Citrus Sinensis ID: 022342

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD
cccEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccEEEccccccccHHHHHHHHHHHHccccccccccccEEEEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccEEEcccEEEEEEccccHHHHHHHcccccccEEEEEEccccccEEEEEcccccccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEEEcHHHHHHHHHHccccEEEEEEccccccccccEEccccccccccccccc
cccEEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHcHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHcccEEEccEcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEcccEEEEEEccHHHHHHHHHccccEEEEEEEEEccccccEEEEEEccccHHHcEEEEEccEEcccHHHHHHHHHHHcccccHHHEEEEccEEcHHHHHHHHHHccccEEEEcEEccEEcccccEEcccccHHHHHHcccc
mnmkifvdtdADVRLARRIRRDTVERGRDVDSVLEQYAKFvkpafddfvlpskkyadviiprggdnhVAIDLIVQHIHTklgqhdlckiypnvyVIQSTFQIRGMHTLIrdrgiskhdfvFYSDRLIRLVVEHglghlpftekqvvtptgsmytgvdfcKKLCGVSIVRSMENALRACCKGikigkilihrdgdngkQLIYEklpndiseRHVLlldpvlatgnSANQAIQLLIEKGVPESHIIFLNlisapegihcvckrfpslkivTSEIDVALNeefrvipglgefgdryfgtdd
mnmkifvdtdadvrlarrirrdtvergrdvdsVLEQYAKFvkpafddfvlpSKKYADVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLghlpftekqvvtptgsmYTGVDFCKKLCGVSIVRSMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEfrvipglgefgdryfgtdd
MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSMENALRAcckgikigkiLIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD
****IFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYF****
MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRGGDNHVAIDLIVQHI***************VYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD*
MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD
*NMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRSMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query298 2.2.26 [Sep-21-2011]
Q9FKS0486 Uridine kinase-like prote yes no 1.0 0.613 0.930 1e-164
Q9LK34483 Uridine kinase-like prote no no 1.0 0.616 0.920 1e-162
Q8VYB2466 Uridine kinase-like prote no no 1.0 0.639 0.847 1e-154
O65583469 Uridine kinase-like prote no no 1.0 0.635 0.840 1e-150
Q9LTY6465 Uridine kinase-like prote no no 1.0 0.640 0.777 1e-141
Q91YL3548 Uridine-cytidine kinase-l yes no 0.996 0.541 0.487 2e-83
Q9NWZ5548 Uridine-cytidine kinase-l yes no 0.996 0.541 0.484 5e-83
Q55EL3499 Uridine-cytidine kinase A yes no 0.989 0.591 0.482 2e-80
Q55GQ6216 Uracil phosphoribosyltran no no 0.701 0.967 0.551 2e-63
Q26998244 Uracil phosphoribosyltran N/A no 0.714 0.872 0.511 2e-61
>sp|Q9FKS0|UKL1_ARATH Uridine kinase-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=UKL1 PE=1 SV=1 Back     alignment and function desciption
 Score =  578 bits (1489), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/301 (93%), Positives = 294/301 (97%), Gaps = 3/301 (0%)

Query: 1   MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVII 60
           MNMKIFVDTDADVRLARRIRRDTVERGRDV+SVLEQYAKFVKPAFDDFVLPSKKYADVII
Sbjct: 183 MNMKIFVDTDADVRLARRIRRDTVERGRDVNSVLEQYAKFVKPAFDDFVLPSKKYADVII 242

Query: 61  PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFV 120
           PRGGDNHVA+DLI QHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIR++ ISKHDFV
Sbjct: 243 PRGGDNHVAVDLITQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIREKDISKHDFV 302

Query: 121 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVR---SMENALRA 177
           FYSDRLIRLVVEHGLGHLPFTEKQVVTPTG++YTGVDFCKKLCGVSI+R   SMENALRA
Sbjct: 303 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGAVYTGVDFCKKLCGVSIIRSGESMENALRA 362

Query: 178 CCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKG 237
           CCKGIKIGKILIHRDGDNGKQLIYEKLP+DISERHVLLLDPVLATGNSANQAI+LLI+KG
Sbjct: 363 CCKGIKIGKILIHRDGDNGKQLIYEKLPHDISERHVLLLDPVLATGNSANQAIELLIQKG 422

Query: 238 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 297
           VPE+HIIFLNLISAPEGIHCVCKRFP+LKIVTSEID  LN+EFRVIPGLGEFGDRYFGTD
Sbjct: 423 VPEAHIIFLNLISAPEGIHCVCKRFPALKIVTSEIDQCLNQEFRVIPGLGEFGDRYFGTD 482

Query: 298 D 298
           +
Sbjct: 483 E 483
Involved in the pyrimidine salvage pathway. The uracil phosphoribosyltransferase (UPRT) activity, that catalyzes the conversion of uracil and 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to UMP and diphosphate, is unsure.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 9
>sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VYB2|UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana GN=UKL3 PE=1 SV=1 Back     alignment and function description
>sp|O65583|UKL4_ARATH Uridine kinase-like protein 4 OS=Arabidopsis thaliana GN=UKL4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 Back     alignment and function description
>sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 Back     alignment and function description
>sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 Back     alignment and function description
>sp|Q55GQ6|UPP_DICDI Uracil phosphoribosyltransferase OS=Dictyostelium discoideum GN=uprt PE=3 SV=1 Back     alignment and function description
>sp|Q26998|UPP_TOXGO Uracil phosphoribosyltransferase OS=Toxoplasma gondii GN=uprt PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
224055715 481 predicted protein [Populus trichocarpa] 1.0 0.619 0.956 1e-165
224129080 477 predicted protein [Populus trichocarpa] 1.0 0.624 0.946 1e-164
356558725 474 PREDICTED: uridine kinase-like protein 1 1.0 0.628 0.946 1e-164
359488603 482 PREDICTED: uridine kinase-like protein 1 1.0 0.618 0.950 1e-164
356571511 476 PREDICTED: uridine kinase-like protein 1 1.0 0.626 0.943 1e-164
359488605 481 PREDICTED: uridine kinase-like protein 1 1.0 0.619 0.950 1e-163
297805570 489 ATUK/UPRT1 [Arabidopsis lyrata subsp. ly 1.0 0.609 0.933 1e-163
15237512 486 putative uracil phosphoribosyltransferas 1.0 0.613 0.930 1e-162
255536937 481 Uracil phosphoribosyltransferase, putati 1.0 0.619 0.933 1e-162
15232108 483 putative uracil phosphoribosyltransferas 1.0 0.616 0.920 1e-161
>gi|224055715|ref|XP_002298617.1| predicted protein [Populus trichocarpa] gi|222845875|gb|EEE83422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 288/301 (95%), Positives = 296/301 (98%), Gaps = 3/301 (0%)

Query: 1   MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVII 60
           MNMKIFVDTDADVRLARRIRRDTVERGRD++SVLEQYAKFVKPAFDDFVLPSKKYADVII
Sbjct: 181 MNMKIFVDTDADVRLARRIRRDTVERGRDINSVLEQYAKFVKPAFDDFVLPSKKYADVII 240

Query: 61  PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFV 120
           PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNV+VIQSTFQIRGMHTLIRD+ ISKHDFV
Sbjct: 241 PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVHVIQSTFQIRGMHTLIRDKEISKHDFV 300

Query: 121 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVR---SMENALRA 177
           FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGS+YTGVDFCKKLCGVSIVR   SMENALRA
Sbjct: 301 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSVYTGVDFCKKLCGVSIVRSGESMENALRA 360

Query: 178 CCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKG 237
           CCKGIKIGKILIHRDGDNGKQLIYEKLP DISERHVLLLDPVLATGNSANQAI+LLI+KG
Sbjct: 361 CCKGIKIGKILIHRDGDNGKQLIYEKLPKDISERHVLLLDPVLATGNSANQAIELLIQKG 420

Query: 238 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 297
           VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPG+GEFGDRYFGTD
Sbjct: 421 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGTD 480

Query: 298 D 298
           D
Sbjct: 481 D 481

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224129080|ref|XP_002328885.1| predicted protein [Populus trichocarpa] gi|222839315|gb|EEE77652.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356558725|ref|XP_003547653.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|359488603|ref|XP_003633787.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356571511|ref|XP_003553920.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|359488605|ref|XP_003633788.1| PREDICTED: uridine kinase-like protein 1, chloroplastic-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297805570|ref|XP_002870669.1| ATUK/UPRT1 [Arabidopsis lyrata subsp. lyrata] gi|297316505|gb|EFH46928.1| ATUK/UPRT1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15237512|ref|NP_198903.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|75333998|sp|Q9FKS0.1|UKL1_ARATH RecName: Full=Uridine kinase-like protein 1, chloroplastic; Includes: RecName: Full=Uridine kinase; Short=UK; Includes: RecName: Full=Putative uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase; Flags: Precursor gi|10177966|dbj|BAB11349.1| uridine kinase-like protein [Arabidopsis thaliana] gi|26983834|gb|AAN86169.1| putative uridine kinase [Arabidopsis thaliana] gi|29465725|gb|AAM10488.1| uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|332007227|gb|AED94610.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255536937|ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] gi|223549434|gb|EEF50922.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15232108|ref|NP_189355.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|75335099|sp|Q9LK34.1|UKL2_ARATH RecName: Full=Uridine kinase-like protein 2, chloroplastic; Includes: RecName: Full=Uridine kinase; Short=UK; Includes: RecName: Full=Putative uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase; Flags: Precursor gi|9294212|dbj|BAB02114.1| uridine kinase-like protein [Arabidopsis thaliana] gi|38564268|gb|AAR23713.1| At3g27190 [Arabidopsis thaliana] gi|51969226|dbj|BAD43305.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|332643756|gb|AEE77277.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query298
TAIR|locus:2164516486 UK/UPRT1 "AT5G40870" [Arabidop 1.0 0.613 0.897 7.5e-144
TAIR|locus:2086523483 UKL2 "AT3G27190" [Arabidopsis 1.0 0.616 0.887 1.1e-142
TAIR|locus:2012125466 UKL3 "AT1G55810" [Arabidopsis 1.0 0.639 0.813 1.1e-133
TAIR|locus:2131498469 UKL4 "AT4G26510" [Arabidopsis 1.0 0.635 0.807 1.9e-131
TAIR|locus:2086691465 UKL5 "AT3G27440" [Arabidopsis 1.0 0.640 0.747 3.6e-121
DICTYBASE|DDB_G0269034499 udkA "uridine kinase" [Dictyos 0.989 0.591 0.463 1e-68
DICTYBASE|DDB_G0267560216 uprt "uracil phosphoribosyltra 0.701 0.967 0.514 4.3e-54
ASPGD|ASPL0000077951249 AN8869 [Emericella nidulans (t 0.687 0.823 0.502 1.4e-48
POMBASE|SPAC1B3.01c219 SPAC1B3.01c "uracil phosphorib 0.687 0.936 0.483 5.4e-47
SGD|S000001170216 FUR1 "Uracil phosphoribosyltra 0.684 0.944 0.495 5.4e-47
TAIR|locus:2164516 UK/UPRT1 "AT5G40870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1406 (500.0 bits), Expect = 7.5e-144, P = 7.5e-144
 Identities = 270/301 (89%), Positives = 284/301 (94%)

Query:     1 MNMKIFVDTDADVRLARRIRRDTVERGRDVDSVLEQYAKFVKPAFDDFVLPSKKYADVII 60
             MNMKIFVDTDADVRLARRIRRDTVERGRDV+SVLEQYAKFVKPAFDDFVLPSKKYADVII
Sbjct:   183 MNMKIFVDTDADVRLARRIRRDTVERGRDVNSVLEQYAKFVKPAFDDFVLPSKKYADVII 242

Query:    61 PRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFV 120
             PRGGDNHVA+DLI QHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIR++ ISKHDFV
Sbjct:   243 PRGGDNHVAVDLITQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIREKDISKHDFV 302

Query:   121 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRS---MENALRA 177
             FYSDRLIRLVVEHGLGHLPFTEKQVVTPTG++YTGVDFCKKLCGVSI+RS   MENALRA
Sbjct:   303 FYSDRLIRLVVEHGLGHLPFTEKQVVTPTGAVYTGVDFCKKLCGVSIIRSGESMENALRA 362

Query:   178 XXXXXXXXXXLIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKG 237
                       LIHRDGDNGKQLIYEKLP+DISERHVLLLDPVLATGNSANQAI+LLI+KG
Sbjct:   363 CCKGIKIGKILIHRDGDNGKQLIYEKLPHDISERHVLLLDPVLATGNSANQAIELLIQKG 422

Query:   238 VPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 297
             VPE+HIIFLNLISAPEGIHCVCKRFP+LKIVTSEID  LN+EFRVIPGLGEFGDRYFGTD
Sbjct:   423 VPEAHIIFLNLISAPEGIHCVCKRFPALKIVTSEIDQCLNQEFRVIPGLGEFGDRYFGTD 482

Query:   298 D 298
             +
Sbjct:   483 E 483
GO:0004845 "uracil phosphoribosyltransferase activity" evidence=IGI;ISS;IDA
GO:0005524 "ATP binding" evidence=ISS
GO:0009058 "biosynthetic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016301 "kinase activity" evidence=ISS
GO:0004849 "uridine kinase activity" evidence=IGI;IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0016310 "phosphorylation" evidence=IDA
GO:0044206 "UMP salvage" evidence=IDA
GO:2000904 "regulation of starch metabolic process" evidence=IMP
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0010050 "vegetative phase change" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2086523 UKL2 "AT3G27190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012125 UKL3 "AT1G55810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131498 UKL4 "AT4G26510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086691 UKL5 "AT3G27440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269034 udkA "uridine kinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267560 uprt "uracil phosphoribosyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000077951 AN8869 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPAC1B3.01c SPAC1B3.01c "uracil phosphoribosyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000001170 FUR1 "Uracil phosphoribosyltransferase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKS0UKL1_ARATH2, ., 4, ., 2, ., 90.93021.00.6131yesno
O13867UPP1_SCHPO2, ., 4, ., 2, ., 90.51190.68790.9360yesno
P18562UPP_YEAST2, ., 4, ., 2, ., 90.51670.68790.9490yesno
Q9LK34UKL2_ARATH2, ., 4, ., 2, ., 90.92021.00.6169nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.4.2.90.824
3rd Layer2.4.20.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_I2295
hypothetical protein (481 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_700026
hypothetical protein (250 aa)
     •• 0.907
grail3.0074007001
hypothetical protein (475 aa)
     •• 0.907
estExt_Genewise1_v1.C_LG_I7094
SubName- Full=Putative uncharacterized protein; (475 aa)
     •• 0.906
gw1.XV.2929.1
adenylate kinase family protein (EC-2.7.4.14) (224 aa)
     •  0.899
gw1.VI.1035.1
cytidine deaminase (EC-3.5.4.5) (290 aa)
     •  0.899
grail3.0996000101
cytidine deaminase (EC-3.5.4.5) (292 aa)
     •  0.899
grail3.0145001501
cytidine deaminase (EC-3.5.4.5) (292 aa)
     •  0.899
fgenesh4_pg.C_LG_VIII000753
hypothetical protein (536 aa)
     •  0.899
eugene3.00031452
hypothetical protein (211 aa)
     •  0.899
eugene3.00021246
SubName- Full=Putative uncharacterized protein; (200 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
COG0035210 COG0035, Upp, Uracil phosphoribosyltransferase [Nu 4e-60
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 2e-47
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 9e-41
TIGR01091207 TIGR01091, upp, uracil phosphoribosyltransferase 3e-36
TIGR00235207 TIGR00235, udk, uridine kinase 2e-34
PRK00129209 PRK00129, upp, uracil phosphoribosyltransferase; R 2e-34
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 3e-32
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 4e-21
PLN02541244 PLN02541, PLN02541, uracil phosphoribosyltransfera 5e-19
PTZ00301210 PTZ00301, PTZ00301, uridine kinase; Provisional 4e-14
PLN02348395 PLN02348, PLN02348, phosphoribulokinase 2e-08
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 2e-08
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 6e-08
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 6e-07
PRK08233182 PRK08233, PRK08233, hypothetical protein; Provisio 3e-06
>gnl|CDD|223113 COG0035, Upp, Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information 
 Score =  190 bits (484), Expect = 4e-60
 Identities = 84/211 (39%), Positives = 121/211 (57%), Gaps = 8/211 (3%)

Query: 92  NVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGS 151
           NVYVI     ++   T++RD+     +F    D + RL+       LP  + ++ TP G 
Sbjct: 3   NVYVIDHP-LVKHKLTILRDKNTGTKEFRELLDEIGRLLAYEATRDLPLEKVEIETPLGP 61

Query: 152 MYTGVDFC-KKLCGVSIVRS---MENALRACCKGIKIGKILIHRDGDNGK-QLIYEKLPN 206
              GV    KK+  V I+R+   M   L       ++G I I+RD +  +  L YEKLP 
Sbjct: 62  T-EGVQIAGKKIVIVPILRAGLGMVEGLLKLIPSARVGHIGIYRDEETLEPVLYYEKLPE 120

Query: 207 DISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLK 266
           DI ER V++LDP+LATG SA  AI LL ++G P+ +I  ++L++APEGI  V K  P ++
Sbjct: 121 DIDERTVIVLDPMLATGGSAIAAIDLLKKRGGPK-NIKVVSLVAAPEGIKAVEKAHPDVE 179

Query: 267 IVTSEIDVALNEEFRVIPGLGEFGDRYFGTD 297
           I T+ ID  LNE+  ++PGLG+ GDR FGT 
Sbjct: 180 IYTAAIDEGLNEKGYIVPGLGDAGDRLFGTK 210

Length = 210
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|130163 TIGR01091, upp, uracil phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|234653 PRK00129, upp, uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|215297 PLN02541, PLN02541, uracil phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|181310 PRK08233, PRK08233, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 298
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide t 100.0
PF14681207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 100.0
PLN02541244 uracil phosphoribosyltransferase 100.0
TIGR01091207 upp uracil phosphoribosyltransferase. that include 100.0
PRK00129209 upp uracil phosphoribosyltransferase; Reviewed 100.0
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 100.0
KOG1017267 consensus Predicted uracil phosphoribosyltransfera 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 99.85
PTZ00301210 uridine kinase; Provisional 99.74
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.61
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.61
PLN02318 656 phosphoribulokinase/uridine kinase 99.59
PRK15453290 phosphoribulokinase; Provisional 99.54
PRK05480209 uridine/cytidine kinase; Provisional 99.41
PLN02369302 ribose-phosphate pyrophosphokinase 99.37
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.33
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.32
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.27
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 99.17
PLN02348395 phosphoribulokinase 99.16
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.14
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 99.1
COG1926220 Predicted phosphoribosyltransferases [General func 99.04
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.04
PRK05205176 bifunctional pyrimidine regulatory protein PyrR ur 98.97
PRK07429327 phosphoribulokinase; Provisional 98.95
PRK02812330 ribose-phosphate pyrophosphokinase; Provisional 98.86
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 98.84
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 98.79
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 98.75
PRK05439311 pantothenate kinase; Provisional 98.73
TIGR01251308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 98.72
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucle 98.65
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 98.62
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.51
PRK15423178 hypoxanthine phosphoribosyltransferase; Provisiona 98.5
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.47
PRK06696223 uridine kinase; Validated 98.47
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 98.45
PF14572184 Pribosyl_synth: Phosphoribosyl synthetase-associat 98.39
PRK02269320 ribose-phosphate pyrophosphokinase; Provisional 98.38
PRK08233182 hypothetical protein; Provisional 98.37
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.36
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.36
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil 98.34
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 98.27
PTZ00149241 hypoxanthine phosphoribosyltransferase; Provisiona 98.26
PRK00553332 ribose-phosphate pyrophosphokinase; Provisional 98.24
PLN02238189 hypoxanthine phosphoribosyltransferase 98.22
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 98.19
PTZ00145439 phosphoribosylpyrophosphate synthetase; Provisiona 98.18
PRK09270229 nucleoside triphosphate hydrolase domain-containin 98.18
PLN02297326 ribose-phosphate pyrophosphokinase 98.07
PRK02304175 adenine phosphoribosyltransferase; Provisional 98.05
PLN02293187 adenine phosphoribosyltransferase 97.98
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase 97.87
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 97.85
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 97.83
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 97.78
PRK13811170 orotate phosphoribosyltransferase; Provisional 97.69
KOG1448316 consensus Ribose-phosphate pyrophosphokinase [Nucl 97.67
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 97.66
PRK12560187 adenine phosphoribosyltransferase; Provisional 97.62
PRK07322178 adenine phosphoribosyltransferase; Provisional 97.6
PRK13812176 orotate phosphoribosyltransferase; Provisional 97.56
TIGR00201190 comF comF family protein. This protein is found in 97.55
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 97.54
PRK05793469 amidophosphoribosyltransferase; Provisional 97.53
PRK08525445 amidophosphoribosyltransferase; Provisional 97.48
KOG1712183 consensus Adenine phosphoribosyl transferases [Nuc 97.48
PRK06031233 phosphoribosyltransferase; Provisional 97.46
PRK08558238 adenine phosphoribosyltransferase; Provisional 97.44
PRK11595227 DNA utilization protein GntX; Provisional 97.43
PRK13809206 orotate phosphoribosyltransferase; Provisional 97.41
TIGR01744191 XPRTase xanthine phosphoribosyltransferase. This m 97.37
PRK13810187 orotate phosphoribosyltransferase; Provisional 97.35
PRK09219189 xanthine phosphoribosyltransferase; Validated 97.34
COG1040225 ComFC Predicted amidophosphoribosyltransferases [G 97.29
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide 97.18
PRK09246501 amidophosphoribosyltransferase; Provisional 97.1
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 97.08
PRK08341442 amidophosphoribosyltransferase; Provisional 97.08
PRK07272484 amidophosphoribosyltransferase; Provisional 96.98
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 96.96
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 96.93
PRK09123479 amidophosphoribosyltransferase; Provisional 96.88
PRK14734200 coaE dephospho-CoA kinase; Provisional 96.84
PRK14730195 coaE dephospho-CoA kinase; Provisional 96.77
PLN02440479 amidophosphoribosyltransferase 96.75
TIGR01743268 purR_Bsub pur operon repressor, Bacillus subtilis 96.7
PRK14732196 coaE dephospho-CoA kinase; Provisional 96.66
PRK07349500 amidophosphoribosyltransferase; Provisional 96.64
KOG3367216 consensus Hypoxanthine-guanine phosphoribosyltrans 96.61
COG2236192 Predicted phosphoribosyltransferases [General func 96.6
PRK09213271 pur operon repressor; Provisional 96.56
PRK07847510 amidophosphoribosyltransferase; Provisional 96.54
PRK06388474 amidophosphoribosyltransferase; Provisional 96.49
TIGR01134442 purF amidophosphoribosyltransferase. Alternate nam 96.48
PRK07631475 amidophosphoribosyltransferase; Provisional 96.44
PRK06781471 amidophosphoribosyltransferase; Provisional 96.44
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 96.42
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 96.34
PRK00023225 cmk cytidylate kinase; Provisional 96.32
TIGR00152188 dephospho-CoA kinase. This model produces scores i 95.81
PRK04182180 cytidylate kinase; Provisional 95.69
PF15609191 PRTase_2: Phosphoribosyl transferase 95.67
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 95.57
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 95.51
PRK01184184 hypothetical protein; Provisional 95.27
COG3954289 PrkB Phosphoribulokinase [Energy production and co 95.2
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotr 94.49
PLN02422232 dephospho-CoA kinase 94.46
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 94.38
PTZ00451244 dephospho-CoA kinase; Provisional 94.28
KOG0572474 consensus Glutamine phosphoribosylpyrophosphate am 94.27
PRK14731208 coaE dephospho-CoA kinase; Provisional 94.18
PRK14733204 coaE dephospho-CoA kinase; Provisional 93.92
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 93.91
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 93.85
PRK00081194 coaE dephospho-CoA kinase; Reviewed 93.61
PRK05057172 aroK shikimate kinase I; Reviewed 93.5
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 92.66
KOG1503354 consensus Phosphoribosylpyrophosphate synthetase-a 92.38
PF01712146 dNK: Deoxynucleoside kinase; InterPro: IPR002624 T 92.36
PRK00131175 aroK shikimate kinase; Reviewed 91.96
PRK13946184 shikimate kinase; Provisional 91.87
PRK13949169 shikimate kinase; Provisional 91.83
PRK08118167 topology modulation protein; Reviewed 91.61
COG0703172 AroK Shikimate kinase [Amino acid transport and me 91.57
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 91.14
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 90.53
PRK00698205 tmk thymidylate kinase; Validated 90.16
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 89.98
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 89.9
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 89.78
PRK13974212 thymidylate kinase; Provisional 89.59
PRK03731171 aroL shikimate kinase II; Reviewed 89.27
PRK04040188 adenylate kinase; Provisional 89.18
PRK00625173 shikimate kinase; Provisional 88.81
PRK13947171 shikimate kinase; Provisional 88.58
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 88.53
PF02224157 Cytidylate_kin: Cytidylate kinase; InterPro: IPR01 87.91
PRK06217183 hypothetical protein; Validated 87.79
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 87.41
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 86.84
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 86.55
PRK08154309 anaerobic benzoate catabolism transcriptional regu 85.63
PRK07261171 topology modulation protein; Provisional 85.25
PRK13975196 thymidylate kinase; Provisional 84.64
PRK07933213 thymidylate kinase; Validated 84.6
PRK13976209 thymidylate kinase; Provisional 84.03
PRK14737186 gmk guanylate kinase; Provisional 83.26
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 82.84
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 82.68
PRK06762166 hypothetical protein; Provisional 82.01
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 81.58
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 81.54
PRK13973213 thymidylate kinase; Provisional 81.11
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 80.54
PRK08356195 hypothetical protein; Provisional 80.04
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.1e-68  Score=467.70  Aligned_cols=204  Identities=41%  Similarity=0.626  Sum_probs=196.7

Q ss_pred             CceeeccchHHHHHHhHhhhcCCCChhhHHHHHHHHHHHHHHHHhCCCCCeeEEEeCCCCcceeeeeec-cceeEeeehH
Q 022342           91 PNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFC-KKLCGVSIVR  169 (298)
Q Consensus        91 ~~l~vl~~~~~l~~llt~LRd~~T~~~~Fr~~~~rl~~lL~~eal~~lp~~~~~v~tp~g~~~~g~~~~-~~i~~V~IlR  169 (298)
                      .++++++|| +++|++|+|||++|++.+||++++||++||+|||++++|+++++|+||.| +++|..+. +++|+|||||
T Consensus         2 ~~v~vi~hp-li~~~lt~lRdk~t~~~~Fr~~~~ei~~lL~yEa~~~l~~e~~~ieTP~~-~~~~~~~~~~~i~~V~ILR   79 (210)
T COG0035           2 MNVYVIDHP-LVKHKLTILRDKNTGTKEFRELLDEIGRLLAYEATRDLPLEKVEIETPLG-PTEGVQIAGKKIVIVPILR   79 (210)
T ss_pred             CceEEeCcH-HHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHhCcCceeEEEEECCCc-ceeeeeecCCcEEEEEEee
Confidence            579999996 79999999999999999999999999999999999999999999999999 68888887 4599999999


Q ss_pred             ---HHHHHHHHhccCCccceEEEEecCCCC-ceeEeccCCCCCCCcEEEEEcCcccchHHHHHHHHHHHHcCCCCccEEE
Q 022342          170 ---SMENALRACCKGIKIGKILIHRDGDNG-KQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIF  245 (298)
Q Consensus       170 ---~m~~~~~~~~p~a~~g~i~i~R~~~t~-~~~~y~klP~~i~~~~Vil~Dp~lATG~t~~~ai~~L~~~g~~~~~I~v  245 (298)
                         +|++|+++++|+|++||||+|||++|+ +..||.|||++++++.|+|+|||+|||+|+++|++.|+++| .+++|++
T Consensus        80 AGl~m~~gl~~~~P~a~vG~ig~~Rdeet~~p~~yy~KLP~~~~~~~viv~DPMLATG~s~i~ai~~L~~~G-~~~~I~~  158 (210)
T COG0035          80 AGLGMVEGLLKLIPSARVGHIGIYRDEETLEPVLYYEKLPEDIDERTVIVLDPMLATGGSAIAAIDLLKKRG-GPKNIKV  158 (210)
T ss_pred             ccccHHHHHHHhCCcceEEEEEEEecCccCceehhHHhCCCcccCCeEEEECchhhccHhHHHHHHHHHHhC-CCceEEE
Confidence               899999999999999999999999999 57899999999999999999999999999999999999997 6699999


Q ss_pred             EEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCCceeCCCCchhhhccCCC
Q 022342          246 LNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTD  297 (298)
Q Consensus       246 v~~vas~~gl~~l~~~~p~v~i~~a~id~~l~~~~~ivPGlGD~GdR~fgt~  297 (298)
                      +|++|+|+|++++.++||+|+||||+||++||++|||+|||||||||+|||+
T Consensus       159 v~~vAapeGi~~v~~~~p~v~I~ta~iD~~Lne~gYIvPGLGDaGDR~fGt~  210 (210)
T COG0035         159 VSLVAAPEGIKAVEKAHPDVEIYTAAIDEGLNEKGYIVPGLGDAGDRLFGTK  210 (210)
T ss_pred             EEEEecHHHHHHHHHhCCCCeEEEEEeccccccCCCCccCCCcccccccCCC
Confidence            9999999999999999999999999999999999999999999999999996

>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PLN02369 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK15423 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PLN02297 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG1448 consensus Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00201 comF comF family protein Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK11595 DNA utilization protein GntX; Provisional Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02440 amidophosphoribosyltransferase Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG3367 consensus Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK09213 pur operon repressor; Provisional Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF15609 PRTase_2: Phosphoribosyl transferase Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>KOG1503 consensus Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism; Nucleotide transport and metabolism] Back     alignment and domain information
>PF01712 dNK: Deoxynucleoside kinase; InterPro: IPR002624 This family consists of various deoxynucleoside kinases including cytidine (2 Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF02224 Cytidylate_kin: Cytidylate kinase; InterPro: IPR011994 Cytidylate kinase (2 Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
1upu_D224 Structure Of The Uracil Phosphoribosyltransferase, 1e-57
1bd3_D243 Structure Of The Apo Uracil Phosphoribosyltransfera 2e-57
1xrj_A261 Rapid Structure Determination Of Human Uridine-Cyti 2e-27
1udw_A252 Crystal Structure Of Human Uridine-cytidine Kinase 3e-27
2jeo_A245 Crystal Structure Of Human Uridine-Cytidine Kinase 9e-26
1i5e_A209 Crystal Structure Of Bacillus Caldolyticus Uracil P 1e-20
3dmp_A217 2.6 A Crystal Structure Of Uracil Phosphoribosyltra 1e-20
1v9s_A208 Crystal Structure Of Tt0130 Protein From Thermus Th 2e-20
3asy_A211 Ligand-Free Structure Of Uridine Kinase From Thermu 8e-18
1o5o_A221 Crystal Structure Of Uracil Phosphoribosyltransfera 5e-17
2ehj_A208 Structure Of Uracil Phosphoribosyl Transferase Leng 3e-16
2e55_A208 Structure Of Aq2163 Protein From Aquifex Aeolicus L 4e-09
1xtt_A216 Sulfolobus Solfataricus Uracil Phosphoribosyltransf 1e-08
>pdb|1UPU|D Chain D, Structure Of The Uracil Phosphoribosyltransferase, Mutant C128v, Bound To Product Uridine-1-Monophosphate (Ump) Length = 224 Back     alignment and structure 
Iteration: 1

 Score =  219 bits (558), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/217 (48%), Positives = 147/217 (67%), Gaps = 4/217 (1%)
Query: 84  HDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEK 143
            D+   +PNV +++ T Q+R M T+IRD+   K +FVFY+DRLIRL++E  L  LPF +K
Sbjct: 7   QDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKK 66
Query: 144 QVVTPTGSMYTGVDFCKKLCGVSIVR---SMENALRAXXXXXXXXXXLIHRDGDNGK-QL 199
           +V TP    Y GV F  K+CGVSIVR   SME+ LRA          LI RD    + +L
Sbjct: 67  EVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKL 126
Query: 200 IYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVC 259
           IYEKLP DI ER V+LLDP+ AT  S  +AI++L+  GV E  IIF+N+++AP+GI  V 
Sbjct: 127 IYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVF 186
Query: 260 KRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGT 296
           K +P +++VT+ +D+ LN  + ++PG+G+FGDRYFGT
Sbjct: 187 KEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT 223
>pdb|1BD3|D Chain D, Structure Of The Apo Uracil Phosphoribosyltransferase, 2 Mutant C128v Length = 243 Back     alignment and structure
>pdb|1XRJ|A Chain A, Rapid Structure Determination Of Human Uridine-Cytidine Kinase 2 Using A Conventional Laboratory X-Ray Source And A Single Samarium Derivative Length = 261 Back     alignment and structure
>pdb|1UDW|A Chain A, Crystal Structure Of Human Uridine-cytidine Kinase 2 Complexed With A Feedback-inhibitor, Ctp Length = 252 Back     alignment and structure
>pdb|2JEO|A Chain A, Crystal Structure Of Human Uridine-Cytidine Kinase 1 Length = 245 Back     alignment and structure
>pdb|1I5E|A Chain A, Crystal Structure Of Bacillus Caldolyticus Uracil Phosphoribosyltransferase With Bound Ump Length = 209 Back     alignment and structure
>pdb|3DMP|A Chain A, 2.6 A Crystal Structure Of Uracil Phosphoribosyltransferase From Burkholderia Pseudomallei Length = 217 Back     alignment and structure
>pdb|1V9S|A Chain A, Crystal Structure Of Tt0130 Protein From Thermus Thermophilus Hb8 Length = 208 Back     alignment and structure
>pdb|3ASY|A Chain A, Ligand-Free Structure Of Uridine Kinase From Thermus Thermophilus Hb8 Length = 211 Back     alignment and structure
>pdb|1O5O|A Chain A, Crystal Structure Of Uracil Phosphoribosyltransferase (Tm0721) From Thermotoga Maritima At 2.30 A Resolution Length = 221 Back     alignment and structure
>pdb|2EHJ|A Chain A, Structure Of Uracil Phosphoribosyl Transferase Length = 208 Back     alignment and structure
>pdb|2E55|A Chain A, Structure Of Aq2163 Protein From Aquifex Aeolicus Length = 208 Back     alignment and structure
>pdb|1XTT|A Chain A, Sulfolobus Solfataricus Uracil Phosphoribosyltransferase In Complex With Uridine 5'-Monophosphate (Ump) Length = 216 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query298
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 7e-83
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 7e-77
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 8e-69
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 1e-68
2e55_A208 Uracil phosphoribosyltransferase; structural genom 3e-68
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 5e-68
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 1e-62
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 2e-58
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 4e-43
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 3e-40
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 2e-38
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 1e-22
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 5e-19
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 2e-17
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 2e-17
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 4e-17
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 4e-15
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 1e-14
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Length = 243 Back     alignment and structure
 Score =  249 bits (636), Expect = 7e-83
 Identities = 114/244 (46%), Positives = 163/244 (66%), Gaps = 14/244 (5%)

Query: 57  DVIIPRGGDNHVAIDLIVQHIHTKLGQHDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISK 116
            ++ PR   N     ++           D+   +PNV +++ T Q+R M T+IRD+   K
Sbjct: 9   LLVDPRYSTNDQEESIL----------QDIITRFPNVVLMKQTAQLRAMMTIIRDKETPK 58

Query: 117 HDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCGVSIVRS---MEN 173
            +FVFY+DRLIRL++E  L  LPF +K+V TP    Y GV F  K+CGVSIVR+   ME+
Sbjct: 59  EEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGVSIVRAGESMES 118

Query: 174 ALRACCKGIKIGKILIHRDGDNGK-QLIYEKLPNDISERHVLLLDPVLATGNSANQAIQL 232
            LRA C+G++IGKILI RD    + +LIYEKLP DI ER V+LLDP+ AT  S  +AI++
Sbjct: 119 GLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEV 178

Query: 233 LIEKGVPESHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDR 292
           L+  GV E  IIF+N+++AP+GI  V K +P +++VT+ +D+ LN  + ++PG+G+FGDR
Sbjct: 179 LLRLGVKEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDR 238

Query: 293 YFGT 296
           YFGT
Sbjct: 239 YFGT 242
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Length = 217 Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Length = 221 Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Length = 209 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Length = 208 Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Length = 208 Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Length = 216 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 100.0
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 100.0
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 100.0
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 100.0
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 100.0
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 100.0
2e55_A208 Uracil phosphoribosyltransferase; structural genom 100.0
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 100.0
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.18
1wd5_A208 Hypothetical protein TT1426; structural genomics, 99.06
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.05
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 99.02
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 99.0
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 98.96
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 98.93
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 98.92
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 98.89
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 98.89
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 98.86
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 98.85
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 98.83
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 98.8
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 98.77
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.77
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 98.74
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 98.73
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 98.72
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 98.71
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 98.7
1vdm_A153 Purine phosphoribosyltransferase; structural genom 98.69
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 98.68
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 98.66
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 98.64
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 98.64
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 98.63
1w30_A201 PYRR bifunctional protein; transferase, glycosyltr 98.63
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; t 98.6
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.58
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyri 98.54
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 98.5
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 98.33
3acd_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 98.28
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.28
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 98.2
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 98.13
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 98.08
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 98.07
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 98.01
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 98.0
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 97.97
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 97.94
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 97.94
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 97.9
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 97.89
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 97.87
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 97.85
1vch_A175 Phosphoribosyltransferase-related protein; structu 97.84
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.8
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 97.68
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 97.63
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 97.57
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; 97.52
1lh0_A213 OMP synthase; loop closure, monomer closure, orota 97.51
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.49
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.4
1o57_A291 PUR operon repressor; purine operon repressor, hel 97.38
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 97.35
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.31
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.31
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 97.21
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.19
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransf; 97.19
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 97.15
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransfe 97.11
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 96.92
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.89
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.74
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 96.71
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.56
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.54
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.33
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.33
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.32
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.13
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.71
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 95.5
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 94.98
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 94.71
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.34
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.3
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 94.28
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.27
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.23
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 94.08
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 94.06
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.78
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.71
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 93.55
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 93.5
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 93.39
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.3
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.29
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.24
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.07
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 92.89
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.78
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 92.75
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.74
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 92.49
1via_A175 Shikimate kinase; structural genomics, transferase 92.44
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 92.29
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 92.23
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.14
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.99
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 91.98
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 91.9
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 91.77
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 91.66
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 91.22
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 91.05
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 90.85
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.47
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 90.37
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 90.13
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 90.12
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.89
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 89.53
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 89.37
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 89.23
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 88.93
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 88.93
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 87.96
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 87.42
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 87.19
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 85.04
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.82
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 84.43
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 84.26
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 84.05
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 82.64
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 80.2
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
Probab=100.00  E-value=5.7e-65  Score=453.61  Aligned_cols=207  Identities=32%  Similarity=0.534  Sum_probs=197.6

Q ss_pred             CCCceeeccchHHHHHHhHhhhcCCCChhhHHHHHHHHHHHHHHHHhCCCCCeeEEEeCCCCcceeeeeec-cceeEeee
Q 022342           89 IYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFC-KKLCGVSI  167 (298)
Q Consensus        89 ~~~~l~vl~~~~~l~~llt~LRd~~T~~~~Fr~~~~rl~~lL~~eal~~lp~~~~~v~tp~g~~~~g~~~~-~~i~~V~I  167 (298)
                      .++|+|+++| |+++|++|+|||++|++.+||++++||++||+|||++++|+++++|+||+| +++|.++. +++|+|||
T Consensus         7 ~~~~v~v~~h-p~i~~~lt~lRd~~t~~~~Fr~~~~rl~~lL~yEa~~~lp~~~~~V~TP~g-~~~g~~~~~~~i~~V~I   84 (217)
T 3dmp_A            7 RFPNLFILDH-PLIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRNLPITTKRVETPLV-EIDAPVIAGKKLAIVPV   84 (217)
T ss_dssp             TCTTEEEECC-HHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHHHHHTTTCCEEEEEEECSSC-EEEEEEECGGGEEEEEE
T ss_pred             CCCCeEecCC-HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHhcCCceeEEEECCCe-EEEEEEecCCcEEEEEe
Confidence            4689999998 589999999999999999999999999999999999999999999999999 58899986 89999999


Q ss_pred             hH---HHHHHHHHhccCCccceEEEEecCCCCceeEeccCCCCCCCcEEEEEcCcccchHHHHHHHHHHHHcCCCCccEE
Q 022342          168 VR---SMENALRACCKGIKIGKILIHRDGDNGKQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHII  244 (298)
Q Consensus       168 lR---~m~~~~~~~~p~a~~g~i~i~R~~~t~~~~~y~klP~~i~~~~Vil~Dp~lATG~t~~~ai~~L~~~g~~~~~I~  244 (298)
                      +|   +|++++++++|++++|+|++|||++|.+..||.++| +++++.|||+|||+|||+|+++|++.|+++|+++++|+
T Consensus        85 lRaG~~m~~~l~~~ip~a~vg~i~~~Rd~~t~p~~~~~~lP-~i~~~~VilvD~~laTG~T~~~ai~~L~~~G~pe~~I~  163 (217)
T 3dmp_A           85 LRAGVGMSDGLLELIPSARVGHIGVYRADDHRPVEYLVRLP-DLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLM  163 (217)
T ss_dssp             ETTTHHHHHHHHHHCTTSEECEEECSCCCSSSCCCSEEECC-CCTTCEEEEECSEESSSHHHHHHHHHHHTTTCCGGGEE
T ss_pred             cccchHHHHHHHHhCcCCceeEEEEEECCCCCcEEEeecCC-CCCCCEEEEEcCcccccHHHHHHHHHHHHcCCCcCeEE
Confidence            99   899999999999999999999999995578999999 99999999999999999999999999999999889999


Q ss_pred             EEEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCCceeCCCCchhhhccCCCC
Q 022342          245 FLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGTDD  298 (298)
Q Consensus       245 vv~~vas~~gl~~l~~~~p~v~i~~a~id~~l~~~~~ivPGlGD~GdR~fgt~~  298 (298)
                      ++|++++++|++++.++||+|+||||+||++||++|||+|||||||||||||+.
T Consensus       164 ~~~~vaa~egl~~l~~~~P~v~i~ta~iD~~Lne~~yIvPGlGDaGDR~fgt~~  217 (217)
T 3dmp_A          164 FLALVAAPEGVQVFQDAHPDVKLYVASLDSHLDDHAYIVPGLGDAGDRLFGTKN  217 (217)
T ss_dssp             EECSEECHHHHHHHHHHCTTCEEEESEECCEECTTSCEESSCSCHHHHHHC---
T ss_pred             EEEEEeCHHHHHHHHHHCCCCEEEEEEecCCcCCCCCccCCCCCHHHhhcCCCC
Confidence            999999999999999999999999999999999999999999999999999974
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 298
d1bd3a_224 c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondi 6e-72
d1i5ea_208 c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldoly 1e-58
d1v9sa1208 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus the 4e-58
d1o5oa_210 c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga marit 1e-54
d1xtta1215 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus 4e-51
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 2e-25
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 5e-22
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 6e-14
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 9e-07
d1vcha1174 c.61.1.1 (A:2-175) Putative phosphoribosyltransfer 3e-04
d1wd5a_208 c.61.1.1 (A:) Putative phosphoribosyltransferase T 0.002
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Uracil PRTase, Upp
species: Toxoplasma gondii [TaxId: 5811]

 Score =  219 bits (559), Expect = 6e-72
 Identities = 111/217 (51%), Positives = 156/217 (71%), Gaps = 4/217 (1%)

Query: 84  HDLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEK 143
            D+   +PNV +++ T Q+R M T+IRD+   K +FVFY+DRLIRL++E  L  LPF +K
Sbjct: 7   QDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKK 66

Query: 144 QVVTPTGSMYTGVDFCKKLCGVSIVRS---MENALRACCKGIKIGKILIHRDGDNGK-QL 199
           +V TP    Y GV F  K+CGVSIVR+   ME+ LRA C+G++IGKILI RD    + +L
Sbjct: 67  EVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKL 126

Query: 200 IYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPESHIIFLNLISAPEGIHCVC 259
           IYEKLP DI ER V+LLDP+ AT  S  +AI++L+  GV E  IIF+N+++AP+GI  V 
Sbjct: 127 IYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVF 186

Query: 260 KRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGT 296
           K +P +++VT+ +D+ LN  + ++PG+G+FGDRYFGT
Sbjct: 187 KEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT 223
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Length = 208 Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Length = 208 Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Length = 210 Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Length = 215 Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query298
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 100.0
d1i5ea_208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 100.0
d1o5oa_210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 100.0
d1v9sa1208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 100.0
d1xtta1215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId 100.0
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.66
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.63
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA146 99.18
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.05
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 98.94
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 98.7
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo 98.7
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus s 98.63
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 98.6
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 98.4
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomon 98.37
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac 98.37
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania t 98.28
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId 98.24
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom 98.2
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtili 98.2
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g 98.15
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tu 98.1
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermoph 98.08
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium 98.06
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 97.81
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 97.79
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 97.65
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 97.63
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 97.47
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 97.37
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 97.36
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 97.35
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Ba 97.25
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 97.16
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.03
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 96.94
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.33
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.31
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 95.93
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain 95.58
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain 95.56
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.51
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.18
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.04
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.87
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.45
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.89
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.73
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 88.81
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 86.65
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 86.25
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 83.51
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 83.1
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 83.1
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 82.01
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 81.49
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 81.27
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Uracil PRTase, Upp
species: Toxoplasma gondii [TaxId: 5811]

Probab=100.00  E-value=3.4e-70  Score=487.30  Aligned_cols=212  Identities=53%  Similarity=0.974  Sum_probs=205.4

Q ss_pred             ccccCCCceeeccchHHHHHHhHhhhcCCCChhhHHHHHHHHHHHHHHHHhCCCCCeeEEEeCCCCcceeeeeeccceeE
Q 022342           85 DLCKIYPNVYVIQSTFQIRGMHTLIRDRGISKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSMYTGVDFCKKLCG  164 (298)
Q Consensus        85 ~l~~~~~~l~vl~~~~~l~~llt~LRd~~T~~~~Fr~~~~rl~~lL~~eal~~lp~~~~~v~tp~g~~~~g~~~~~~i~~  164 (298)
                      ++++.+||+++++++|++++|||+|||++|++++||++++||++||+|||++++|+++++|+||+|.++.|..+.+++|+
T Consensus         8 ~~~~r~pnv~vl~~~p~i~~~lTiLRd~~T~~~~Fr~~~~ri~~lL~yEa~~~l~~~~~~V~TPlg~~~~~~~~~~~v~~   87 (224)
T d1bd3a_           8 DIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICG   87 (224)
T ss_dssp             HHHHHCTTEEECCCCHHHHHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHTTSCBCCEEEECTTSCEEEECCBCCCEEE
T ss_pred             HHHhhCCCeEEeCCCHHHHHHHHHhHCCCCChHHHHHHHHHHHHHHHHHHHhccCceEEEEECCCcccccceecCCceEE
Confidence            45567799999988789999999999999999999999999999999999999999999999999988888888899999


Q ss_pred             eeehH---HHHHHHHHhccCCccceEEEEecCCCC-ceeEeccCCCCCCCcEEEEEcCcccchHHHHHHHHHHHHcCCCC
Q 022342          165 VSIVR---SMENALRACCKGIKIGKILIHRDGDNG-KQLIYEKLPNDISERHVLLLDPVLATGNSANQAIQLLIEKGVPE  240 (298)
Q Consensus       165 V~IlR---~m~~~~~~~~p~a~~g~i~i~R~~~t~-~~~~y~klP~~i~~~~Vil~Dp~lATG~t~~~ai~~L~~~g~~~  240 (298)
                      |||||   +|++|+++++|+|++|||+++||++|. +..||.++|++++++.|||+|||+|||+|+++|++.|+++|+++
T Consensus        88 V~ILRAGl~m~~g~~~~~p~a~~g~i~~~Rde~t~~p~~~y~klP~~i~~~~vil~DPmLATG~S~~~ai~~L~~~g~~~  167 (224)
T d1bd3a_          88 VSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKE  167 (224)
T ss_dssp             EEEETGGGGGHHHHHHHSTTCCEEEEEEEECTTTCCEEEEEEECCTTGGGSEEEEECSEESSCHHHHHHHHHHHHTTCCG
T ss_pred             EeeecccchhhhhHHhhCCCccceeeeeccccCCCCceeeHhhCCCccccceEEEeChHHhcchHHHHHHHHHHHcCCCc
Confidence            99999   899999999999999999999999998 57899999999999999999999999999999999999999999


Q ss_pred             ccEEEEEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCCceeCCCCchhhhccCC
Q 022342          241 SHIIFLNLISAPEGIHCVCKRFPSLKIVTSEIDVALNEEFRVIPGLGEFGDRYFGT  296 (298)
Q Consensus       241 ~~I~vv~~vas~~gl~~l~~~~p~v~i~~a~id~~l~~~~~ivPGlGD~GdR~fgt  296 (298)
                      ++|+++|++||++|++++.++||+++|||++||++||++|||+|||||||||||||
T Consensus       168 ~~I~~v~~iaa~~Gi~~l~~~~P~v~i~ta~ID~~Ln~~~yIvPGlGDaGDR~fGT  223 (224)
T d1bd3a_         168 ERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT  223 (224)
T ss_dssp             GGEEEEEEEECHHHHHHHHHHCTTCEEEEEEECSEECTTSCEESCCSCHHHHHHTC
T ss_pred             ceEEEEEEEecHHHHHHHHHHCcCCEEEEEEECcccCCCCccCCCCCcHHHhhcCC
Confidence            99999999999999999999999999999999999999999999999999999998
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure