Citrus Sinensis ID: 022417


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MALRPIDNALPITTPERPKKQVKFAAPVQKQPDLSVNDENKASFPPSADAFIDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCQSNLQPIDAQSMVKIITSQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcc
ccccccHccccccccccccccccccccccccccccccccccccccccccccEEEEcHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHccc
malrpidnalpittperpkkqvkfaapvqkqpdlsvndenkasfppsadafidyipsenlkaipdpesmipcliegldskdwtNVCESLNNARRFALhhssllepNLEKVMAVVVKAMknprsalckTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVEsitplpllqKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCqsnlqpidaqSMVKIITSQ
malrpidnalpittperpkkqVKFAApvqkqpdlsvndenKASFPPSADAFIDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMvesitplpllqKLKTYVKHTnprirakaaiSISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCQSnlqpidaqSMVKIITSQ
MALRPIDNALPITTPERPKKQVKFAAPVQKQPDLSVNDENKASFPPSADAFIDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEkvmavvvkamkNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPrirakaaisisiCVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCQSNLQPIDAQSMVKIITSQ
*************************************************AFIDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRL*******************************FC*******************
************************************************************KAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEE**********************VKII***
MALRPIDNALPITTPERPKKQVKFAAPVQKQPDLSVNDENKASFPPSADAFIDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTE*********QSFCQSNLQPIDAQSMVKIITSQ
*************************************************AFIDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCQSNLQPIDAQSMVKIITS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRPIDNALPITTPERPKKQVKFAAPVQKQPDLSVNDENKASFPPSADAFIDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCQSNLQPIDAQSMVKIITSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query297 2.2.26 [Sep-21-2011]
Q6A070 1759 Protein FAM179B OS=Mus mu yes no 0.589 0.099 0.302 5e-11
Q9Y4F4 1720 Protein FAM179B OS=Homo s yes no 0.417 0.072 0.328 8e-11
Q3TYG6 1002 Protein FAM179A OS=Mus mu no no 0.538 0.159 0.303 2e-10
Q6ZUX3 1019 Protein FAM179A OS=Homo s no no 0.693 0.202 0.278 7e-09
>sp|Q6A070|F179B_MOUSE Protein FAM179B OS=Mus musculus GN=Fam179b PE=3 SV=2 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 83/185 (44%), Gaps = 10/185 (5%)

Query: 77   LDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDI 136
            L  +DW    E LN  R  A  HS LL   L +    VV+ +KN RS + + +++   D+
Sbjct: 1269 LADEDWEKKMEGLNFVRCLAAFHSDLLNTKLHETTFAVVQEVKNLRSGVSRAAVVCLGDL 1328

Query: 137  FSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKL-K 195
            F+     L  S    LD+ V  LL KA +   F+ E+ D+AL  MV ++TP   +  L  
Sbjct: 1329 FTY----LKKSMDQELDSAVRALLHKAGESNTFIREDVDKALKAMVNNVTPARAVTSLIN 1384

Query: 196  TYVKHTNPRIRAKAAISISICVTKMGLE----GMKELGLVSLVQVAAGLLNDRLPEAREA 251
                H +  +R   A  ++  V  M  E    G K++    L+  AA    D   E R  
Sbjct: 1385 GGQSHLHIAVRRCTAQHLADVVECMDPERISSGTKDMA-DRLLPAAAKFAQDSSQETRYY 1443

Query: 252  ARSMV 256
             R M+
Sbjct: 1444 GRKML 1448





Mus musculus (taxid: 10090)
>sp|Q9Y4F4|F179B_HUMAN Protein FAM179B OS=Homo sapiens GN=FAM179B PE=1 SV=4 Back     alignment and function description
>sp|Q3TYG6|F179A_MOUSE Protein FAM179A OS=Mus musculus GN=Fam179a PE=2 SV=1 Back     alignment and function description
>sp|Q6ZUX3|F179A_HUMAN Protein FAM179A OS=Homo sapiens GN=FAM179A PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query297
359477401297 PREDICTED: protein FAM179B-like [Vitis v 0.996 0.996 0.755 1e-126
255551757297 clasp, putative [Ricinus communis] gi|22 1.0 1.0 0.737 1e-120
224108123298 predicted protein [Populus trichocarpa] 0.993 0.989 0.754 1e-112
449432852293 PREDICTED: protein FAM179B-like [Cucumis 0.976 0.989 0.693 1e-110
449513357293 PREDICTED: protein FAM179B-like [Cucumis 0.976 0.989 0.693 1e-110
224114958295 predicted protein [Populus trichocarpa] 0.983 0.989 0.750 1e-109
224114942284 predicted protein [Populus trichocarpa] 0.946 0.989 0.694 1e-106
356529571298 PREDICTED: uncharacterized protein LOC10 0.989 0.986 0.662 1e-103
224107133286 predicted protein [Populus trichocarpa] 0.949 0.986 0.677 6e-99
297800586296 hypothetical protein ARALYDRAFT_493301 [ 0.976 0.979 0.607 3e-94
>gi|359477401|ref|XP_003631973.1| PREDICTED: protein FAM179B-like [Vitis vinifera] gi|297736855|emb|CBI26056.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 225/298 (75%), Positives = 255/298 (85%), Gaps = 2/298 (0%)

Query: 1   MALRPIDNALPITTPERPKKQVKFAAPVQKQPDLSVNDENKASFPPSADAFIDYIPSENL 60
           MALR +DNALP TTPERPKKQ K A  +QKQ D  VNDENKA  PP+ADA IDYI SENL
Sbjct: 1   MALRSLDNALP-TTPERPKKQAKVAVSIQKQSDFGVNDENKAPLPPTADATIDYISSENL 59

Query: 61  KAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKN 120
           KA+PDPE+ I  L EGLDSKDW  VCESLN+ARRFAL+HS+L+ P LEKV+ V+VKAMKN
Sbjct: 60  KAMPDPETQITGLTEGLDSKDWAKVCESLNDARRFALYHSALMAPILEKVLLVLVKAMKN 119

Query: 121 PRSALCKTSIMAASDIFSAFGDKLLDST-SDALDNLVLQLLMKASQDKKFVCEEADRALN 179
           PRSAL KTSIMA++DIF+ FGD+LL  T SDA D+++LQLL+KASQDKKFVCEEAD+AL 
Sbjct: 120 PRSALSKTSIMASTDIFNTFGDELLQPTNSDAFDHMLLQLLLKASQDKKFVCEEADKALK 179

Query: 180 TMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAG 239
            MV S+TPLPLLQKL+ YV H N RIRAKAAISIS CV+KMGLEGMKE GLVSLVQ+AA 
Sbjct: 180 AMVGSMTPLPLLQKLQAYVNHANLRIRAKAAISISHCVSKMGLEGMKEFGLVSLVQIAAE 239

Query: 240 LLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCQSNLQPIDAQSMVKIITSQ 297
           LLNDRLPEAREAARS V S+Y+AFTENEE KQE+WQ+FCQSNL P+ AQSMVKII+SQ
Sbjct: 240 LLNDRLPEAREAARSTVISIYDAFTENEEQKQESWQNFCQSNLTPLHAQSMVKIISSQ 297




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255551757|ref|XP_002516924.1| clasp, putative [Ricinus communis] gi|223544012|gb|EEF45538.1| clasp, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224108123|ref|XP_002333428.1| predicted protein [Populus trichocarpa] gi|222836622|gb|EEE75015.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449432852|ref|XP_004134212.1| PREDICTED: protein FAM179B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449513357|ref|XP_004164305.1| PREDICTED: protein FAM179B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224114958|ref|XP_002332272.1| predicted protein [Populus trichocarpa] gi|222832037|gb|EEE70514.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114942|ref|XP_002332268.1| predicted protein [Populus trichocarpa] gi|222832033|gb|EEE70510.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356529571|ref|XP_003533363.1| PREDICTED: uncharacterized protein LOC100806408 [Glycine max] Back     alignment and taxonomy information
>gi|224107133|ref|XP_002314385.1| predicted protein [Populus trichocarpa] gi|222863425|gb|EEF00556.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297800586|ref|XP_002868177.1| hypothetical protein ARALYDRAFT_493301 [Arabidopsis lyrata subsp. lyrata] gi|297314013|gb|EFH44436.1| hypothetical protein ARALYDRAFT_493301 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query297
TAIR|locus:2130814296 AT4G15830 [Arabidopsis thalian 0.973 0.976 0.549 8.5e-81
TAIR|locus:2096667326 AT3G01450 "AT3G01450" [Arabido 0.801 0.730 0.401 1.8e-46
TAIR|locus:2185505346 AT5G14790 "AT5G14790" [Arabido 0.861 0.739 0.375 2.4e-44
TAIR|locus:2086919361 AT3G18530 [Arabidopsis thalian 0.582 0.479 0.331 4.9e-21
MGI|MGI:2443498 1002 Fam179a "family with sequence 0.666 0.197 0.277 3.2e-08
FB|FBgn02598181655 CG42399 [Drosophila melanogast 0.686 0.123 0.25 4.5e-08
TAIR|locus:2130814 AT4G15830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 811 (290.5 bits), Expect = 8.5e-81, P = 8.5e-81
 Identities = 167/304 (54%), Positives = 217/304 (71%)

Query:     1 MALRPIDNALPITTPERPKKQVKFAAPVQKQPDLSVNDENKASFPPS-ADAFIDYIPSEN 59
             MALR I+NALPI+  ERPKK  K +    KQP++ +NDEN    P + A++ ++Y+ SEN
Sbjct:     1 MALRNIENALPISQ-ERPKKLAKLS----KQPEIGLNDENN---PVAVAESTVEYVASEN 52

Query:    60 LKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEXXXXXXXXXXX 119
             LK   DPES +  L+E L SKDW  VC+SLNN RRFA+HHSSLL P LE           
Sbjct:    53 LKPFSDPESSVQRLLEELASKDWIKVCDSLNNTRRFAIHHSSLLLPILEKLIVVMVKAMK 112

Query:   120 NPRSALCKTSIMAASDIFSAFGDKLLDSTS-DALDNLVLQLLMKASQDKKFVCEEADRAL 178
             NPRSALCKTSIM  SDIF+A+G+KLL+     ++D+L+LQLLMKASQDKKFVCEEA++AL
Sbjct:   113 NPRSALCKTSIMTCSDIFTAYGEKLLEGPHLKSMDDLLLQLLMKASQDKKFVCEEAEKAL 172

Query:   179 NTMVESITPLPLLQKLKTYVKHTNPXXXXXXXXXXXXCVTKMGLEGMKELGLVSLVQVAA 238
             NTMV S+  LPLL+KL++YV+H+NP            CV+KM +  M+E G++ L Q+AA
Sbjct:   173 NTMVNSVARLPLLRKLQSYVRHSNPRVRAKAAVSTSNCVSKMEVNEMEEFGMILLAQMAA 232

Query:   239 GLLNDRLPEAREAARSMVNSMYNAFTENEEH-----KQEAWQSFCQSNLQPIDAQSMVKI 293
               L+D+LPEAREAARSMVNS++  FT NEE      KQEAW+ FC+ N+  ++AQ+M+KI
Sbjct:   233 DQLSDKLPEAREAARSMVNSLFEKFTWNEEEDEEGSKQEAWKKFCEKNVTGLNAQAMIKI 292

Query:   294 ITSQ 297
             + SQ
Sbjct:   293 VASQ 296




GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
GO:0051225 "spindle assembly" evidence=RCA
TAIR|locus:2096667 AT3G01450 "AT3G01450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185505 AT5G14790 "AT5G14790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086919 AT3G18530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2443498 Fam179a "family with sequence similarity 179, member A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0259818 CG42399 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query297
pfam12348228 pfam12348, CLASP_N, CLASP N terminal 9e-05
>gnl|CDD|221541 pfam12348, CLASP_N, CLASP N terminal Back     alignment and domain information
 Score = 42.6 bits (101), Expect = 9e-05
 Identities = 34/151 (22%), Positives = 61/151 (40%), Gaps = 11/151 (7%)

Query: 122 RSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQD-KKFVCEEADRALNT 180
           R+ L  T      ++    G  L D  ++ L    L  L+K   D KK + + A++A+  
Sbjct: 66  RTTLSSTGCHLLKELAIQLGHHL-DPFAEIL----LPTLLKLCGDTKKIISQNANQAVAD 120

Query: 181 MVESITPLP--LLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMK---ELGLVSLVQ 235
           ++ +++  P   LQ +   ++  N + R  +AI + I + + G          GL    +
Sbjct: 121 ILSNVSYTPRLELQHISAALQDKNVQPREYSAIWLKILLIRHGHHKSHIEHHGGLDLYEK 180

Query: 236 VAAGLLNDRLPEAREAARSMVNSMYNAFTEN 266
                L D  P  RE ARS     +  +   
Sbjct: 181 SLKKGLEDANPGVRETARSTFWEFFRVWPAR 211


This region is found at the N terminal of CLIP-associated proteins (CLASPs). CLASPs are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules. In yeast, Drosophila, and Xenopus, a single CLASP orthologue is present. In mammals, a second paralogue (CLASP2) exists which has some functional overlap with CLASP1. Length = 228

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 297
KOG2933334 consensus Uncharacterized conserved protein [Funct 100.0
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 99.97
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 99.4
KOG1242569 consensus Protein containing adaptin N-terminal re 99.21
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.87
KOG1242 569 consensus Protein containing adaptin N-terminal re 97.86
PF05004309 IFRD: Interferon-related developmental regulator ( 97.7
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.64
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.6
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.57
KOG2956516 consensus CLIP-associating protein [General functi 97.56
PRK09687280 putative lyase; Provisional 97.42
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 97.38
PTZ00429 746 beta-adaptin; Provisional 97.35
PRK09687280 putative lyase; Provisional 97.27
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 97.17
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.13
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 96.99
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 96.97
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 96.9
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.68
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 96.66
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.65
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 96.61
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 96.52
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.51
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 96.51
PTZ00429 746 beta-adaptin; Provisional 96.43
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 96.43
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 96.31
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.21
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.13
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 95.91
KOG2956516 consensus CLIP-associating protein [General functi 95.9
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 95.74
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.73
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 95.66
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 95.56
PF05004309 IFRD: Interferon-related developmental regulator ( 95.21
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 95.14
cd03561133 VHS VHS domain family; The VHS domain is present i 94.94
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 94.78
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 94.6
KOG0212 675 consensus Uncharacterized conserved protein [Funct 94.52
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 94.33
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 94.33
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 94.22
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 94.22
PF08167165 RIX1: rRNA processing/ribosome biogenesis 94.12
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 94.03
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.02
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 93.99
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 93.92
COG1413335 FOG: HEAT repeat [Energy production and conversion 93.74
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 93.67
KOG0212 675 consensus Uncharacterized conserved protein [Funct 93.59
KOG1824 1233 consensus TATA-binding protein-interacting protein 93.49
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 93.39
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 93.23
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 92.94
KOG2025 892 consensus Chromosome condensation complex Condensi 92.94
KOG2032533 consensus Uncharacterized conserved protein [Funct 92.82
KOG1824 1233 consensus TATA-binding protein-interacting protein 92.28
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 92.27
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 92.27
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 92.18
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 91.84
KOG2149 393 consensus Uncharacterized conserved protein [Funct 91.44
KOG2032533 consensus Uncharacterized conserved protein [Funct 91.41
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 91.37
KOG0414 1251 consensus Chromosome condensation complex Condensi 91.34
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 91.17
PF12719 298 Cnd3: Nuclear condensing complex subunits, C-term 91.04
cd03565141 VHS_Tom1 VHS domain family, Tom1 subfamily; The VH 89.67
KOG1243 690 consensus Protein kinase [General function predict 89.44
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 89.29
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 89.15
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 88.97
PF04118 307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 88.42
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 88.23
KOG2062 929 consensus 26S proteasome regulatory complex, subun 88.19
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 88.03
COG1413335 FOG: HEAT repeat [Energy production and conversion 87.5
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 87.32
KOG4653982 consensus Uncharacterized conserved protein [Funct 87.07
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 86.92
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 86.76
COG5098 1128 Chromosome condensation complex Condensin, subunit 86.34
KOG4199461 consensus Uncharacterized conserved protein [Funct 86.27
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 86.25
KOG0414 1251 consensus Chromosome condensation complex Condensi 86.23
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 86.04
KOG0413 1529 consensus Uncharacterized conserved protein relate 85.93
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 85.81
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 85.41
TIGR02270 410 conserved hypothetical protein. Members are found 85.24
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 84.96
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 84.84
TIGR02270 410 conserved hypothetical protein. Members are found 84.82
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 84.3
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 84.08
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 83.84
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 83.61
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 82.72
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 82.26
PF13251182 DUF4042: Domain of unknown function (DUF4042) 81.86
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 81.82
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 81.64
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 81.41
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 80.69
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 80.1
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=4.1e-51  Score=377.51  Aligned_cols=290  Identities=36%  Similarity=0.561  Sum_probs=257.7

Q ss_pred             CCCCCCccCCCCCCCCC--cchh-------hhhccC---CCCCCCCCCCCC------CCCCCCCCCcccceeccCCCCCC
Q 022417            1 MALRPIDNALPITTPER--PKKQ-------VKFAAP---VQKQPDLSVNDE------NKASFPPSADAFIDYIPSENLKA   62 (297)
Q Consensus         1 ~~~~~~~~~~~~~~~~~--~~~~-------~~~~~~---~~~~~~~~~~~~------~~~~~~~~~~~~v~y~~~~eL~P   62 (297)
                      ++|+.+-||+| .+.||  ++|.       .|-.-.   -.+++-..+..+      -..|+++...++++|+.+++|.|
T Consensus         4 ~~l~~~~~~~p-~sqer~~d~~as~~~~~~gK~~gs~e~~p~~~~~pl~h~~~t~~~~~~~~~e~~~~~~e~~~sk~l~~   82 (334)
T KOG2933|consen    4 KALKDLRNALP-VSQERFQDKKASIVKSCMGKMSGSHEDKPPTNHPPLDHNSPTPQEAIKQEGERLIHSVEYIVSKNLSP   82 (334)
T ss_pred             hhhhhccccCc-cchhcccccccccccchhhcccCccccCCCCCCCCccccCCCchhhhccccccccccHHHhhhcccCc
Confidence            47888999999 88888  7772       222100   011111222222      22346666788999999999999


Q ss_pred             CCCccccHHHHHhccCCcCHHHHHHHHHHHHHHHhhChhhhhHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHcCC
Q 022417           63 IPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGD  142 (297)
Q Consensus        63 l~~pe~~l~~~l~~L~s~dW~~~~eaL~~LRrLa~~h~e~l~~~L~~i~~~v~~~vknLRS~Vsk~A~~tl~dLf~~l~~  142 (297)
                      |++|+.+|+.++.+|+|+||+.+|+||++||||+.||+|.+.+.|++++..|+++++||||+|||+||+|++|||+.|++
T Consensus        83 fd~p~~al~~~l~~L~s~dW~~~vdgLn~irrLs~fh~e~l~~~L~~vii~vvkslKNlRS~VsraA~~t~~difs~ln~  162 (334)
T KOG2933|consen   83 FDDPEAALKQALKKLSSDDWEDKVDGLNSIRRLSEFHPESLNPMLHEVIIAVVKSLKNLRSAVSRAACMTLADIFSSLNN  162 (334)
T ss_pred             cCcHHHHHHHHHHHhchHHHHHHhhhHHHHHHHHhhhHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcchhhHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHhcCchhHHHHHHhhccCCCHHHHHHHHHHHHHHHHhhCc
Q 022417          143 KLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGL  222 (297)
Q Consensus       143 ~~md~~~~~ld~ll~~LL~Ka~~sn~FI~e~A~~AL~~Mv~~~s~~kll~~L~~~~~hKn~~VR~~aA~~L~~~v~~~g~  222 (297)
                       .++.   ++|.++.+||+|++++|+||||+|++||.+||.+++|.++++.|+.+++|.|+.+|++++.|+.+|+.++|.
T Consensus       163 -~i~~---~ld~lv~~Ll~ka~~dnrFvreda~kAL~aMV~~vtp~~~L~~L~~~~~~~n~r~r~~a~~~~~~~v~rl~v  238 (334)
T KOG2933|consen  163 -SIDQ---ELDDLVTQLLHKASQDNRFVREDAEKALVAMVNHVTPQKLLRKLIPILQHSNPRVRAKAALCFSRCVIRLGV  238 (334)
T ss_pred             -HHHH---HHHHHHHHHHhhhcccchHHHHHHHHHHHHHHhccChHHHHHHHHHHHhhhchhhhhhhhccccccceeccc
Confidence             6775   499999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhccHHHHHHHHHHhccCCCHHHHHHHHHHHHHHHHHhccchh-------hh---HHHHHHHHHhcCChhhHHHHHH
Q 022417          223 EGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTENEE-------HK---QEAWQSFCQSNLQPIDAQSMVK  292 (297)
Q Consensus       223 ~~l~~~~~~~ll~~~a~~l~D~~pE~R~~aRk~l~~L~~~~~~~~~-------~~---~~~~~~~~~~~l~~~~a~~~~~  292 (297)
                      ..+..++...+.+.+..-..|..|+.|+.||-++..+.++|....+       .+   ...|+.||++++++..+|++++
T Consensus       239 ~~~~~~~~~dl~~a~~~~~~d~Lp~~~~~a~~~~~~~~~v~~~~~~lv~~e~~n~e~r~~t~~~v~~~~~~~~~~~~~lr  318 (334)
T KOG2933|consen  239 LPVLLQGSCDLSRAAQEQGSDKLPELREAARFVRLELKEVLKTAQELVEDESENPEVRKATWRGVCPKSLTGLSAQAVLR  318 (334)
T ss_pred             cchhhHhHHHHHHHHHhhhcccccccccchhHHHHhHHHHHHHhhhhcchhhcCcchhhhhhhhcCccCCchhhHHHHHH
Confidence            9988899999999999999999999999999999999999977643       23   3799999999999999999999


Q ss_pred             hhc
Q 022417          293 IIT  295 (297)
Q Consensus       293 ~~~  295 (297)
                      +++
T Consensus       319 ~~n  321 (334)
T KOG2933|consen  319 VTN  321 (334)
T ss_pred             Hhh
Confidence            986



>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query297
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 8e-22
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 5e-13
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 1e-05
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
 Score = 90.8 bits (225), Expect = 8e-22
 Identities = 39/238 (16%), Positives = 81/238 (34%), Gaps = 13/238 (5%)

Query: 56  PSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVV 115
             + L  +     M     + L+ K WT   ESL    +    H  L       +++ + 
Sbjct: 3   HMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALK 62

Query: 116 KAMKNPRSALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEAD 175
           K +    + +       A    +     L    S+     V  LL K  + K  V     
Sbjct: 63  KVITKDSNVVLVA---MAGKCLALLAKGLAKRFSNYASACVPSLLEKFKEKKPNVVTALR 119

Query: 176 RALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQ 235
            A++ +  S +     + +   + + NP ++++ A+ I+  +T+     + +  L  L  
Sbjct: 120 EAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFIARALTRTQPTALNKKLLKLLTT 179

Query: 236 VAAGLLNDRLPEAREAARSMVNSMYNAFTENEEHKQEAWQSFCQSNLQPIDAQSMVKI 293
                LN+  P  R+++   + ++     +                L  +D   M KI
Sbjct: 180 SLVKTLNEPDPTVRDSSAEALGTLIKLMGDKA----------VTPLLADVDPLKMAKI 227


>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Length = 266 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query297
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.86
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.83
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 99.67
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 99.56
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.53
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.97
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.8
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.66
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.65
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.64
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.63
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.63
1qgr_A876 Protein (importin beta subunit); transport recepto 98.59
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.57
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 98.56
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.52
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.51
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.5
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.49
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.48
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.47
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.43
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.43
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.36
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.36
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.36
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 98.36
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.34
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.31
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.31
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 98.28
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 98.22
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 98.22
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 98.09
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 98.01
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.0
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.88
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.88
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 97.66
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.58
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 97.57
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 97.55
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 97.55
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 97.48
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 97.48
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.45
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 97.33
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 97.29
3tjz_B 355 Coatomer subunit gamma; protein trafficking, golgi 97.05
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.05
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 96.96
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 96.89
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 96.84
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 96.59
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 96.56
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 96.52
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 96.29
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.29
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 96.25
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 96.21
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 96.18
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 96.11
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 96.11
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 96.07
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 95.94
2db0_A253 253AA long hypothetical protein; heat repeats, hel 95.9
3nmz_A458 APC variant protein; protein-protein complex, arma 95.86
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 95.75
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 95.61
2x19_B 963 Importin-13; nuclear transport, protein transport; 95.35
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 95.1
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 95.06
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 95.06
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 94.94
2x19_B 963 Importin-13; nuclear transport, protein transport; 94.79
3g2s_A149 C-terminal fragment of sortilin-related receptor; 94.62
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 94.47
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 94.46
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.35
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 94.33
2x1g_F 971 Cadmus; transport protein, developmental protein, 94.15
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.03
2x1g_F 971 Cadmus; transport protein, developmental protein, 93.83
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 93.75
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 93.68
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 93.53
3nmz_A458 APC variant protein; protein-protein complex, arma 93.25
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 92.54
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 92.42
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 92.18
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 91.79
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 91.14
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 90.36
1elk_A157 Target of MYB1; superhelix of helices, endocytosis 89.91
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 89.7
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 89.42
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 89.38
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.3
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 88.06
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 86.81
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 86.33
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 85.42
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 84.94
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 83.41
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 81.51
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
Probab=99.86  E-value=1e-20  Score=168.29  Aligned_cols=205  Identities=16%  Similarity=0.216  Sum_probs=182.6

Q ss_pred             ceeccCCCCCCCCCccccHHHHHhccCCcCHHHHHHHHHHHHHHHhhChhhhhHHHHHHHHHHHHHh-cCcchHHHHHHH
Q 022417           52 IDYIPSENLKAIPDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAM-KNPRSALCKTSI  130 (297)
Q Consensus        52 v~y~~~~eL~Pl~~pe~~l~~~l~~L~s~dW~~~~eaL~~LRrLa~~h~e~l~~~L~~i~~~v~~~v-knLRS~Vsk~A~  130 (297)
                      +++++++|+.+.=.|     .+++.+.|.||..|.+|+..|..++..++++....+.+++..+.+.+ ++....|...|+
T Consensus         4 ~d~~~~~di~~~l~~-----~l~~~l~s~~w~~R~~a~~~L~~l~~~~~~~~~~~~~~i~~~L~~~l~kd~~~~V~~~a~   78 (242)
T 2qk2_A            4 MDLLDPVDILSKMPK-----DFYDKLEEKKWTLRKESLEVLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAG   78 (242)
T ss_dssp             HHTTSCBCCGGGSCT-----THHHHHTCSSHHHHHHHHHHHHHHHHHCSSBCCCCCHHHHHHHHHHHHHCSCHHHHHHHH
T ss_pred             HHhCCcccccccCCH-----HHHhhhccCCHHHHHHHHHHHHHHHccCCCCCCCCHHHHHHHHHHHhccCCCHHHHHHHH
Confidence            556667776332223     57888899999999999999999999888876677889999999999 599999999999


Q ss_pred             HHHHHHHHHcCCCCCCcchhhHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHhcCchhHHHHHHhhccCCCHHHHHHHH
Q 022417          131 MAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITPLPLLQKLKTYVKHTNPRIRAKAA  210 (297)
Q Consensus       131 ~tl~dLf~~l~~~~md~~~~~ld~ll~~LL~Ka~~sn~FI~e~A~~AL~~Mv~~~s~~kll~~L~~~~~hKn~~VR~~aA  210 (297)
                      .+++.|+..+|. .+.+.   +..+++.|+.+.++.+..||+.|..||..++.+++...+++.|..+++|+|+.||..+.
T Consensus        79 ~~l~~la~~l~~-~~~~~---~~~ilp~ll~~l~d~~~~vr~~a~~aL~~~~~~~~~~~ll~~l~~~l~~~~~~vr~~~l  154 (242)
T 2qk2_A           79 KCLALLAKGLAK-RFSNY---ASACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETA  154 (242)
T ss_dssp             HHHHHHHHHHGG-GGHHH---HHHHHHHHHHGGGCCCHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHTTCSCHHHHHHHH
T ss_pred             HHHHHHHHHHhh-hHHHH---HHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHcCCChHHHHHHH
Confidence            999999999999 77764   88999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhCchhhhhccHHHHHHHHHHhccCCCHHHHHHHHHHHHHHHHHhcc
Q 022417          211 ISISICVTKMGLEGMKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSMYNAFTE  265 (297)
Q Consensus       211 ~~L~~~v~~~g~~~l~~~~~~~ll~~~a~~l~D~~pE~R~~aRk~l~~L~~~~~~  265 (297)
                      .+|..++...+++......+..+++.+..+++|.++++|..|..++..+..+++.
T Consensus       155 ~~l~~~l~~~~~~~~~~~~l~~l~p~l~~~l~D~~~~VR~~A~~~l~~l~~~vg~  209 (242)
T 2qk2_A          155 LFIARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGD  209 (242)
T ss_dssp             HHHHHHHTTCCGGGCCHHHHHHHHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHCH
T ss_pred             HHHHHHHHHcCCCCccHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHcCH
Confidence            9999999998765433344789999999999999999999999999999999974



>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 297
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 5e-05
d1b3ua_ 588 a.118.1.2 (A:) Constant regulatory domain of prote 7e-05
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Cullin-associated NEDD8-dissociated protein 1 (Tip120)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (98), Expect = 5e-05
 Identities = 31/196 (15%), Positives = 67/196 (34%), Gaps = 14/196 (7%)

Query: 64   PDPESMIPCLIEGLDSKDWTNVCESLNNARRFALHHSSLLEPNLEKVMAVVVKAMKNPRS 123
                 +   ++E   S       E + +A  +AL    +   NL + +  V++ + +   
Sbjct: 849  SGQLELKSVILEAFSSPS-----EEVKSAASYALGS--ISVGNLPEYLPFVLQEITSQPK 901

Query: 124  ALCKTSIMAASDIFSAFGDKLLDSTSDALDNLVLQLLMKASQDKKFVCEEADRALNTMVE 183
                  + +  +I S+     L    + +  L+L+        ++         L  +  
Sbjct: 902  RQ-YLLLHSLKEIISSASVVGLKPYVENIWALLLKHC---ECAEEGTRNVVAECLGKLT- 956

Query: 184  SITPLPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEGMKELGLVSLVQVAAGLLND 243
             I P  LL +LK Y+   +   R+    ++   ++    + +  L L + +      L D
Sbjct: 957  LIDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHP-QPIDPL-LKNCIGDFLKTLED 1014

Query: 244  RLPEAREAARSMVNSM 259
                 R  A    NS 
Sbjct: 1015 PDLNVRRVALVTFNSA 1030


>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query297
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.05
d1b3ua_588 Constant regulatory domain of protein phosphatase 98.58
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.54
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.28
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.08
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.97
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.88
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.85
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.77
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.73
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.6
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 97.55
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.35
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.34
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 97.3
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.3
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.15
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 96.99
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 96.82
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 96.46
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 96.05
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 95.74
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 95.51
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 95.49
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 94.99
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 93.42
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 93.34
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 93.04
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 91.87
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 91.84
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 91.31
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 88.72
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 86.53
d1elka_153 Tom1 protein {Human (Homo sapiens) [TaxId: 9606]} 83.06
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Constant regulatory domain of protein phosphatase 2a, pr65alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.05  E-value=3.9e-09  Score=100.49  Aligned_cols=177  Identities=11%  Similarity=0.135  Sum_probs=139.7

Q ss_pred             HHHHHhccCCcCHHHHHHHHHHHHHHHhh-ChhhhhHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHcCCCCCCcc
Q 022417           70 IPCLIEGLDSKDWTNVCESLNNARRFALH-HSSLLEPNLEKVMAVVVKAMKNPRSALCKTSIMAASDIFSAFGDKLLDST  148 (297)
Q Consensus        70 l~~~l~~L~s~dW~~~~eaL~~LRrLa~~-h~e~l~~~L~~i~~~v~~~vknLRS~Vsk~A~~tl~dLf~~l~~~~md~~  148 (297)
                      +..+...+.+.+|..+..++..+..++.+ .++.+.+   .+.+.+...+.+.-..|-..|+.+++.|+..+|. ..   
T Consensus       404 l~~l~~~~~d~~~~~r~~~~~~l~~l~~~~~~~~~~~---~l~~~l~~~l~D~~~~VR~~A~~~L~~l~~~~~~-~~---  476 (588)
T d1b3ua_         404 LPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDE---KLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGK-EW---  476 (588)
T ss_dssp             HHHHHHHHTCSSHHHHHHHHHHHHHHHHHHCGGGCCH---HHHHHHHHGGGCSSHHHHHHHHHHHHHHHHHHCH-HH---
T ss_pred             HHHHHHHHhcccHHHHHHHHHHHHHHHHHcChHhHHH---HHHHHHHhhccCCchhHHHHHHHHHHHHHHHhCc-HH---
Confidence            33455666899999999999999999864 3444443   3445566778888888999999999999999998 21   


Q ss_pred             hhhHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHhcCc----hhHHHHHHhhccCCCHHHHHHHHHHHHHHHHhhCchh
Q 022417          149 SDALDNLVLQLLMKASQDKKFVCEEADRALNTMVESITP----LPLLQKLKTYVKHTNPRIRAKAAISISICVTKMGLEG  224 (297)
Q Consensus       149 ~~~ld~ll~~LL~Ka~~sn~FI~e~A~~AL~~Mv~~~s~----~kll~~L~~~~~hKn~~VR~~aA~~L~~~v~~~g~~~  224 (297)
                        ....+++.++.-..+.+..+|..+-.++..+...++.    ..+++.|...+++..|.||..++..|..+....+...
T Consensus       477 --~~~~i~~~l~~~~~~~~~~~R~~~~~~l~~l~~~~~~~~~~~~ilp~ll~~~~D~v~nVR~~a~~~l~~i~~~~~~~~  554 (588)
T d1b3ua_         477 --AHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNST  554 (588)
T ss_dssp             --HHHHTHHHHHHTTTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHGGGCSCHHHHHHHHHHHHHHGGGSCHHH
T ss_pred             --HHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHcChHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHHcCcHh
Confidence              2345566665555667888899999999999887764    4688889999999999999999999999888776433


Q ss_pred             hhhccHHHHHHHHHHhccCCCHHHHHHHHHHHHHH
Q 022417          225 MKELGLVSLVQVAAGLLNDRLPEAREAARSMVNSM  259 (297)
Q Consensus       225 l~~~~~~~ll~~~a~~l~D~~pE~R~~aRk~l~~L  259 (297)
                      +    ...+.+.+.++.+|.++|||++|.+++..|
T Consensus       555 ~----~~~i~~~l~~L~~D~d~dVr~~A~~al~~l  585 (588)
T d1b3ua_         555 L----QSEVKPILEKLTQDQDVDVKYFAQEALTVL  585 (588)
T ss_dssp             H----HHHHHHHHHHHTTCSSHHHHHHHHHHHHHT
T ss_pred             H----HHHHHHHHHHHcCCCCHHHHHHHHHHHHHH
Confidence            2    356778888899999999999999998764



>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elka_ a.118.9.2 (A:) Tom1 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure