus 197 ~~~~~~g~~~~~~~l~p~~~~~~~~~~~~tl~PG~~~p~~~~H~~eh~~~iL~G~G~~~~~g~~~~v~~GD~i~~~~~~~ 276 (300)
|+++++|+++++|+|+|++++++|+||+|||+||+++|+||||+|||++|||+|+|+|++||+|++|++||+|||+|||+
T Consensus 163 ~~~~~~g~~~~~r~l~p~~~~~d~~~~~~t~~PG~~~p~~e~H~~eh~~~vL~G~g~y~l~~~~~~V~~GD~i~~~~~~~ 242 (266)
T 4e2q_A 163 PLLETPGEVFELRKLLPMSVAYDFNIHTMDFQPGEFLNVKEVHYNQHGLLLLEGQGIYRLGDNWYPVQAGDVIWMAPFVP 242 (266)
T ss_dssp CCBCCTTCCSEEEESSCCSTTCSEEEEEEEECTTCBCSSCCCCSCCEEEEEEECEEEEEETTEEEEEETTCEEEECTTCC
T ss_pred CCcccCCCcEEEEEccCcccccceEEEEEEECCCcCcCCceEcccceEEEEEeceEEEEECCEEEEecCCCEEEECCCCc
Confidence 99999987778999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeEEecCCccEEEEEEeecCCCCC
Q 022278 277 QWYAALGKTRTRYLLYKDVNRNPL 300 (300)
Q Consensus 277 H~~~n~G~e~~~fi~~kd~nr~~~ 300 (300)
|||+|+|++|++||+|||||||||
T Consensus 243 h~~~n~G~e~~~yl~ykd~nr~~~ 266 (266)
T 4e2q_A 243 QWYAALGKTRSRYLLYKDVNRNPL 266 (266)
T ss_dssp EEEEEESSSCEEEEEEEECSSCCC
T ss_pred EEEEeCCCCCEEEEEEccccCCCC
Confidence 999999999999999999999997
|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A 3rzz_A | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >3qwg_A ESX-1 secretion-associated regulator ESPR; N-terminal helix-turn-helix motif, transcription factor, transcription; 1.99A {Mycobacterium tuberculosis} PDB: 3qf3_A 3qyx_A | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3r1f_A ESX-1 secretion-associated regulator ESPR; helix-turn-helix, transcription factor, helix-turn-helix transcription factor; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4ghj_A Probable transcriptional regulator; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE; 1.75A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* | Back alignment and structure |
|---|
| >3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ofy_A Putative XRE-family transcriptional regulator; transcription regulator, structural genomics, PS protein structure initiative; 1.70A {Rhodococcus SP} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3g5g_A Regulatory protein; transcriptional regulator, helix-turn-helix, restriction- modification, transcription regulator; 2.80A {Enterobacter SP} PDB: 3fya_A | Back alignment and structure |
|---|
| >1neq_A DNA-binding protein NER; NMR {Enterobacteria phage MU} SCOP: a.35.1.2 PDB: 1ner_A | Back alignment and structure |
|---|
| >3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2wus_R RODZ, putative uncharacterized protein; structural protein, cell WALL morphogenesis, bacterial cytos bacterial actin; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3vk0_A NHTF, transcriptional regulator; HTH motif, XRE transcription factor, DNA binding protein; 1.88A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A | Back alignment and structure |
|---|
| >3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L | Back alignment and structure |
|---|
| >1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* | Back alignment and structure |
|---|
| >2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3f52_A CLP gene regulator (CLGR); helix-turn-helix motif, transcriptional ACTI human pathogen, transcription activator; 1.75A {Corynebacterium glutamicum} PDB: 3f51_A | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >4ich_A Transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, transcription RE; 1.95A {Saccharomonospora viridis} | Back alignment and structure |
|---|
| >3fym_A Putative uncharacterized protein; HTH DNA binding, DNA binding protein; 1.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3lfp_A CSP231I C protein; transcriptional regulator, DNA binding protein, helix-turn-H restriction-modification, transcription; 2.00A {Citrobacter SP} PDB: 3lis_A | Back alignment and structure |
|---|
| >3ivp_A Putative transposon-related DNA-binding protein; APC62618, clostridium diffic structural genomics, PSI-2, protein structure initiative; HET: PG4; 2.02A {Clostridium difficile} | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* | Back alignment and structure |
|---|
| >2o38_A Hypothetical protein; alpha-beta, helix-turn-helix, structural genomics, PSI-2, PR structure initiative; 1.83A {Rhodopseudomonas palustris} SCOP: a.35.1.13 | Back alignment and structure |
|---|
| >2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 | Back alignment and structure |
|---|
| >3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 | Back alignment and structure |
|---|
| >2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* | Back alignment and structure |
|---|
| >3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} | Back alignment and structure |
|---|
| >1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* | Back alignment and structure |
|---|
| >1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A | Back alignment and structure |
|---|
| >3kxa_A NGO0477 protein, putative uncharacterized protein; NEW protein fold, OPPF, STRU genomics, oxford protein production facility; 2.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A | Back alignment and structure |
|---|
| >2p5t_A Putative transcriptional regulator PEZA; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A | Back alignment and structure |
|---|
| >3cec_A Putative antidote protein of plasmid maintenance; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2eby_A Putative HTH-type transcriptional regulator YBAQ; hypothetical protein, JW0472, structural genomics, NPPSFA; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} | Back alignment and structure |
|---|
| >3pxp_A Helix-turn-helix domain protein; DNA-binding, basic helix-loop-helix motif, BHLH motif, lambd repressor-like DNA-binding fold; HET: MSE MYR; 2.30A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1nr3_A MTH0916, DNA-binding protein TFX; northeast structural genomics consortium, reduced- dimensionality PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: d.236.1.1 | Back alignment and structure |
|---|
| >1yll_A PA5104, conserved hypothetical protein; structural genomics, beta-BA PSI, protein structure initiative, midwest center for struc genomics; 1.64A {Pseudomonas aeruginosa} SCOP: b.82.1.17 | Back alignment and structure |
|---|
| >2jvl_A TRMBF1; coactivator, helix-turn-helix, Pro binding, transcription; NMR {Trichoderma reesei} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A | Back alignment and structure |
|---|
| >2awi_A PRGX; repressor, pheromone, DNA binding, regulatory domain, transcription; 2.25A {Enterococcus faecalis} SCOP: a.35.1.11 a.118.8.4 PDB: 2axv_A 2axu_A 2aw6_A 2axz_A 2grl_A 2grm_A | Back alignment and structure |
|---|
| >2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 | Back alignment and structure |
|---|
| >2l1p_A DNA-binding protein SATB1; PSI-biology, NESG, structural genomics, protein structure in northeast structural genomics consortium; NMR {Homo sapiens} PDB: 3nzl_A* | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 | Back alignment and structure |
|---|
| >3esg_A HUTD, putative uncharacterized protein; beta barrel, unknown function; 1.80A {Pseudomonas fluorescens} SCOP: b.82.1.0 | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} | Back alignment and structure |
|---|
| >3bdn_A Lambda repressor; repressor, allostery; HET: DNA; 3.91A {Enterobacteria phage lambda} | Back alignment and structure |
|---|
| >3rcq_A Aspartyl/asparaginyl beta-hydroxylase; structural genomics, structural genomics consortium, SGC, oxidoreductase, human; HET: OGA; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A | Back alignment and structure |
|---|
| >1e5r_A Proline oxidase; oxidoreductase, oxygenase, 2-oxoglutarate dependent oxygenase; 2.30A {Streptomyces SP} SCOP: b.82.2.4 PDB: 1e5s_A | Back alignment and structure |
|---|
| >2qdr_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE EPE; 2.60A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2oyz_A UPF0345 protein VPA0057; unknown function, structural genomi 2, protein structure initiative, midwest center for structu genomics, MCSG; 1.71A {Vibrio parahaemolyticus} SCOP: b.82.1.22 | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >2fjr_A Repressor protein CI; genetic switch, regulation, cooperativity, transcription regulator; 1.95A {Enterobacteria phage 186} PDB: 2fkd_A | Back alignment and structure |
|---|
| >2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3eo6_A Protein of unknown function (DUF1255); AFE_2634, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 0.97A {Acidithiobacillus ferrooxidans ATCC23270} | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >1dw9_A Cyanate lyase; cyanate degradation, structural genomics, PSI, protei structure initiative, midwest center for structural genomic; HET: SO4; 1.65A {Escherichia coli} SCOP: a.35.1.4 d.72.1.1 PDB: 1dwk_A* 2ivq_A 2ivb_A 2iu7_A 2iv1_A 2iuo_A 2ivg_A | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >3hqx_A UPF0345 protein aciad0356; DUF1255,PF06865,PSI2,MCSG, structural genomics, protein STRU initiative, midwest center for structural genomics; 1.66A {Acinetobacter SP} SCOP: b.82.1.0 | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >1yll_A PA5104, conserved hypothetical protein; structural genomics, beta-BA PSI, protein structure initiative, midwest center for struc genomics; 1.64A {Pseudomonas aeruginosa} SCOP: b.82.1.17 | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >1ywk_A 4-deoxy-L-threo-5-hexosulose-uronate ketol- isomerase 1; structural genomics, nysgxrc target T1814, PSI, protein structure initiative; 2.95A {Enterococcus faecalis} SCOP: b.82.1.13 | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3g7d_A PHPD; non heme Fe(II) dioxygenase, cupin, biosynthetic protein; 1.80A {Streptomyces viridochromogenes} PDB: 3gbf_A 3rzz_A | Back alignment and structure |
|---|
| >3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* | Back alignment and structure |
|---|
| >2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 300 | ||||
| d1sfna_ | 245 | b.82.1.11 (A:) Hypothetical protein DR1152 {Deinoc | 3e-68 | |
| d1sefa_ | 250 | b.82.1.11 (A:) Hypothetical protein EF2996 {Entero | 2e-67 | |
| d1rc6a_ | 253 | b.82.1.11 (A:) Hypothetical protein YlbA {Escheric | 6e-61 | |
| d1sq4a_ | 273 | b.82.1.11 (A:) Glyoxylate-induced protein PA1140 { | 3e-58 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 9e-05 | |
| d2arca_ | 161 | b.82.4.1 (A:) Regulatory protein AraC {Escherichia | 8e-04 | |
| d2d40a1 | 308 | b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Es | 0.001 | |
| d1vj2a_ | 114 | b.82.1.10 (A:) Hypothetical protein TM1459 {Thermo | 0.003 | |
| d2pyta1 | 128 | b.82.1.24 (A:100-227) Ethanolamine utilization pro | 0.004 |
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Length = 245 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: YlbA-like domain: Hypothetical protein DR1152 species: Deinococcus radiodurans [TaxId: 1299]
Score = 210 bits (536), Expect = 3e-68
Identities = 94/244 (38%), Positives = 133/244 (54%), Gaps = 7/244 (2%)
Query: 61 GFTRSVYKRDHALITPESHVLSPLPEWTNTLGAYLITPA--MGSHFVMYLANMQENARSA 118
G TRS HA+ITPE+ V + L EW + I P +G+ FV + A M A++
Sbjct: 5 GQTRSALHGSHAVITPETFVRTALAEWPGSAIVLHIAPVVGLGARFVQFTAEMPAGAQA- 63
Query: 119 LPPHDVERFIFVVQGSAMLTNASGVSSKLMVDSYTYLPPNFAHSLRAEGSATLVVFERRY 178
+RF FV+ G + G + L Y YLP H L A+ A + VFE+ Y
Sbjct: 64 -TESVYQRFAFVLSGEVDVA-VGGETRTLREYDYVYLPAGEKHMLTAKTDARVSVFEKPY 121
Query: 179 ASLENHITEQIVGSTDKQ--PLLETPGEVFQLRKLLPQAVPFDFNIHIMDFQPGDFLNVK 236
++E + +++ + RKLLP FDF + M F PG L
Sbjct: 122 QTVEGVQAPGVYWGNERENPGYPFEGDDHLIARKLLPDEPAFDFMVSTMSFAPGASLPYA 181
Query: 237 EVHYNQHGLLLLEGQGIYRLGDSWYPVQAGDVLWMAPFVPQWYAALGKTRTRYLLYKDVN 296
EVHY +HGLL+LEG+G+Y+L +++YPV AGD++WM PQWY ALG+ ++YLLYKD+N
Sbjct: 182 EVHYMEHGLLMLEGEGLYKLEENYYPVTAGDIIWMGAHCPQWYGALGRNWSKYLLYKDMN 241
Query: 297 RNPL 300
R+PL
Sbjct: 242 RHPL 245
|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Length = 273 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Length = 308 | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Length = 114 | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Length = 128 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 300 | |||
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 100.0 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 100.0 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 100.0 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 100.0 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 99.94 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 99.86 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 99.86 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 99.84 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 99.81 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 99.81 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 99.78 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 99.75 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.73 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 99.69 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 99.69 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 99.67 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 99.64 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.64 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 99.63 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 99.62 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.62 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 99.52 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 99.49 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.49 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.47 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.44 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 99.44 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 99.44 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 99.43 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 99.43 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 99.42 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 99.4 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 99.34 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 99.33 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 99.33 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 99.27 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 99.17 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 99.11 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 99.05 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.04 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 99.03 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 98.89 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 98.84 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 98.8 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 98.79 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 98.79 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 98.74 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 98.68 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 98.62 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 98.61 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 98.58 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 98.57 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 98.53 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 98.53 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 98.52 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 98.5 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 98.45 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 98.45 | |
| d1ywka1 | 260 | 5-keto-4-deoxyuronate isomerase KduI {Enterococcus | 98.43 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 98.4 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 98.34 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 98.33 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 98.32 | |
| d1xrua1 | 277 | 5-keto-4-deoxyuronate isomerase KduI {Escherichia | 98.32 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 98.3 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 98.25 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 98.22 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 98.17 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 98.12 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 98.11 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 98.1 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 97.99 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 97.96 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 97.83 | |
| d1y7ya1 | 69 | Restriction-modification controller protein C.AhdI | 97.79 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 97.76 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 97.69 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 97.67 | |
| d1utxa_ | 66 | Putative transcription regulator CylR2 {Enterococc | 97.62 | |
| d2ofya1 | 82 | Putative transcriptional regulator RHA1_ro04071 {R | 97.61 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 97.56 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 97.54 | |
| d1lmb3_ | 87 | lambda C1 repressor, DNA-binding domain {Bacteriop | 97.38 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 97.38 | |
| d1y9qa1 | 79 | Probable transcriptional regulator VC1968, N-termi | 97.32 | |
| d2b5aa1 | 77 | Regulatory protein C.BclI {Bacillus caldolyticus [ | 97.3 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 97.26 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 97.22 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 97.2 | |
| d2a6ca1 | 69 | HTH-motif protein NE1354 {Nitrosomonas europaea [T | 97.15 | |
| d1b0na2 | 68 | SinR repressor, DNA-binding domain {Bacillus subti | 97.09 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 97.04 | |
| d2r1jl1 | 66 | P22 C2 repressor, DNA-binding domain {Salmonella b | 97.03 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 97.03 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 96.94 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 96.93 | |
| d1r69a_ | 63 | 434 C1 repressor, DNA-binding domain {Bacteriophag | 96.78 | |
| d1x57a1 | 78 | Endothelial differentiation-related factor 1, EDF1 | 96.66 | |
| d2croa_ | 65 | cro 434 {Bacteriophage 434 [TaxId: 10712]} | 96.61 | |
| d2o38a1 | 89 | Hypothetical protein RPA3824 {Rhodopseudomonas pal | 96.59 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 96.5 | |
| d1tq5a1 | 231 | Hypothetical protein YhhW {Escherichia coli [TaxId | 96.36 | |
| d2icta1 | 87 | Antitoxin HigA {Escherichia coli [TaxId: 562]} | 96.28 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 96.27 | |
| d1ylla1 | 195 | Hypothetical protein PA5104 {Pseudomonas aeruginos | 96.22 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 95.72 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 95.67 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 95.46 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 95.29 | |
| d1e5ra_ | 290 | Type II Proline 3-hydroxylase (proline oxidase) {S | 94.38 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 94.38 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 94.04 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 93.82 | |
| d2ppxa1 | 62 | Uncharacterized protein Atu1735 {Agrobacterium tum | 93.8 | |
| d2oyza1 | 93 | Uncharacterized protein VPA0057 {Vibrio parahaemol | 93.59 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 93.5 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 93.46 | |
| d1zx5a1 | 299 | Putative mannosephosphate isomerase AF0035 {Archae | 91.38 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 91.15 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 90.87 | |
| d1ywka1 | 260 | 5-keto-4-deoxyuronate isomerase KduI {Enterococcus | 90.51 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 89.9 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 88.6 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 87.39 | |
| d1ft9a2 | 132 | CO-sensing protein CooA, N-terminal domain {Rhodos | 86.99 | |
| d1cx4a2 | 147 | Regulatory subunit of Protein kinase A {Rat (Rattu | 85.62 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 85.46 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 85.16 | |
| d3dl3a1 | 96 | Tellurite resistance protein B, TehB {Vibrio fisch | 84.77 | |
| d1xrua1 | 277 | 5-keto-4-deoxyuronate isomerase KduI {Escherichia | 84.62 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 84.26 | |
| d3dl3a1 | 96 | Tellurite resistance protein B, TehB {Vibrio fisch | 84.14 | |
| d1ne6a1 | 136 | Regulatory subunit of Protein kinase A {Cow (Bos t | 83.22 | |
| d1q3ea_ | 193 | HCN pacemaker channel {Mouse (Mus musculus) [TaxId | 82.72 | |
| d2oyza1 | 93 | Uncharacterized protein VPA0057 {Vibrio parahaemol | 82.36 | |
| d3bb6a1 | 109 | Uncharacterized protein YeaR {Escherichia coli [Ta | 82.21 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 82.06 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 82.05 | |
| d1e5ra_ | 290 | Type II Proline 3-hydroxylase (proline oxidase) {S | 81.88 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 81.62 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 81.51 | |
| d1vp6a_ | 133 | Putative ion channel CnbD {Mesorhizobium loti [Tax | 80.56 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 80.49 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 80.27 |
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: YlbA-like domain: Glyoxylate-induced protein PA1140 species: Pseudomonas aeruginosa [TaxId: 287]
Probab=100.00 E-value=2.8e-60 Score=437.31 Aligned_cols=242 Identities=30% Similarity=0.517 Sum_probs=222.4
Q ss_pred hcccCCcceeeeeeeeEeCC---CCeeeccCCCCCcceEEEEecCCCC--CcEEEEEEEEcCCCcCCCC--CCCceEEEE
Q 022278 57 QDLPGFTRSVYKRDHALITP---ESHVLSPLPEWTNTLGAYLITPAMG--SHFVMYLANMQENARSALP--PHDVERFIF 129 (300)
Q Consensus 57 ~~~lg~trs~f~~~~av~~~---e~~~~~~~p~~~~~~~~~L~sp~~g--~~f~~~lv~l~PG~~~~~~--~h~gEEf~y 129 (300)
++.|.++|++|+++|+|+++ .+.+.+.+|+|++++.++|++|.+| +.|++++++++||+++..+ .++.|||+|
T Consensus 14 ~~~l~~~Rav~~~~yavip~~~~~~iv~s~lP~w~~~~~~vl~~p~~G~a~~F~~y~vev~PGg~s~~p~~~~~~Ee~~y 93 (273)
T d1sq4a_ 14 QTELLTDRAMFTEAYAVIPKGVMRDIVTSHLPFWDNMRMWVIARPLSGFAETFSQYIVELAPNGGSDKPEQDPNAEAVLF 93 (273)
T ss_dssp ---CCCCCCEECSSEEEECGGGCCGGGCBCCTTCEEEEEEEECCCSSSSCCSCEEEEEEEEEEEEESSCCCCTTEEEEEE
T ss_pred hhHhccCceEeccceEEccCcccccceeecCCCCCCceEEEECCcccCCCcceEEEEEEECCCCccCCCCCCCCcEEEEE
Confidence 45678999999999999966 7899999999999999999999999 6899999999999976443 567899999
Q ss_pred EEECEEEEEEcCCcEEEeccCcEEEeCCCCceEEee--CCeEEEEEEEeeccccCCC-CcceeeccCCCCCCcccCC--c
Q 022278 130 VVQGSAMLTNASGVSSKLMVDSYTYLPPNFAHSLRA--EGSATLVVFERRYASLENH-ITEQIVGSTDKQPLLETPG--E 204 (300)
Q Consensus 130 VLeG~v~l~v~gg~~~~L~~Gds~yfpa~~~H~~~N--~~~a~vl~v~~~y~~~~g~-~p~~~~~~~~d~~~~~~~g--~ 204 (300)
|++|++++++ +|+++.|++||++|+|++.+|+++| +++|+++||.++|++.+|. +|..++++++|+++.++++ +
T Consensus 94 Vl~G~~~l~~-~g~~~~L~~Gd~~y~P~g~~h~~~N~g~~~a~~l~i~k~y~~~~g~~~p~~~v~~~~dv~p~~~~~~~~ 172 (273)
T d1sq4a_ 94 VVEGELSLTL-QGQVHAMQPGGYAFIPPGADYKVRNTTGQHTRFHWIRKHYQKVDGVPLPEAFVTNEQDIQPLVMPDTEG 172 (273)
T ss_dssp EEESCEEEEE-SSCEEEECTTEEEEECTTCCEEEECCSSSCEEEEEEEEECCCCTTCCCCCCEEEEGGGSCCEECSSGGG
T ss_pred EEeCEEEEEE-CCEEEEecCCCEEEECCCCcEeeeecCCCCEEEEEEEeccccccccccccccccChhccCcccccCCCc
Confidence 9999999999 9999999999999999999999998 7899999999999999995 6889999999999999887 2
Q ss_pred e-eEEEEeeCCCCCcceEEEEEEecCCcccCcceeeccceEEEEEEeeEEEEeCCEEEEccCCcEEEeCCCCceeEEecC
Q 022278 205 V-FQLRKLLPQAVPFDFNIHIMDFQPGDFLNVKEVHYNQHGLLLLEGQGIYRLGDSWYPVQAGDVLWMAPFVPQWYAALG 283 (300)
Q Consensus 205 ~-~~~~~l~p~~~~~~~~~~~~tl~PG~~~p~~~~H~~eh~~~iL~G~G~~~~~g~~~~v~~GD~i~~~~~~~H~~~n~G 283 (300)
. ...|.++|++.+++|+|++++|+||++++.+|+|.+||++|||+|+|+|++||+|++|++||+|||+++|+|+++|+|
T Consensus 173 ~~~~~r~~~p~d~~~d~~~~i~~~~PG~~~~~~h~H~~ee~~~vl~G~~~~~~~~~~~~v~~GD~i~~~~~~ph~~~n~g 252 (273)
T d1sq4a_ 173 RWSTTRFVDMSDMRHDMHVNIVNFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGG 252 (273)
T ss_dssp CEEEECSSCTTCTTCSEEEEEEEECSSSEESCCCCCSEEEEEEEEECEEEEEETTEEEEEETTCEEEEEESCCEEEECCS
T ss_pred eeEEEEeeCCcccccceEEEEEEEccCCccccccccccceEEEEEccEEEEEECCEEEEecCCCEEEECCCCCEEeEeCC
Confidence 2 233446688999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CccEEEEEEeecCCCC
Q 022278 284 KTRTRYLLYKDVNRNP 299 (300)
Q Consensus 284 ~e~~~fi~~kd~nr~~ 299 (300)
++|++||+|||||||+
T Consensus 253 ~~p~~yl~~kd~nR~~ 268 (273)
T d1sq4a_ 253 PGRFRYLLYKDVNRHM 268 (273)
T ss_dssp SSCEEEEEEEECSSCC
T ss_pred CCCEEEEEEEEcCcCc
Confidence 9999999999999996
|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ofya1 a.35.1.3 (A:3-84) Putative transcriptional regulator RHA1_ro04071 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1lmb3_ a.35.1.2 (3:) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d1x57a1 a.35.1.12 (A:8-85) Endothelial differentiation-related factor 1, EDF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} | Back information, alignment and structure |
|---|
| >d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ylla1 b.82.1.17 (A:2-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d1ywka1 b.82.1.13 (A:1001-1260) 5-keto-4-deoxyuronate isomerase KduI {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} | Back information, alignment and structure |
|---|
| >d1xrua1 b.82.1.13 (A:1-277) 5-keto-4-deoxyuronate isomerase KduI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} | Back information, alignment and structure |
|---|
| >d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oyza1 b.82.1.22 (A:2-94) Uncharacterized protein VPA0057 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1e5ra_ b.82.2.4 (A:) Type II Proline 3-hydroxylase (proline oxidase) {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|