Citrus Sinensis ID: 022296


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MSGYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYFLL
ccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHcccEEccccHHHHHHHHcccHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHcccEEccccccccccccccccHHHHcccccccccccccHHccccccccccccHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccccccccccccHHHHHHHccccccccccccccccccc
ccccEEccHHHccccccccccccccEEEEccccccccccHHHHHHHHHHHcHHccEEEEcccccccccHHHHHHHHHHHHHcccEEcccHHHHHHHHccccHHHHHHHHHHHccccEEEEccccEcccHHHHHHHHHHHHHcccEEEEEccEEccccccccccccHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHccccEEEccHHHHHHHHHHHcccccccHHHHcccccccc
msgyyygwksfdeyedraekprrfgvtemrsphytlsssHNVLEDIFESMGQfvdglkfsggshslmpkpFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFdtielnvgsleipeETLLRYVRLVKSaglkakpkfavmfnksdipsdrdrafgayvaraprstdklflasnpeievgvginksRRAERCLEAGadmimidsddvckhADSLRADIIAKVIGRLglektmfeatnprtsewfirrygpkvnlfvdhsqvmdleclrgrnlgkshrsvlsssyfll
msgyyygwksfdeyedRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELnvgsleipeeTLLRYVRLVKsaglkakpkfavmfnksdipsdrdRAFGAYVARaprstdklflasnpeievgvginksrrAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIgrlglektmfeatnprtsewfirRYGPKVNLFVDHSQVMDLECLrgrnlgkshrsvlsssyfll
MSGYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYFLL
***YYYGWKSFDEY*************************HNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDI****DRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNL***************
****YYG*KSFDEY*****KPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYFLL
MSGYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYFLL
**GYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYFLL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGYYYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYFLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query299 2.2.26 [Sep-21-2011]
O27710258 Phosphosulfolactate synth yes no 0.789 0.914 0.233 1e-08
Q57703251 Phosphosulfolactate synth yes no 0.719 0.856 0.230 1e-05
>sp|O27710|PSLS_METTH Phosphosulfolactate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=comA PE=3 SV=1 Back     alignment and function desciption
 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 119/283 (42%), Gaps = 47/283 (16%)

Query: 17  RAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVV 76
           R+ KPR+ G+T +       +S+     D+ E    +VD +KF  G+  L  +  ++E V
Sbjct: 11  RSGKPRKNGITMVLDKGMGPASAR----DLMEISSDYVDFIKFGWGTLPLHRRDTVKEKV 66

Query: 77  KRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYV 136
                 DV    G      I +     +EY ++ + +GF+T+E++ G++EI  E   R +
Sbjct: 67  DMYRSFDVEPYPGGTLFE-IAHLNDKVEEYFQEARSLGFETLEISNGTVEIETEEKCRLI 125

Query: 137 RLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGIN 196
            +    G      F V+        +RDR                     P+       +
Sbjct: 126 EMAVDEG------FMVLSEVGKKDPERDRLL------------------EPD-------D 154

Query: 197 KSRRAERCLEAGADMIMIDSDD------VCKHADSLRADIIAKVIGRLGLEKTMFEATNP 250
           + R     L AGA M+++++ +      +     ++R D    +  RL +++ ++EA   
Sbjct: 155 RVRLVRADLRAGASMVLMEARESGQNIGIYDERGNIREDEFNHLTDRLPMDRIIWEAPQK 214

Query: 251 RTSEWFIRRYGPKVNL-FVDHSQVMDLEC----LRGRNLGKSH 288
               +FI + GP VNL  +   ++  LE     LRG  LGK +
Sbjct: 215 SQQVYFILKIGPDVNLGNIPPEEITALETIRRGLRGDTLGKVN 257




Catalyzes the addition of sulfite to phosphoenolpyruvate (PEP) to yield (2R)-phospho-3-sulfolactate (PSL).
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (taxid: 187420)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 9
>sp|Q57703|PSLS_METJA Phosphosulfolactate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=comA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
449454694286 PREDICTED: uncharacterized protein LOC10 0.939 0.982 0.736 1e-123
224116330291 predicted protein [Populus trichocarpa] 0.959 0.986 0.715 1e-120
30685384286 Aldolase-type TIM barrel family protein 0.946 0.989 0.705 1e-119
356524766286 PREDICTED: uncharacterized protein LOC10 0.946 0.989 0.690 1e-115
255555077277 furin, putative [Ricinus communis] gi|22 0.899 0.971 0.714 1e-115
297804020 1745 hypothetical protein ARALYDRAFT_329472 [ 0.899 0.154 0.630 1e-109
3402751 1736 putative protein [Arabidopsis thaliana] 0.899 0.154 0.626 1e-109
350534450286 phosphosulfolactate synthase-related pro 0.946 0.989 0.639 1e-108
356519509291 PREDICTED: uncharacterized protein LOC10 0.966 0.993 0.654 1e-107
357123468299 PREDICTED: uncharacterized protein LOC10 0.949 0.949 0.602 1e-104
>gi|449454694|ref|XP_004145089.1| PREDICTED: uncharacterized protein LOC101208408 [Cucumis sativus] gi|449473349|ref|XP_004153856.1| PREDICTED: uncharacterized protein LOC101220954 [Cucumis sativus] gi|449488403|ref|XP_004158021.1| PREDICTED: uncharacterized protein LOC101228109 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/292 (73%), Positives = 251/292 (85%), Gaps = 11/292 (3%)

Query: 6   YGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHS 65
           Y WKSFDE EDR EKPRR GVTEMR PHYTLS+  +V+++IFES+GQFVDGLKFSGGSHS
Sbjct: 4   YLWKSFDEDEDRPEKPRRCGVTEMRGPHYTLST-QDVIQEIFESLGQFVDGLKFSGGSHS 62

Query: 66  LMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSL 125
           L+P+ F++EV + AH+HDVYVSTGDWAEHL+R GPS FKEYVE+CK +GFDTIELNVGSL
Sbjct: 63  LLPRDFMKEVTEMAHRHDVYVSTGDWAEHLLRKGPSGFKEYVEECKLLGFDTIELNVGSL 122

Query: 126 EIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLAS 185
           ++PEETLLRYVRL+K+ GL+AKP+FAV FNKSDIP   +RAFGAY+   PRS++   L  
Sbjct: 123 DVPEETLLRYVRLIKNGGLRAKPQFAVKFNKSDIPISGNRAFGAYIVPKPRSSE---LVE 179

Query: 186 NPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTMF 245
           + ++ +       RRAERCLEAGADMIMID+DDV KHA+ LRADIIAK+IGRLGLEKTMF
Sbjct: 180 DVDLLI-------RRAERCLEAGADMIMIDADDVSKHAEFLRADIIAKIIGRLGLEKTMF 232

Query: 246 EATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYF 297
           EA+NP+TSEWFI  YGPKVNLFVDHSQVMDLECLRGRNLGK+H S+L SSYF
Sbjct: 233 EASNPQTSEWFINHYGPKVNLFVDHSQVMDLECLRGRNLGKNHSSILGSSYF 284




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224116330|ref|XP_002317271.1| predicted protein [Populus trichocarpa] gi|222860336|gb|EEE97883.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30685384|ref|NP_567623.2| Aldolase-type TIM barrel family protein [Arabidopsis thaliana] gi|26452567|dbj|BAC43368.1| unknown protein [Arabidopsis thaliana] gi|332659039|gb|AEE84439.1| Aldolase-type TIM barrel family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356524766|ref|XP_003530999.1| PREDICTED: uncharacterized protein LOC100805668 [Glycine max] Back     alignment and taxonomy information
>gi|255555077|ref|XP_002518576.1| furin, putative [Ricinus communis] gi|223542421|gb|EEF43963.1| furin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297804020|ref|XP_002869894.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. lyrata] gi|297315730|gb|EFH46153.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|3402751|emb|CAA20197.1| putative protein [Arabidopsis thaliana] gi|7268928|emb|CAB79131.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|350534450|ref|NP_001234653.1| phosphosulfolactate synthase-related protein [Solanum lycopersicum] gi|54639895|gb|AAV36519.1| phosphosulfolactate synthase-related protein [Solanum lycopersicum] gi|54639897|gb|AAV36520.1| phosphosulfolactate synthase-related protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356519509|ref|XP_003528415.1| PREDICTED: uncharacterized protein LOC100781391 [Glycine max] Back     alignment and taxonomy information
>gi|357123468|ref|XP_003563432.1| PREDICTED: uncharacterized protein LOC100846790 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
TAIR|locus:2141196286 HSA32 "HEAT-STRESS-ASSOCIATED 0.943 0.986 0.710 2e-111
UNIPROTKB|Q653W2302 P0547F09.36 "Phosphosulfolacta 0.929 0.920 0.611 4.2e-95
ASPGD|ASPL0000047680342 AN10197 [Emericella nidulans ( 0.872 0.763 0.373 1.6e-38
UNIPROTKB|Q5BDB6 1107 AN1464.2 "Putative uncharacter 0.872 0.235 0.373 2.7e-37
UNIPROTKB|Q83AE7290 CBU_1954 "(2R)-phospho-3-sulfo 0.806 0.831 0.271 3.3e-24
TIGR_CMR|CBU_1954290 CBU_1954 "hypothetical protein 0.806 0.831 0.271 3.3e-24
TAIR|locus:2141196 HSA32 "HEAT-STRESS-ASSOCIATED 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1100 (392.3 bits), Expect = 2.0e-111, P = 2.0e-111
 Identities = 209/294 (71%), Positives = 254/294 (86%)

Query:     5 YYGWKSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSH 64
             YY WKSF+E EDR EKPRR+GVTEMR PHY++ S  N+L++IFESMGQFVDGLKFSGGS+
Sbjct:     4 YYRWKSFEENEDRPEKPRRYGVTEMRGPHYSVLSQ-NLLQEIFESMGQFVDGLKFSGGSN 62

Query:    65 SLMPKPFIEEVVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGS 124
             SL+PK FI++ ++ AH+H VYVSTGDWAEH++R+GPSAFK+YVE+CKQ+GFDTIELN   
Sbjct:    63 SLIPKSFIKQAIEMAHEHGVYVSTGDWAEHMLRSGPSAFKDYVEECKQLGFDTIELNANL 122

Query:   125 LEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLA 184
             LE+PEETLLRYVRL+K+ GL+AKP FAV FNKSDIP  R+RAFG+YV   PRS++  F+ 
Sbjct:   123 LEVPEETLLRYVRLIKNGGLRAKPMFAVKFNKSDIPG-RNRAFGSYVVPEPRSSE--FVE 179

Query:   185 SNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCKHADSLRADIIAKVIGRLGLEKTM 244
                +I++ +     R+AERCLEAGAD IMID+DDVCK+ADSLRADIIAKVIGRLG+EKTM
Sbjct:   180 ---DIDLLI-----RKAERCLEAGADTIMIDADDVCKYADSLRADIIAKVIGRLGIEKTM 231

Query:   245 FEATNPRTSEWFIRRYGPKVNLFVDHSQVMDLECLRGRNLGKSHRSVLSSSYFL 298
             FEA++ +  EWFI+RYGP VNL+VDHSQ+MDLECLRGR+LGK H+SVLSSSYFL
Sbjct:   232 FEASDAKLVEWFIKRYGPNVNLYVDHSQIMDLECLRGRHLGKDHQSVLSSSYFL 285




GO:0003824 "catalytic activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IBA
GO:0005618 "cell wall" evidence=IBA
GO:0005634 "nucleus" evidence=ISM
GO:0008152 "metabolic process" evidence=IBA
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0010286 "heat acclimation" evidence=RCA;IMP
GO:0006457 "protein folding" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0010608 "posttranscriptional regulation of gene expression" evidence=IMP
UNIPROTKB|Q653W2 P0547F09.36 "Phosphosulfolactate synthase-related protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
ASPGD|ASPL0000047680 AN10197 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BDB6 AN1464.2 "Putative uncharacterized protein" [Aspergillus nidulans FGSC A4 (taxid:227321)] Back     alignment and assigned GO terms
UNIPROTKB|Q83AE7 CBU_1954 "(2R)-phospho-3-sulfolactate synthase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1954 CBU_1954 "hypothetical protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.4.1.19LOW CONFIDENCE prediction!
3rd Layer4.4.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00012839001
SubName- Full=Chromosome undetermined scaffold_405, whole genome shotgun sequence; (286 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
pfam02679245 pfam02679, ComA, (2R)-phospho-3-sulfolactate synth 2e-84
COG1809258 COG1809, COG1809, (2R)-phospho-3-sulfolactate synt 5e-41
TIGR03849237 TIGR03849, arch_ComA, phosphosulfolactate synthase 3e-16
pfam13654 509 pfam13654, AAA_32, AAA domain 0.003
>gnl|CDD|190389 pfam02679, ComA, (2R)-phospho-3-sulfolactate synthase (ComA) Back     alignment and domain information
 Score =  253 bits (648), Expect = 2e-84
 Identities = 94/277 (33%), Positives = 140/277 (50%), Gaps = 42/277 (15%)

Query: 15  EDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEE 74
            +R EKPRR G+T +             LED+ ES G ++D LKF  G+ +LMP+  ++E
Sbjct: 4   PERPEKPRRTGLTMVLDKGLGPRF----LEDLLESAGDYIDFLKFGWGTSALMPEDILKE 59

Query: 75  VVKRAHQHDVYVSTGDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLR 134
            +  AH+H VYV TG     +  +    F EY+ +CK++GFD IE++ G++E+PEE  LR
Sbjct: 60  KIDLAHEHGVYVYTGGTLFEIAIS-QGKFDEYLRECKELGFDAIEISDGTIELPEEERLR 118

Query: 135 YVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVG 194
            +R  K AG K          K D   D              + D+L             
Sbjct: 119 LIRKAKKAGFKVLS----EVGKKDPELDS-----------SLTPDELI------------ 151

Query: 195 INKSRRAERCLEAGADMIMIDSD-----DVCKHADSLRADIIAKVIGRLGLEKTMFEATN 249
                + ER LEAGAD ++I++       +      +R D++ +++ RLGLEK +FEA  
Sbjct: 152 ----EQIERDLEAGADKVIIEARESGGVGLYDSDGEVRTDLVEEILERLGLEKLIFEAPQ 207

Query: 250 PRTSEWFIRRYGPKVNL-FVDHSQVMDLECLRGRNLG 285
            +   WFI+R+GP VNL  +  S+V+ LE LR    G
Sbjct: 208 KKQQVWFIKRFGPNVNLGNIPPSEVLALETLRRGLRG 244


In methanobacteria (2R)-phospho-3-sulfolactate synthase (ComA) catalyzes the first step of the biosynthesis of coenzyme M from phosphoenolpyruvate (P-enolpyruvate). This novel enzyme catalyzes the stereospecific Michael addition of sulfite to P-enolpyruvate, forming L-2-phospho-3-sulfolactate (PSL). It is suggested that the ComA-catalyzed reaction is analogous to those reactions catalyzed by beta-elimination enzymes that proceed through an enolate intermediate. Length = 245

>gnl|CDD|224722 COG1809, COG1809, (2R)-phospho-3-sulfolactate synthase (PSL synthase, CoM biosynthesis) [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|163561 TIGR03849, arch_ComA, phosphosulfolactate synthase Back     alignment and domain information
>gnl|CDD|222290 pfam13654, AAA_32, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 299
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 100.0
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 100.0
COG1809258 (2R)-phospho-3-sulfolactate synthase (PSL synthase 100.0
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 97.36
PRK13209283 L-xylulose 5-phosphate 3-epimerase; Reviewed 97.24
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 97.19
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 97.02
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 96.99
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 96.85
PF00682237 HMGL-like: HMGL-like of this family is not conserv 96.83
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 96.81
PRK06294370 coproporphyrinogen III oxidase; Provisional 96.62
PRK08446350 coproporphyrinogen III oxidase; Provisional 96.6
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 96.52
PRK13210284 putative L-xylulose 5-phosphate 3-epimerase; Revie 96.52
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 96.44
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 96.31
PRK05628375 coproporphyrinogen III oxidase; Validated 96.3
TIGR00542279 hxl6Piso_put hexulose-6-phosphate isomerase, putat 96.24
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 96.07
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 96.0
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 95.98
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 95.98
PRK05660378 HemN family oxidoreductase; Provisional 95.96
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 95.96
TIGR00538 455 hemN oxygen-independent coproporphyrinogen III oxi 95.8
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 95.74
PRK05904353 coproporphyrinogen III oxidase; Provisional 95.7
PRK07379 400 coproporphyrinogen III oxidase; Provisional 95.69
TIGR00539360 hemN_rel putative oxygen-independent coproporphyri 95.67
PLN02746347 hydroxymethylglutaryl-CoA lyase 95.57
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 95.56
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 95.54
PRK13347 453 coproporphyrinogen III oxidase; Provisional 95.49
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 95.47
PRK08208 430 coproporphyrinogen III oxidase; Validated 95.47
TIGR01212302 radical SAM protein, TIGR01212 family. This unchar 95.42
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 95.38
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 95.38
PRK09249 453 coproporphyrinogen III oxidase; Provisional 95.36
PRK03170 292 dihydrodipicolinate synthase; Provisional 95.34
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 95.28
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 95.09
COG0826 347 Collagenase and related proteases [Posttranslation 95.07
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 94.91
PRK01060281 endonuclease IV; Provisional 94.9
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 94.9
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 94.89
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 94.78
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 94.78
PRK12331 448 oxaloacetate decarboxylase; Provisional 94.71
PRK09856275 fructoselysine 3-epimerase; Provisional 94.7
PRK05799 374 coproporphyrinogen III oxidase; Provisional 94.57
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 94.53
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 94.5
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 94.48
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 94.36
PF00682237 HMGL-like: HMGL-like of this family is not conserv 94.33
PRK08207488 coproporphyrinogen III oxidase; Provisional 94.28
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 94.26
PRK09057380 coproporphyrinogen III oxidase; Provisional 94.2
PRK12581 468 oxaloacetate decarboxylase; Provisional 94.13
PRK08599377 coproporphyrinogen III oxidase; Provisional 94.11
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 94.1
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 94.04
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 94.02
PRK09282 592 pyruvate carboxylase subunit B; Validated 93.94
cd06547339 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG 93.86
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 93.85
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 93.79
TIGR02668302 moaA_archaeal probable molybdenum cofactor biosynt 93.77
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 93.69
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 93.68
PRK06582390 coproporphyrinogen III oxidase; Provisional 93.58
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 93.54
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM 93.5
COG1082274 IolE Sugar phosphate isomerases/epimerases [Carboh 93.49
PRK04147293 N-acetylneuraminate lyase; Provisional 93.41
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 93.37
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 93.37
PRK14042 596 pyruvate carboxylase subunit B; Provisional 93.29
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM 93.21
PRK00915 513 2-isopropylmalate synthase; Validated 93.21
PRK14040 593 oxaloacetate decarboxylase; Provisional 93.2
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 93.17
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 93.11
PRK14041 467 oxaloacetate decarboxylase; Provisional 93.1
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 92.98
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 92.98
TIGR02109358 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. 92.95
PRK14040 593 oxaloacetate decarboxylase; Provisional 92.86
TIGR02313 294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 92.79
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 92.76
PRK09058 449 coproporphyrinogen III oxidase; Provisional 92.63
PRK12330 499 oxaloacetate decarboxylase; Provisional 92.47
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 92.47
cd04743 320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 92.46
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 92.42
PRK12331 448 oxaloacetate decarboxylase; Provisional 92.33
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 92.27
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.25
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 92.17
PRK05301378 pyrroloquinoline quinone biosynthesis protein PqqE 91.9
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 91.83
PRK00915 513 2-isopropylmalate synthase; Validated 91.68
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 91.6
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 91.53
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 91.47
PRK10076213 pyruvate formate lyase II activase; Provisional 91.3
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 91.2
PLN02417280 dihydrodipicolinate synthase 91.16
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 91.11
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 91.1
PRK07094323 biotin synthase; Provisional 91.07
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 91.04
PRK12330 499 oxaloacetate decarboxylase; Provisional 91.02
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 91.01
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 90.92
cd00952 309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 90.86
PRK09282 592 pyruvate carboxylase subunit B; Validated 90.86
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 90.78
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 90.76
PLN03228 503 methylthioalkylmalate synthase; Provisional 90.71
PRK09389 488 (R)-citramalate synthase; Provisional 90.69
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 90.63
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 90.57
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 90.47
PLN02746347 hydroxymethylglutaryl-CoA lyase 90.35
PRK10812265 putative DNAse; Provisional 90.34
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 90.34
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 89.95
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 89.93
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 89.93
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 89.84
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 89.71
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 89.66
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 89.58
TIGR02495191 NrdG2 anaerobic ribonucleoside-triphosphate reduct 89.54
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 89.42
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coen 89.34
PRK12581 468 oxaloacetate decarboxylase; Provisional 89.14
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 89.12
smart00518273 AP2Ec AP endonuclease family 2. These endonuclease 89.07
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 89.06
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 89.02
PLN02951373 Molybderin biosynthesis protein CNX2 88.99
PRK14041 467 oxaloacetate decarboxylase; Provisional 88.99
TIGR01211 522 ELP3 histone acetyltransferase, ELP3 family. The S 88.85
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 88.83
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 88.78
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 88.75
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 88.74
cd00019279 AP2Ec AP endonuclease family 2; These endonuclease 88.72
PRK11449258 putative deoxyribonuclease YjjV; Provisional 88.62
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 88.52
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 88.51
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 88.47
PLN02321 632 2-isopropylmalate synthase 88.37
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 88.36
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 88.23
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 88.18
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 87.94
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.59
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 87.5
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 87.44
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 87.44
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 87.43
PLN02591250 tryptophan synthase 87.21
PLN03228 503 methylthioalkylmalate synthase; Provisional 87.03
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.0
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 86.86
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 86.53
PLN02424332 ketopantoate hydroxymethyltransferase 86.5
COG3623287 SgaU Putative L-xylulose-5-phosphate 3-epimerase [ 86.45
PF04055166 Radical_SAM: Radical SAM superfamily; InterPro: IP 86.3
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 86.15
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 85.98
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 85.92
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 85.72
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 85.58
PRK12999 1146 pyruvate carboxylase; Reviewed 85.55
PRK09989258 hypothetical protein; Provisional 84.99
PF00215226 OMPdecase: Orotidine 5'-phosphate decarboxylase / 84.97
PRK09389 488 (R)-citramalate synthase; Provisional 84.8
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 84.79
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 84.63
PRK04302223 triosephosphate isomerase; Provisional 84.6
PRK08898394 coproporphyrinogen III oxidase; Provisional 84.6
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 84.5
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 84.45
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 84.11
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 83.73
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 83.72
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 83.59
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 83.57
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 83.3
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 83.24
PRK06801286 hypothetical protein; Provisional 82.95
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 82.94
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 82.92
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 82.91
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 82.85
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 82.84
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 82.84
PRK15452 443 putative protease; Provisional 82.81
PRK08091228 ribulose-phosphate 3-epimerase; Validated 82.64
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 82.57
TIGR00587274 nfo apurinic endonuclease (APN1). All proteins in 82.51
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 82.5
PRK12677 384 xylose isomerase; Provisional 82.48
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 82.46
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 82.44
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 82.24
PRK09997258 hydroxypyruvate isomerase; Provisional 82.16
smart00642166 Aamy Alpha-amylase domain. 82.05
PRK13523337 NADPH dehydrogenase NamA; Provisional 81.56
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 81.53
PRK14042 596 pyruvate carboxylase subunit B; Provisional 81.47
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of th 81.47
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 81.22
cd07942284 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and 81.18
PRK08446350 coproporphyrinogen III oxidase; Provisional 81.09
PRK12999 1146 pyruvate carboxylase; Reviewed 81.05
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 80.68
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 80.38
smart0048167 POLIIIAc DNA polymerase alpha chain like domain. D 80.23
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 80.11
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 80.09
PRK10425258 DNase TatD; Provisional 80.06
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
Probab=100.00  E-value=8.3e-93  Score=653.59  Aligned_cols=237  Identities=39%  Similarity=0.663  Sum_probs=196.4

Q ss_pred             CCCCCCCCCCCCCceeEecCCCCCCcchhHHHHHHHhhcccccEEEeeCcccccCChhHHHHHHHHHHhCCceecCC-cH
Q 022296           13 EYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTG-DW   91 (299)
Q Consensus        13 ~~~~R~~KPR~~GlT~V~DkGl~~~~g~~~l~DlLe~ag~yID~lKfg~GTs~l~p~~~l~eKI~l~~~~gV~v~~G-tl   91 (299)
                      ++|+|++|||++|+|||+|||+    |+++++|+|++||+|||++|||||||+|||++.|++||++||+|||+|||| |+
T Consensus         1 ~~~~R~~KPR~~GlT~v~Dkgl----g~~~~~dlLe~ag~yID~~K~g~Gt~~l~~~~~l~eki~l~~~~gV~v~~GGtl   76 (244)
T PF02679_consen    1 NLPERPEKPRSRGLTMVIDKGL----GLRYLEDLLESAGDYIDFLKFGWGTSALYPEEILKEKIDLAHSHGVYVYPGGTL   76 (244)
T ss_dssp             -TTGGG-SS-SSS-EEEEESS------HHHHHHHHHHHGGG-SEEEE-TTGGGGSTCHHHHHHHHHHHCTT-EEEE-HHH
T ss_pred             CCCCCCCCCCCCCcEEEecCCC----CHHHHHHHHHHhhhhccEEEecCceeeecCHHHHHHHHHHHHHcCCeEeCCcHH
Confidence            4789999999999999999998    888999999999999999999999999999999999999999999999997 69


Q ss_pred             HHHHHHhCCchHHHHHHHHHHcCCCEEEecCCcccCChhHHHHHHHHHHHcCCcccceeeeecCCCCCCCcccccccccc
Q 022296           92 AEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYV  171 (299)
Q Consensus        92 fE~a~~qg~~~~~~yl~~~k~lGF~~IEISdGti~i~~~~r~~lI~~~~~~G~~v~~E~gvK~~~sevg~~~d~~~~~~~  171 (299)
                      ||+|++|+  ++++|+++||++||++|||||||++||+++|+++|++++++||+|+||||+|++.++             
T Consensus        77 ~E~a~~q~--~~~~yl~~~k~lGf~~IEiSdGti~l~~~~r~~~I~~~~~~Gf~v~~EvG~K~~~~~-------------  141 (244)
T PF02679_consen   77 FEVAYQQG--KFDEYLEECKELGFDAIEISDGTIDLPEEERLRLIRKAKEEGFKVLSEVGKKDPESD-------------  141 (244)
T ss_dssp             HHHHHHTT---HHHHHHHHHHCT-SEEEE--SSS---HHHHHHHHHHHCCTTSEEEEEES-SSHHHH-------------
T ss_pred             HHHHHhcC--hHHHHHHHHHHcCCCEEEecCCceeCCHHHHHHHHHHHHHCCCEEeecccCCCchhc-------------
Confidence            99999999  999999999999999999999999999999999999999999999999999855321             


Q ss_pred             cCCCCccchhcccCCCccchhhhhhhHHHHHHHHHccCcEEEEecc-----ccccCCCcccHHHHHHHHhccCCCceEEe
Q 022296          172 ARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSD-----DVCKHADSLRADIIAKVIGRLGLEKTMFE  246 (299)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~dLeAGA~~VIiEar-----gi~d~~G~~r~d~i~~ii~~l~~eklifE  246 (299)
                                     ...+++++   |+++++||+|||++||||||     |||+++|+||+|++++|++++|++|||||
T Consensus       142 ---------------~~~~~~~~---i~~~~~dLeAGA~~ViiEarEsG~~Gi~~~~g~~r~d~v~~i~~~~~~~~lifE  203 (244)
T PF02679_consen  142 ---------------FSLDPEEL---IEQAKRDLEAGADKVIIEARESGKGGIYDNDGEVRTDLVEKIIERLGLEKLIFE  203 (244)
T ss_dssp             ---------------TT--CCHH---HHHHHHHHHHTECEEEE--TTT--STTB-TTS-B-HHHHHHHHTTS-GGGEEEE
T ss_pred             ---------------ccCCHHHH---HHHHHHHHHCCCCEEEEeeeccCCCCccCCCCCccHHHHHHHHHhCCHhHEEEe
Confidence                           01337788   99999999999999999999     99999999999999999999999999999


Q ss_pred             cCCchhHHHHHHHhCCCcccc-cCCCCchhhhhhhcccCCC
Q 022296          247 ATNPRTSEWFIRRYGPKVNLF-VDHSQVMDLECLRGRNLGK  286 (299)
Q Consensus       247 AP~k~qQ~~fI~~fG~~VNLg-I~~~eVi~LE~LR~~~~G~  286 (299)
                      ||+|+||+|||++|||||||| |+|+||++|||||+|+||.
T Consensus       204 Ap~k~qq~~~I~~~G~~VNLgNI~~~eVl~LE~LR~GLrgD  244 (244)
T PF02679_consen  204 APQKEQQEWFIKRFGPNVNLGNIAPSEVLALETLRRGLRGD  244 (244)
T ss_dssp             --SHHHHHHHHHHH-TT--EEEEEGGGHHHHHHHHCT-SGG
T ss_pred             CCCHhHHHHHHHHhCCCcCcccCCHHHHHHHHHHhccccCC
Confidence            999999999999999999998 9999999999999999983



Coenzyme M (CoM; 2-mercaptoethanesulphonic acid) serves as the terminal methyl carrier for this process. Previously thought to be unique to methanogenic archaea, CoM has also been found in methylotrophic bacteria. Biosynthesis of CoM begins with the Michael addition of sulphite to phosphoenolpyruvate, forming 2-phospho-3-sulpholactate (PSL). This reaction is catalyzed by members of this family, PSL synthase (ComA) []. Subsequently, PSL is dephosphorylated by phosphosulpholactate phosphatase (ComB) to form 3-sulpholactate [], which is then converted to 3-sulphopyruvate by L-sulpholactate dehydrogenase (ComC; 1.1.1.272 from EC) []. Sulphopyruvate decarboxylase (ComDE; 4.1.1.79 from EC) converts 3-sulphopyruvate to sulphoacetaldehyde []. Reductive thiolation of sulphoacetaldehyde is the final step.; GO: 0019295 coenzyme M biosynthetic process; PDB: 1U83_A 1QWG_A.

>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>COG1809 (2R)-phospho-3-sulfolactate synthase (PSL synthase, CoM biosynthesis) [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>TIGR01212 radical SAM protein, TIGR01212 family Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09856 fructoselysine 3-epimerase; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>COG1082 IolE Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK10812 putative DNAse; Provisional Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02951 Molybderin biosynthesis protein CNX2 Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd00019 AP2Ec AP endonuclease family 2; These endonucleases play a role in DNA repair Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK09989 hypothetical protein; Provisional Back     alignment and domain information
>PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR00587 nfo apurinic endonuclease (APN1) Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK12677 xylose isomerase; Provisional Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK09997 hydroxypyruvate isomerase; Provisional Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>smart00481 POLIIIAc DNA polymerase alpha chain like domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
1qwg_A251 Crystal Structure Of Methanococcus Jannaschii Phosp 2e-06
>pdb|1QWG|A Chain A, Crystal Structure Of Methanococcus Jannaschii Phosphosulfolactate Synthase Length = 251 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 60/259 (23%), Positives = 109/259 (42%), Gaps = 51/259 (19%) Query: 43 LEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYV-STGDWAEHLIRNGPS 101 +ED + G ++D +KF G+ +++ + ++E + + V G E+ G Sbjct: 28 VEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKDWGIKVYPGGTLFEYAYSKGK- 86 Query: 102 AFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPS 161 F E++ +C+++GF+ +E++ GS +I E ++ K G F V+ Sbjct: 87 -FDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKRAKDNG------FMVLTEVGKKMP 139 Query: 162 DRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSDDVCK 221 D+D+ L + I++ IN L+AGAD ++I+ + K Sbjct: 140 DKDKQ----------------LTIDDRIKL---INFD------LDAGADYVIIEGRESGK 174 Query: 222 ---------HADSLRADIIAKVIGRLGLEKTMFEATNPRTSEWFIRRYGPKVNLF-VDHS 271 D++AK + + K +FEA FI ++G VNL + Sbjct: 175 GKGLFDKEGKVKENELDVLAK---NVDINKVIFEAPQKSQQVAFILKFGSSVNLANIAFD 231 Query: 272 QVMDLEC----LRGRNLGK 286 +V+ LE LRG GK Sbjct: 232 EVISLETLRRGLRGDTFGK 250

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 1e-73
1u83_A276 Phosphosulfolactate synthase; structural genomics, 2e-63
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Length = 251 Back     alignment and structure
 Score =  225 bits (575), Expect = 1e-73
 Identities = 52/283 (18%), Positives = 106/283 (37%), Gaps = 49/283 (17%)

Query: 16  DRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEV 75
           +   +  + G+T +             +ED  +  G ++D +KF  G+ +++ +  ++E 
Sbjct: 5   EFLYEDFQRGLTVVLDKGLPPKF----VEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEK 60

Query: 76  VKRAHQHDVYVST-GDWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLR 134
           +       + V   G   E+    G   F E++ +C+++GF+ +E++ GS +I  E    
Sbjct: 61  INYYKDWGIKVYPGGTLFEYAYSKG--KFDEFLNECEKLGFEAVEISDGSSDISLEERNN 118

Query: 135 YVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVG 194
            ++  K  G     +        D     D                              
Sbjct: 119 AIKRAKDNGFMVLTEVGKKMPDKDKQLTIDDR---------------------------- 150

Query: 195 INKSRRAERCLEAGADMIMIDSDD------VCKHADSLRADIIAKVIGRLGLEKTMFEAT 248
               +     L+AGAD ++I+  +      +      ++ + +  +   + + K +FEA 
Sbjct: 151 ---IKLINFDLDAGADYVIIEGRESGKGKGLFDKEGKVKENELDVLAKNVDINKVIFEAP 207

Query: 249 NPRTSEWFIRRYGPKVNLF-VDHSQVMDLECLR----GRNLGK 286
                  FI ++G  VNL  +   +V+ LE LR    G   GK
Sbjct: 208 QKSQQVAFILKFGSSVNLANIAFDEVISLETLRRGLRGDTFGK 250


>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 100.0
1u83_A276 Phosphosulfolactate synthase; structural genomics, 100.0
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 96.1
3lmz_A257 Putative sugar isomerase; structural genomics, joi 95.93
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 95.61
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 95.58
3qc0_A275 Sugar isomerase; TIM barrel, structural genomics, 95.54
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 95.44
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 95.39
3cqj_A295 L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barre 95.26
1yx1_A264 Hypothetical protein PA2260; structural genomics, 95.21
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 95.19
3ble_A337 Citramalate synthase from leptospira interrogans; 94.95
2q02_A272 Putative cytoplasmic protein; structural genomics, 94.93
1olt_A 457 Oxygen-independent coproporphyrinogen III oxidase; 94.82
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 94.63
3kws_A287 Putative sugar isomerase; structural genomics, joi 94.61
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 94.27
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 94.14
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 94.05
2x7v_A287 Probable endonuclease 4; DNA repair protein, metal 93.89
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 93.84
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 93.84
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 93.83
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 93.79
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 93.57
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 93.47
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 93.32
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 93.25
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 93.04
3aal_A303 Probable endonuclease 4; endoiv, DNA repair, base 93.03
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 92.99
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 92.74
3tha_A252 Tryptophan synthase alpha chain; structural genomi 92.65
3aam_A270 Endonuclease IV, endoiv; DNA repair, base excision 92.56
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 92.5
2zvr_A290 Uncharacterized protein TM_0416; hyperthermophIle, 92.43
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 92.37
3vni_A294 Xylose isomerase domain protein TIM barrel; D-psic 92.33
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 92.21
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 92.11
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 92.06
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 92.03
1qtw_A285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 91.93
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 91.88
2g0w_A296 LMO2234 protein; putative sugar isomerase, structu 91.85
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 91.82
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 91.81
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 91.79
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 91.77
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 91.53
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 91.45
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 91.33
3ngf_A269 AP endonuclease, family 2; structural genomics, se 91.3
3obe_A305 Sugar phosphate isomerase/epimerase; structural ge 91.23
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 91.16
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 91.14
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 91.1
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 90.98
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 90.79
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 90.72
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 90.64
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 90.64
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 90.43
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 90.21
3lmz_A257 Putative sugar isomerase; structural genomics, joi 90.16
2qul_A290 D-tagatose 3-epimerase; beta/alpha barrel, isomera 89.98
2qw5_A335 Xylose isomerase-like TIM barrel; putative sugar p 89.95
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 89.81
1i60_A278 IOLI protein; beta barrel, structural genomics, PS 89.71
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 89.49
3ktc_A 333 Xylose isomerase; putative sugar isomerase, struct 89.48
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 89.42
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 89.33
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 89.33
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 89.32
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 89.1
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 89.0
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 88.98
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 88.97
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 88.94
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 88.94
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 88.88
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 88.85
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 88.52
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 88.32
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 88.17
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 87.55
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 87.53
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 87.47
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 87.21
3dx5_A286 Uncharacterized protein ASBF; beta-alpha barrel, p 87.19
3kws_A287 Putative sugar isomerase; structural genomics, joi 87.09
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 87.07
1hjs_A 332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 87.04
3u0h_A281 Xylose isomerase domain protein; structural genomi 87.01
3ble_A337 Citramalate synthase from leptospira interrogans; 86.95
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 86.92
2r91_A 286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 86.88
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 86.84
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 86.64
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 86.57
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 86.45
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 86.4
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 86.38
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 86.34
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 86.1
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 86.03
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 86.03
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 86.03
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 85.95
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 85.87
2zds_A 340 Putative DNA-binding protein; TIM-barrel fold, str 85.85
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 85.72
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 85.69
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 85.66
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 85.66
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 85.51
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 85.44
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 85.36
2nuw_A 288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 85.2
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 85.14
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 85.12
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 85.08
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 84.97
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 84.9
3tva_A290 Xylose isomerase domain protein TIM barrel; struct 84.72
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 84.6
3cny_A301 Inositol catabolism protein IOLE; xylose isomerase 84.57
1w3i_A 293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 84.54
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 84.53
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 84.5
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 84.37
2vtf_A 626 Endo-beta-N-acetylglucosaminidase; hydrolase, fami 84.36
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 84.24
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 84.12
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 83.7
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 83.69
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 83.58
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 83.44
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 83.43
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 83.24
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 83.19
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 83.13
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 83.05
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 82.84
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 82.7
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 82.69
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 82.62
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 82.57
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet 82.24
2hk0_A309 D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00 81.95
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 81.9
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 81.76
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 81.63
4dpp_A 360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 81.61
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 81.53
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 81.4
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 81.39
2ztj_A 382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 81.11
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 81.05
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 81.0
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 80.85
1xim_A 393 D-xylose isomerase; isomerase(intramolecular oxido 80.82
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 80.64
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 80.38
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 80.35
3l23_A303 Sugar phosphate isomerase/epimerase; structural ge 80.33
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
Probab=100.00  E-value=5.3e-92  Score=648.52  Aligned_cols=233  Identities=21%  Similarity=0.391  Sum_probs=222.1

Q ss_pred             CCCCCCCceeEecCCCCCCcchhHHHHHHHhhcccccEEEeeCcccccCChhHHHHHHHHHHhCCceecCC-cHHHHHHH
Q 022296           19 EKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVSTG-DWAEHLIR   97 (299)
Q Consensus        19 ~KPR~~GlT~V~DkGl~~~~g~~~l~DlLe~ag~yID~lKfg~GTs~l~p~~~l~eKI~l~~~~gV~v~~G-tlfE~a~~   97 (299)
                      +|||++|+|||+|||+    |+++++|+|++||+|||++|||||||+|||++.|++||++||+|||+|||| ||||+|+.
T Consensus         8 ~KPR~~GlT~v~dkgl----g~~~~~d~Le~~g~yID~lKfg~Gt~~l~~~~~l~eki~l~~~~gV~v~~GGTl~E~~~~   83 (251)
T 1qwg_A            8 YEDFQRGLTVVLDKGL----PPKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKDWGIKVYPGGTLFEYAYS   83 (251)
T ss_dssp             CCCCCCCCEEEEESSC----CHHHHHHHHHHHGGGCSEEEECTTGGGGSCHHHHHHHHHHHHTTTCEEEECHHHHHHHHH
T ss_pred             CCCcccCeeEEecCCC----CHHHHHHHHHHhhhhcceEEecCceeeecCHHHHHHHHHHHHHcCCeEECCcHHHHHHHH
Confidence            9999999999999998    888999999999999999999999999999999999999999999999998 59999999


Q ss_pred             hCCchHHHHHHHHHHcCCCEEEecCCcccCChhHHHHHHHHHHHcCCcccceeeeecCCCCCCCcccccccccccCCCCc
Q 022296           98 NGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRS  177 (299)
Q Consensus        98 qg~~~~~~yl~~~k~lGF~~IEISdGti~i~~~~r~~lI~~~~~~G~~v~~E~gvK~~~sevg~~~d~~~~~~~~~~~~~  177 (299)
                      ||  ++++|+++||++||++|||||||++||+++|+++|+++++.||+|+||+|+|++..      +             
T Consensus        84 qg--~~~~yl~~~k~lGf~~iEiS~G~i~l~~~~~~~~I~~~~~~G~~v~~EvG~k~~~~------~-------------  142 (251)
T 1qwg_A           84 KG--KFDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKRAKDNGFMVLTEVGKKMPDK------D-------------  142 (251)
T ss_dssp             TT--CHHHHHHHHHHHTCCEEEECCSSSCCCHHHHHHHHHHHHHTTCEEEEEECCSSHHH------H-------------
T ss_pred             cC--cHHHHHHHHHHcCCCEEEECCCcccCCHHHHHHHHHHHHHCCCEEeeeccccCCcc------c-------------
Confidence            99  99999999999999999999999999999999999999999999999999986621      1             


Q ss_pred             cchhcccCCCccchhhhhhhHHHHHHHHHccCcEEEEecc------ccccCCCcccHHHHHHHHhccCCCceEEecCCch
Q 022296          178 TDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSD------DVCKHADSLRADIIAKVIGRLGLEKTMFEATNPR  251 (299)
Q Consensus       178 ~~~~~~~~~~~~~~~~~~~~i~~~~~dLeAGA~~VIiEar------gi~d~~G~~r~d~i~~ii~~l~~eklifEAP~k~  251 (299)
                               ..++++++   |+++++||+|||++||||||      |||+++|+||+|++++|++++|++|||||||+|+
T Consensus       143 ---------~~~~~~~~---I~~~~~~LeAGA~~ViiEarEsG~~iGi~~~~g~~r~d~v~~i~~~l~~eklifEAp~k~  210 (251)
T 1qwg_A          143 ---------KQLTIDDR---IKLINFDLDAGADYVIIEGRESGKGKGLFDKEGKVKENELDVLAKNVDINKVIFEAPQKS  210 (251)
T ss_dssp             ---------TTCCHHHH---HHHHHHHHHHTCSEEEECCTTTCCSSTTBCTTSCBCHHHHHHHHTTSCGGGEEEECCSHH
T ss_pred             ---------CCCCHHHH---HHHHHHHHHCCCcEEEEeeecccCCcccCCCCCCCcHHHHHHHHHhCChhhEEEECCChH
Confidence                     01348888   99999999999999999998      9999999999999999999999999999999999


Q ss_pred             hHHHHHHHhCCCcccc-cCCCCchhhhhhhcccCCCcc
Q 022296          252 TSEWFIRRYGPKVNLF-VDHSQVMDLECLRGRNLGKSH  288 (299)
Q Consensus       252 qQ~~fI~~fG~~VNLg-I~~~eVi~LE~LR~~~~G~~~  288 (299)
                      ||+|||++|||||||| |+|+||++|||||+|+||.+.
T Consensus       211 qq~~fI~~fG~~VNLgNI~~~eVi~LE~LR~GLrgDT~  248 (251)
T 1qwg_A          211 QQVAFILKFGSSVNLANIAFDEVISLETLRRGLRGDTF  248 (251)
T ss_dssp             HHHHHHHHHCTTCCEEEEEGGGHHHHHHHHHTCSGGGT
T ss_pred             HHHHHHHHhCCCccccCCCHHHHHHHHHHHcccccccc
Confidence            9999999999999998 999999999999999988654



>1u83_A Phosphosulfolactate synthase; structural genomics, phosphosulfolactate PSI, protein structure initiative, midwest center for struc genomics; 2.20A {Bacillus subtilis} SCOP: c.1.27.1 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>3qc0_A Sugar isomerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-biology,; HET: UNL PG4; 1.45A {Sinorhizobium meliloti} PDB: 3ju2_A Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3cqj_A L-ribulose-5-phosphate 3-epimerase ULAE; TIM-barrel, isomerase, phosphate-binding motif; 2.04A {Escherichia coli} PDB: 3cqi_A 3cqh_A 3cqk_A Back     alignment and structure
>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} SCOP: c.1.15.7 Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>2q02_A Putative cytoplasmic protein; structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.40A {Salmonella typhimurium LT2} SCOP: c.1.15.4 Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3aal_A Probable endonuclease 4; endoiv, DNA repair, base excision repair, TIM barrel, DNA DA endonuclease, hydrolase, metal-binding; 1.60A {Geobacillus kaustophilus} PDB: 1xp3_A Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3aam_A Endonuclease IV, endoiv; DNA repair, base excision repair, BER, TIM barrel, endonucle hydrolase, structural genomics, NPPSFA; 1.58A {Thermus thermophilus} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3-epimeras tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3vni_A Xylose isomerase domain protein TIM barrel; D-psicose 3-epimerase, ketohexose; 1.98A {Clostridium cellulolyticum} PDB: 3vnj_A* 3vnl_A* 3vnk_A* 3vnm_A* Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2g0w_A LMO2234 protein; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE PG4; 1.70A {Listeria monocytogenes} SCOP: c.1.15.4 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3ngf_A AP endonuclease, family 2; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 1.80A {Brucella melitensis biovar abortus} SCOP: c.1.15.0 Back     alignment and structure
>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>2qul_A D-tagatose 3-epimerase; beta/alpha barrel, isomerase; 1.79A {Pseudomonas cichorii} PDB: 2ou4_A 2qum_A* 2qun_A* Back     alignment and structure
>2qw5_A Xylose isomerase-like TIM barrel; putative sugar phosphate isomerase/epimerase; 1.78A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3ktc_A Xylose isomerase; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.54A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3dx5_A Uncharacterized protein ASBF; beta-alpha barrel, petrobactin synthesis, ASB locus, structu genomics, PSI-2, protein structure initiative; HET: MSE DHB TRS; 2.12A {Bacillus anthracis} Back     alignment and structure
>3kws_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 1.68A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>3u0h_A Xylose isomerase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2zds_A Putative DNA-binding protein; TIM-barrel fold, structural genomics, NPPSFA; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3cny_A Inositol catabolism protein IOLE; xylose isomerase-like TIM barrel, structural genomics, joint for structural genomics, JCSG; 1.85A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>2hk0_A D-psicose 3-epimerase; TIM-barrel, isomerase; 2.00A {Agrobacterium tumefaciens} PDB: 2hk1_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1xim_A D-xylose isomerase; isomerase(intramolecular oxidoreductse); HET: XYL; 2.20A {Actinoplanes missouriensis} SCOP: c.1.15.3 PDB: 4xim_A 5xim_A* 6xim_A* 7xim_A 8xim_A* 9xim_A* 3xin_A 2xim_A* 5xin_A* 1xin_A* 1bhw_A* 2xin_A* 3xim_A* Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 299
d1qwga_251 c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase 1e-70
d1u83a_249 c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase 9e-63
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (2r)-phospho-3-sulfolactate synthase ComA
family: (2r)-phospho-3-sulfolactate synthase ComA
domain: (2r)-phospho-3-sulfolactate synthase ComA
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  216 bits (552), Expect = 1e-70
 Identities = 49/269 (18%), Positives = 102/269 (37%), Gaps = 45/269 (16%)

Query: 20  KPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRA 79
           +  + G+T +             +ED  +  G ++D +KF  G+ +++ +  ++E +   
Sbjct: 9   EDFQRGLTVVLDKGLPPKF----VEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYY 64

Query: 80  HQHDVYVSTG-DWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRL 138
               + V  G    E+    G   F E++ +C+++GF+ +E++ GS +I  E     ++ 
Sbjct: 65  KDWGIKVYPGGTLFEYAYSKGK--FDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKR 122

Query: 139 VKSAGLKAKPKFAVMFNKSDIPSDRDRAFGAYVARAPRSTDKLFLASNPEIEVGVGINKS 198
            K  G     +        D     D                                  
Sbjct: 123 AKDNGFMVLTEVGKKMPDKDKQLTIDDRI------------------------------- 151

Query: 199 RRAERCLEAGADMIMIDSDD------VCKHADSLRADIIAKVIGRLGLEKTMFEATNPRT 252
           +     L+AGAD ++I+  +      +      ++ + +  +   + + K +FEA     
Sbjct: 152 KLINFDLDAGADYVIIEGRESGKGKGLFDKEGKVKENELDVLAKNVDINKVIFEAPQKSQ 211

Query: 253 SEWFIRRYGPKVNLF-VDHSQVMDLECLR 280
              FI ++G  VNL  +   +V+ LE LR
Sbjct: 212 QVAFILKFGSSVNLANIAFDEVISLETLR 240


>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} Length = 249 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 100.0
d1u83a_249 (2r)-phospho-3-sulfolactate synthase ComA {Bacillu 100.0
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 96.97
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 95.81
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 94.8
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 94.22
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 94.2
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 93.55
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 93.2
d1f74a_ 293 N-acetylneuraminate lyase {Haemophilus influenzae 92.79
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 92.47
d1qtwa_285 Endonuclease IV {Escherichia coli [TaxId: 562]} 91.52
d1dqwa_267 Orotidine 5'-monophosphate decarboxylase (OMP deca 91.11
d1olta_ 441 Oxygen-independent coproporphyrinogen III oxidase 90.76
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 90.51
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 90.51
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 89.1
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 88.69
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 88.62
d1i60a_278 Hypothetical protein IolI {Bacillus subtilis [TaxI 88.61
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 88.29
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 87.82
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 87.35
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 87.29
d1i60a_278 Hypothetical protein IolI {Bacillus subtilis [TaxI 87.11
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 86.09
d1hjsa_ 332 Beta-1,4-galactanase {Thielavia heterothallica, ak 86.08
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 85.83
d1zzma1259 Putative deoxyribonuclease YjjV {Escherichia coli 85.62
d1j6oa_260 Hypothetical protein TM0667 {Thermotoga maritima [ 85.57
d2g0wa1275 Hypothetical protein Lmo2234 {Listeria monocytogen 85.34
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 85.18
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 84.8
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 84.49
d1k77a_260 Hypothetical protein YgbM (EC1530) {Escherichia co 84.39
d1mxga2 361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 84.16
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 83.62
d1xwya1260 Deoxyribonuclease TatD (MttC) {Escherichia coli [T 83.58
d1yixa1265 Putative deoxyribonuclease YcfH {Escherichia coli 83.46
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 83.27
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 83.22
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 82.91
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 82.32
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 82.28
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 82.01
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 81.92
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 81.64
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 81.64
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 81.34
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 80.5
d1w3ia_ 293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 80.35
d1rh9a1 370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 80.35
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 80.18
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (2r)-phospho-3-sulfolactate synthase ComA
family: (2r)-phospho-3-sulfolactate synthase ComA
domain: (2r)-phospho-3-sulfolactate synthase ComA
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Probab=100.00  E-value=5.6e-87  Score=613.94  Aligned_cols=240  Identities=21%  Similarity=0.393  Sum_probs=224.0

Q ss_pred             ccCCCCCCCCCCCCCCCceeEecCCCCCCcchhHHHHHHHhhcccccEEEeeCcccccCChhHHHHHHHHHHhCCceecC
Q 022296            9 KSFDEYEDRAEKPRRFGVTEMRSPHYTLSSSHNVLEDIFESMGQFVDGLKFSGGSHSLMPKPFIEEVVKRAHQHDVYVST   88 (299)
Q Consensus         9 ~~f~~~~~R~~KPR~~GlT~V~DkGl~~~~g~~~l~DlLe~ag~yID~lKfg~GTs~l~p~~~l~eKI~l~~~~gV~v~~   88 (299)
                      +.|.-+.    |||++|||||+|||+    |+++++|+|++||+|||++||||||++|||++.|++||++||+|||+|||
T Consensus         2 ~~~~fl~----~~~~~GlTmv~DkGl----gl~~leD~Le~ag~yID~~K~g~Gt~~l~p~~~l~eKI~l~~~~~V~v~~   73 (251)
T d1qwga_           2 KAFEFLY----EDFQRGLTVVLDKGL----PPKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKDWGIKVYP   73 (251)
T ss_dssp             CTTGGGC----CCCCCCCEEEEESSC----CHHHHHHHHHHHGGGCSEEEECTTGGGGSCHHHHHHHHHHHHTTTCEEEE
T ss_pred             chhhhhc----CCccCCcEEEeeCCC----CHHHHHHHHHhhhhheeEEEecCceeeecCHHHHHHHHHHHHHcCCeEeC
Confidence            4454443    999999999999999    78899999999999999999999999999999999999999999999999


Q ss_pred             C-cHHHHHHHhCCchHHHHHHHHHHcCCCEEEecCCcccCChhHHHHHHHHHHHcCCcccceeeeecCCCCCCCcccccc
Q 022296           89 G-DWAEHLIRNGPSAFKEYVEDCKQVGFDTIELNVGSLEIPEETLLRYVRLVKSAGLKAKPKFAVMFNKSDIPSDRDRAF  167 (299)
Q Consensus        89 G-tlfE~a~~qg~~~~~~yl~~~k~lGF~~IEISdGti~i~~~~r~~lI~~~~~~G~~v~~E~gvK~~~sevg~~~d~~~  167 (299)
                      | ||||+|+.||  ++++|+++|++|||++|||||||++||+++|+++|++++++||+|+||+|+|++.++         
T Consensus        74 GGtlfE~a~~qg--~~~~y~~~~~~lGf~~iEiSdg~~~i~~~~~~~~I~~~~~~G~~V~~EvG~K~~~~~---------  142 (251)
T d1qwga_          74 GGTLFEYAYSKG--KFDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKRAKDNGFMVLTEVGKKMPDKD---------  142 (251)
T ss_dssp             CHHHHHHHHHTT--CHHHHHHHHHHHTCCEEEECCSSSCCCHHHHHHHHHHHHHTTCEEEEEECCSSHHHH---------
T ss_pred             CcHHHHHHHHcC--CHHHHHHHHHHcCCCEEEEcCCccCCCHHHHHHHHHHHHhCCCEEeecccCCCCCCc---------
Confidence            7 7999999999  999999999999999999999999999999999999999999999999999865321         


Q ss_pred             cccccCCCCccchhcccCCCccchhhhhhhHHHHHHHHHccCcEEEEecc------ccccCCCcccHHHHHHHHhccCCC
Q 022296          168 GAYVARAPRSTDKLFLASNPEIEVGVGINKSRRAERCLEAGADMIMIDSD------DVCKHADSLRADIIAKVIGRLGLE  241 (299)
Q Consensus       168 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~dLeAGA~~VIiEar------gi~d~~G~~r~d~i~~ii~~l~~e  241 (299)
                                         ..++++++   |+++++||+||||+||||||      |||+++|++|++++++|++++|++
T Consensus       143 -------------------~~~~~~~~---i~~~~~~LeaGA~~ViiEarEsg~~~Gi~~~~g~~r~~~i~~i~~~l~~~  200 (251)
T d1qwga_         143 -------------------KQLTIDDR---IKLINFDLDAGADYVIIEGRESGKGKGLFDKEGKVKENELDVLAKNVDIN  200 (251)
T ss_dssp             -------------------TTCCHHHH---HHHHHHHHHHTCSEEEECCTTTCCSSTTBCTTSCBCHHHHHHHHTTSCGG
T ss_pred             -------------------cccCHHHH---HHHHHHHHHCCCceeEeehhhcCCccceecCCCChhHHHHHHHHHhCCcc
Confidence                               01347888   99999999999999999987      799999999999999999999999


Q ss_pred             ceEEecCCchhHHHHHHHhCCCcccc-cCCCCchhhhhhhcccCCCccc
Q 022296          242 KTMFEATNPRTSEWFIRRYGPKVNLF-VDHSQVMDLECLRGRNLGKSHR  289 (299)
Q Consensus       242 klifEAP~k~qQ~~fI~~fG~~VNLg-I~~~eVi~LE~LR~~~~G~~~~  289 (299)
                      |+|||||+|+||+|||++|||||||| |+|+||++|||||+|++|.+..
T Consensus       201 kiifEAP~k~~q~w~I~~fGp~VNL~NI~~~~vi~LE~LR~GLrgdT~g  249 (251)
T d1qwga_         201 KVIFEAPQKSQQVAFILKFGSSVNLANIAFDEVISLETLRRGLRGDTFG  249 (251)
T ss_dssp             GEEEECCSHHHHHHHHHHHCTTCCEEEEEGGGHHHHHHHHHTCSGGGTT
T ss_pred             cEEEECCChhHHHHHHHHhCCCcccccCCHHHHhHHHHHhcCCCccccc
Confidence            99999999999999999999999999 9999999999999888875543



>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g0wa1 c.1.15.4 (A:10-284) Hypothetical protein Lmo2234 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k77a_ c.1.15.5 (A:) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure