Citrus Sinensis ID: 022481


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MSIEPPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFNSSSRTGKDNLQVSSDGVNSVTDTFSRLDIDSDKDPKVESVVKRHPVSSVLECKCGMPLCICEAPAPAASTETRPPQMKSSSTTAGQSNPKPKKTENTARSRGSTSNSNFSSIFNPGQVTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKMEEDKNNVGSTTSV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHccccHHHHHHHHHccccccccccc
ccccccccccccEccccccEcEccEccEEccccccEEcHHHccEEEEEHHHcEEEEEEEcHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccc
msieppafqeatrcdvckcsfntfrrrhhcrccgrtlchehssdqmtlpqfgihtnVRVCadcfnsssrtgkdnlqvssdgvnsvtdtfsrldidsdkdpkvesvvkrhpvssvleckcgmplciceapapaastetrppqmksssttagqsnpkpkktentarsrgstsnsnfssifnpgqvtngatdkprmeyevnGEGLRDAIKNGDAAAVKKLLSegvdanfcdkqgMSLLHLAALFNRTDIAFILMEsganmdcknaqgespldcapvtLQYKMRQKMeedknnvgsttsv
msieppafqeatrcdvcKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFNSSsrtgkdnlqvssdgvnsvtdtfsrldidsdkdpkvesvvkrhpvssvlecKCGMPLCICEAPapaastetrppqmksssttagqsnpkpkktentarsrgstsnsnfssifnpgqvtngatdkpRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRqkmeedknnvgsttsv
MSIEPPAFQEATRCDVCKCSFNTFrrrhhcrccgrtlchEHSSDQMTLPQFGIHTNVRVCADCFNSSSRTGKDNLQVSSDGVNSVTDTFSRLDIDSDKDPKVESVVKRHPVSSVLECKCGMPLCICEAPAPAASTETRPPQMKSSSTTAGQSNPKPKKTENTArsrgstsnsnfssifnPGQVTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKMEEDKNNVGSTTSV
**********ATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFN********************************************PVSSVLECKCGMPLCIC*******************************************************************************IKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANM***************************************
**IEPPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFNSSSRTGKDNLQVSSDGVNSVT*******************VKRHPVSSVLECKCGMPLCICEAPAPAASTET***********AGQSNPKPKKTENTARSRGSTSNSNFSSIFNPGQVT*GATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKMEEDKNNV******
MSIEPPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFNSSSRTGKDNLQVSSDGVNSVTDTFSRLDIDSD***********HPVSSVLECKCGMPLCICEAPAP****************************************SNFSSIFNPGQVTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQK**************
****PPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFNSS********************************************SSVLECKCGMPLCICEAPAPA**************************************************VTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKMEED**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIEPPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFNSSSRTGKDNLQVSSDGVNSVTDTFSRLDIDSDKDPKVESVVKRHPVSSVLECKCGMPLCICEAPAPAASTETRPPQMKSSSTTAGQSNPKPKKTENTARSRGSTSNSNFSSIFNPGQVTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKMEEDKNNVGSTTSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query296 2.2.26 [Sep-21-2011]
Q9VB70989 Lateral signaling target yes no 0.266 0.079 0.402 2e-11
B4IC49975 Lateral signaling target N/A no 0.266 0.081 0.402 3e-11
B4PRU6984 Lateral signaling target N/A no 0.236 0.071 0.424 3e-11
B3P851981 Lateral signaling target N/A no 0.236 0.071 0.424 4e-11
P40343 622 Vacuolar protein sorting- yes no 0.202 0.096 0.433 8e-11
Q6FQJ1 603 Vacuolar protein sorting- yes no 0.206 0.101 0.409 1e-10
Q5ABD9 841 Vacuolar protein sorting- N/A no 0.260 0.091 0.376 1e-10
Q755J9 604 Vacuolar protein sorting- yes no 0.206 0.100 0.426 2e-10
Q0V8S0 777 Hepatocyte growth factor- yes no 0.202 0.077 0.433 2e-10
O14964 777 Hepatocyte growth factor- yes no 0.226 0.086 0.388 2e-10
>sp|Q9VB70|LST2_DROME Lateral signaling target protein 2 homolog OS=Drosophila melanogaster GN=CG6051 PE=1 SV=3 Back     alignment and function desciption
 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 8/87 (9%)

Query: 2   SIEPPAF---QEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVR 58
           ++ PPA+    +A RC  C+  F  FRRRHHCR CG   C   S+    LP++G+   VR
Sbjct: 900 TLSPPAWIPDGKAPRCMACQTPFTAFRRRHHCRNCGGVFCGVCSNASAPLPKYGLTKAVR 959

Query: 59  VCADCFNSSSRTGKDNLQVSSDGVNSV 85
           VC DC+    R+G     +   GV SV
Sbjct: 960 VCRDCYVREVRSG-----MGVQGVQSV 981




Negative regulator of epidermal growth factor receptor (EGFR) signaling.
Drosophila melanogaster (taxid: 7227)
>sp|B4IC49|LST2_DROSE Lateral signaling target protein 2 homolog OS=Drosophila sechellia GN=GM10129 PE=3 SV=1 Back     alignment and function description
>sp|B4PRU6|LST2_DROYA Lateral signaling target protein 2 homolog OS=Drosophila yakuba GN=GE10583 PE=3 SV=1 Back     alignment and function description
>sp|B3P851|LST2_DROER Lateral signaling target protein 2 homolog OS=Drosophila erecta GN=GG12136 PE=3 SV=1 Back     alignment and function description
>sp|P40343|VPS27_YEAST Vacuolar protein sorting-associated protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS27 PE=1 SV=3 Back     alignment and function description
>sp|Q6FQJ1|VPS27_CANGA Vacuolar protein sorting-associated protein 27 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VPS27 PE=3 SV=1 Back     alignment and function description
>sp|Q5ABD9|VPS27_CANAL Vacuolar protein sorting-associated protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS27 PE=3 SV=1 Back     alignment and function description
>sp|Q755J9|VPS27_ASHGO Vacuolar protein sorting-associated protein 27 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VPS27 PE=3 SV=1 Back     alignment and function description
>sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 Back     alignment and function description
>sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
224141709288 predicted protein [Populus trichocarpa] 0.935 0.961 0.726 1e-114
225463157289 PREDICTED: FYVE and coiled-coil domain-c 0.956 0.979 0.678 1e-111
255550253294 zinc finger protein, putative [Ricinus c 0.952 0.959 0.700 1e-106
357479263292 Protein phosphatase 1 regulatory subunit 0.939 0.952 0.679 1e-104
388513021292 unknown [Medicago truncatula] 0.939 0.952 0.679 1e-104
356565578291 PREDICTED: uncharacterized protein LOC10 0.935 0.951 0.665 1e-103
388513187289 unknown [Lotus japonicus] 0.959 0.982 0.657 1e-103
255647942291 unknown [Glycine max] 0.935 0.951 0.661 1e-102
363808358291 uncharacterized protein LOC100814367 [Gl 0.935 0.951 0.669 1e-102
388504016289 unknown [Lotus japonicus] 0.959 0.982 0.654 1e-102
>gi|224141709|ref|XP_002324207.1| predicted protein [Populus trichocarpa] gi|222865641|gb|EEF02772.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/285 (72%), Positives = 237/285 (83%), Gaps = 8/285 (2%)

Query: 1   MSIEPPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVC 60
           MS EPPAFQEA+RCDVCKCSFNTFRRRHHCRCCGRTLCHEHSS+QM LPQFGI +N RVC
Sbjct: 2   MSTEPPAFQEASRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSNQMALPQFGILSNARVC 61

Query: 61  ADCFNSSSRTGKDNLQVSSDGVNSVTDTFSRLDIDSDKDPKVESVVKRHPVSSVLECKCG 120
           ADCFN+S+R+ K       DGV+S+TD  SRLDID++K PK E   +    + V+ECKCG
Sbjct: 62  ADCFNNSTRSEK------VDGVDSITDKVSRLDIDTEKHPKPEPTTQNQSAAGVIECKCG 115

Query: 121 MPLCICEAPAPAASTETRPPQMKSSSTTAGQSNPKPKKTENTARSRGSTSNSNFSSIFNP 180
           MPLCICEAPA  A T+  P Q+K SST   QSN KPKKT+   ++RGSTS+S  SS+FN 
Sbjct: 116 MPLCICEAPA--AKTDPVPKQVKLSSTFTSQSNSKPKKTDAVPKNRGSTSSSKPSSVFNH 173

Query: 181 GQVTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAAL 240
           GQ+TNG  DKP+M+YEVNGEGLR+AIKNGD  AVKKLLSEGVDAN+ DKQGMSLLHLAAL
Sbjct: 174 GQITNGGVDKPQMDYEVNGEGLREAIKNGDTVAVKKLLSEGVDANYRDKQGMSLLHLAAL 233

Query: 241 FNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKMEE 285
           FNRTDIAFILM+SGA+M+ KNAQGE+PLDCAP TLQYKM+QKMEE
Sbjct: 234 FNRTDIAFILMDSGASMNYKNAQGETPLDCAPATLQYKMKQKMEE 278




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225463157|ref|XP_002268154.1| PREDICTED: FYVE and coiled-coil domain-containing protein 1 isoform 1 [Vitis vinifera] gi|296084844|emb|CBI27726.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255550253|ref|XP_002516177.1| zinc finger protein, putative [Ricinus communis] gi|223544663|gb|EEF46179.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357479263|ref|XP_003609917.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] gi|355510972|gb|AES92114.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|388513021|gb|AFK44572.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356565578|ref|XP_003551016.1| PREDICTED: uncharacterized protein LOC100804827 [Glycine max] Back     alignment and taxonomy information
>gi|388513187|gb|AFK44655.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255647942|gb|ACU24428.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|363808358|ref|NP_001241998.1| uncharacterized protein LOC100814367 [Glycine max] gi|255636154|gb|ACU18419.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388504016|gb|AFK40074.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
TAIR|locus:2057746190 AT2G26210 [Arabidopsis thalian 0.540 0.842 0.526 1.7e-41
DICTYBASE|DDB_G028092393 DDB_G0280923 "ankyrin repeat-c 0.263 0.838 0.407 8.4e-10
UNIPROTKB|Q8EID4105 SO_0908 "Ankyrin domain protei 0.25 0.704 0.368 7.3e-07
TIGR_CMR|SO_0908105 SO_0908 "conserved domain prot 0.25 0.704 0.368 7.3e-07
MGI|MGI:1916549290 Asb9 "ankyrin repeat and SOCS 0.266 0.272 0.369 4.9e-06
UNIPROTKB|Q83EV7131 CBU_0201 "Ankyrin repeat prote 0.243 0.549 0.351 1.2e-05
TIGR_CMR|CBU_0201131 CBU_0201 "ankyrin repeat famil 0.243 0.549 0.351 1.2e-05
UNIPROTKB|Q5ZIZ1172 PPP1R12A "Protein phosphatase 0.273 0.470 0.304 2.5e-05
UNIPROTKB|E2QRR4293 ASB9 "Uncharacterized protein" 0.263 0.266 0.349 4.3e-05
UNIPROTKB|O95271 1327 TNKS "Tankyrase-1" [Homo sapie 0.456 0.101 0.293 6.3e-05
TAIR|locus:2057746 AT2G26210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 440 (159.9 bits), Expect = 1.7e-41, P = 1.7e-41
 Identities = 91/173 (52%), Positives = 116/173 (67%)

Query:   112 SSVLECKCGMPLCICEAPAPAASTETRPPQMKSSSTTAGQSNPKPKKTENTAXXXXXXXX 171
             S  +ECKCGMPLCIC AP P ++ +  PP     +T A    P+  K+E +A        
Sbjct:    29 SETMECKCGMPLCICVAP-PKSTDKPNPP-----ATIAPVVLPQ-LKSEASAKSKGSTSS 81

Query:   172 XXXXXXXXPGQVTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQG 231
                          N   D P+ +YE +GEGLR+AIKNGD+A  KKLL EGVDAN+ D+QG
Sbjct:    82 SNARSAL------NAGLDTPQRDYEASGEGLREAIKNGDSAGAKKLLKEGVDANYRDRQG 135

Query:   232 MSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKME 284
             MS+LHLA LFN+TDIA +LM+ GA+++ KNAQGE+PLDCAP TLQYKMR+KM+
Sbjct:   136 MSVLHLAVLFNQTDIALMLMDHGASLEYKNAQGETPLDCAPATLQYKMREKMK 188


GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
DICTYBASE|DDB_G0280923 DDB_G0280923 "ankyrin repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EID4 SO_0908 "Ankyrin domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0908 SO_0908 "conserved domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
MGI|MGI:1916549 Asb9 "ankyrin repeat and SOCS box-containing 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q83EV7 CBU_0201 "Ankyrin repeat protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0201 CBU_0201 "ankyrin repeat family protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIZ1 PPP1R12A "Protein phosphatase 1 regulatory subunit 12A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRR4 ASB9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95271 TNKS "Tankyrase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
smart0006468 smart00064, FYVE, Protein present in Fab1, YOTB, V 9e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-16
pfam0136368 pfam01363, FYVE, FYVE zinc finger 5e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-16
cd0006557 cd00065, FYVE, FYVE domain; Zinc-binding domain; t 3e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-12
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-08
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-06
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-04
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-04
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.001
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.003
>gnl|CDD|214499 smart00064, FYVE, Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
 Score = 72.9 bits (179), Expect = 9e-17
 Identities = 27/62 (43%), Positives = 36/62 (58%)

Query: 8  FQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCADCFNSS 67
           +E + C  C   FN  +RRHHCR CGR  C + SS +  LP+ GI   VRVC DC+ + 
Sbjct: 7  DEEVSNCMGCGKEFNLTKRRHHCRNCGRIFCSKCSSKKAPLPKLGIERPVRVCDDCYENL 66

Query: 68 SR 69
          + 
Sbjct: 67 NG 68


The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PHD finger and the RING finger. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. The FYVE finger functions in the membrane recruitment of cytosolic proteins by binding to phosphatidylinositol 3-phosphate (PI3P), which is prominent on endosomes. The R+HHC+XCG motif is critical for PI3P binding. Length = 68

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|216454 pfam01363, FYVE, FYVE zinc finger Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238022 cd00065, FYVE, FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 296
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.91
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.9
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02791284 ankyrin-like protein; Provisional 99.85
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.85
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.84
PHA02859209 ankyrin repeat protein; Provisional 99.83
KOG0508 615 consensus Ankyrin repeat protein [General function 99.83
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 99.83
PHA02791 284 ankyrin-like protein; Provisional 99.83
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.82
PHA02878 477 ankyrin repeat protein; Provisional 99.82
PHA02875 413 ankyrin repeat protein; Provisional 99.81
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.81
PHA02875 413 ankyrin repeat protein; Provisional 99.8
PHA03095 471 ankyrin-like protein; Provisional 99.8
PHA02874 434 ankyrin repeat protein; Provisional 99.8
PHA02798 489 ankyrin-like protein; Provisional 99.79
PHA02878 477 ankyrin repeat protein; Provisional 99.79
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.79
PHA02859209 ankyrin repeat protein; Provisional 99.79
PHA02946 446 ankyin-like protein; Provisional 99.79
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 99.79
PHA02884 300 ankyrin repeat protein; Provisional 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.78
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.78
PHA02874 434 ankyrin repeat protein; Provisional 99.78
PHA03100 480 ankyrin repeat protein; Provisional 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.78
PHA02741169 hypothetical protein; Provisional 99.77
PHA02795 437 ankyrin-like protein; Provisional 99.77
PHA03100 480 ankyrin repeat protein; Provisional 99.77
PHA02741169 hypothetical protein; Provisional 99.77
PHA02743166 Viral ankyrin protein; Provisional 99.76
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.76
PHA02884 300 ankyrin repeat protein; Provisional 99.75
PHA03095 471 ankyrin-like protein; Provisional 99.75
PHA02795 437 ankyrin-like protein; Provisional 99.75
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.74
PHA02989 494 ankyrin repeat protein; Provisional 99.74
PHA02876 682 ankyrin repeat protein; Provisional 99.74
PHA02989 494 ankyrin repeat protein; Provisional 99.74
KOG0508 615 consensus Ankyrin repeat protein [General function 99.73
PHA02730 672 ankyrin-like protein; Provisional 99.73
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.73
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.72
KOG0510 929 consensus Ankyrin repeat protein [General function 99.72
PHA02798 489 ankyrin-like protein; Provisional 99.72
PHA02917 661 ankyrin-like protein; Provisional 99.71
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.71
PHA02946 446 ankyin-like protein; Provisional 99.71
KOG0514452 consensus Ankyrin repeat protein [General function 99.7
PHA02917 661 ankyrin-like protein; Provisional 99.69
KOG0514452 consensus Ankyrin repeat protein [General function 99.69
PHA02876 682 ankyrin repeat protein; Provisional 99.68
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.68
PHA02736154 Viral ankyrin protein; Provisional 99.67
KOG1729288 consensus FYVE finger containing protein [General 99.66
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.65
KOG1818 634 consensus Membrane trafficking and cell signaling 99.65
PHA02792 631 ankyrin-like protein; Provisional 99.63
KOG0510 929 consensus Ankyrin repeat protein [General function 99.63
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.63
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 99.62
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.62
PHA02792 631 ankyrin-like protein; Provisional 99.61
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.61
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.61
PHA02730 672 ankyrin-like protein; Provisional 99.6
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 99.59
KOG1819990 consensus FYVE finger-containing proteins [General 99.59
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.59
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.59
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.57
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.56
PTZ00303 1374 phosphatidylinositol kinase; Provisional 99.54
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.52
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.52
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.52
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.51
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.49
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.49
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.48
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.48
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.46
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.45
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.41
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.35
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.33
KOG1842505 consensus FYVE finger-containing protein [General 99.33
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.32
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.19
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.14
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.13
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.12
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 99.08
KOG1841 1287 consensus Smad anchor for receptor activation [Def 99.04
KOG1409404 consensus Uncharacterized conserved protein, conta 99.01
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.99
PF1360630 Ank_3: Ankyrin repeat 98.99
PF1360630 Ank_3: Ankyrin repeat 98.97
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.95
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.94
KOG0522 560 consensus Ankyrin repeat protein [General function 98.94
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.93
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.86
KOG0511 516 consensus Ankyrin repeat protein [General function 98.77
KOG2384 223 consensus Major histocompatibility complex protein 98.62
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.59
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.59
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.57
KOG1843473 consensus Uncharacterized conserved protein [Funct 98.5
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.49
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.31
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.27
KOG2384 223 consensus Major histocompatibility complex protein 98.25
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.23
KOG0511 516 consensus Ankyrin repeat protein [General function 98.23
KOG0522 560 consensus Ankyrin repeat protein [General function 98.2
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 98.05
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.04
KOG1811 1141 consensus Predicted Zn2+-binding protein, contains 97.98
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.83
KOG0230 1598 consensus Phosphatidylinositol-4-phosphate 5-kinas 97.67
KOG2505591 consensus Ankyrin repeat protein [General function 97.58
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.39
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 97.34
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.32
KOG0230 1598 consensus Phosphatidylinositol-4-phosphate 5-kinas 97.29
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.03
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.48
KOG2505591 consensus Ankyrin repeat protein [General function 96.43
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.44
KOG1729288 consensus FYVE finger containing protein [General 94.22
KOG0993542 consensus Rab5 GTPase effector Rabaptin-5 [Intrace 94.2
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 93.66
KOG1841 1287 consensus Smad anchor for receptor activation [Def 93.5
KOG3576267 consensus Ovo and related transcription factors [T 92.18
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.83
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.72
PRK00464154 nrdR transcriptional regulator NrdR; Validated 91.33
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.88
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 90.38
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.29
smart0015439 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C 88.72
PF1371736 zinc_ribbon_4: zinc-ribbon domain 88.5
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 88.04
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 87.88
PHA0276855 hypothetical protein; Provisional 86.78
PF1371937 zinc_ribbon_5: zinc-ribbon domain 86.39
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 86.28
PF1463444 zf-RING_5: zinc-RING finger domain 84.31
COG5151421 SSL1 RNA polymerase II transcription initiation/nu 81.0
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.91  E-value=8.2e-25  Score=173.04  Aligned_cols=123  Identities=26%  Similarity=0.315  Sum_probs=91.2

Q ss_pred             CCCCCCcCccccc-CCCCCCCCCCCCCccccccChHHHHHHHHcCCHHHHHHHHHc-CCCCcccCCCCCcHHHHHHHcCC
Q 022481          166 RGSTSNSNFSSIF-NPGQVTNGATDKPRMEYEVNGEGLRDAIKNGDAAAVKKLLSE-GVDANFCDKQGMSLLHLAALFNR  243 (296)
Q Consensus       166 ~~~~~~~~~~~ll-~~g~~~~~~~~~~~~~~~~~~t~Lh~A~~~g~~~~v~~Ll~~-gadvn~~d~~g~TpLh~A~~~g~  243 (296)
                      .+.+...++.+|+ +.+..+|..|+.||+       |||.|+..|+.++|+.|+.+ |+|+|..+..|.|+||||+-.|+
T Consensus        46 ~S~g~~eiv~fLlsq~nv~~ddkDdaGWt-------Plhia~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r  118 (226)
T KOG4412|consen   46 CSFGHVEIVYFLLSQPNVKPDDKDDAGWT-------PLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGR  118 (226)
T ss_pred             eecCchhHHHHHHhcCCCCCCCccccCCc-------hhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCCh
Confidence            3445666677776 556666666665555       77777777777777777776 77777777777777777777777


Q ss_pred             HHHHHHHHHCCCCCCccCCCCCCHhhHhhhcCcHHHHHHHHHcCCCCCCCCC
Q 022481          244 TDIAFILMESGANMDCKNAQGESPLDCAPVTLQYKMRQKMEEDKNNVGSTTS  295 (296)
Q Consensus       244 ~~iv~~LL~~ga~~~~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~n~  295 (296)
                      .+|+++||++|+.++++|..|.||||.|+..|+++++++|+..||.+|.+|+
T Consensus       119 ~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk  170 (226)
T KOG4412|consen  119 LEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDK  170 (226)
T ss_pred             hhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCCcccc
Confidence            7777777777777777777777777777777777777777777777777764



>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG1729 consensus FYVE finger containing protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00303 phosphatidylinositol kinase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1842 consensus FYVE finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1841 consensus Smad anchor for receptor activation [Defense mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1843 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1811 consensus Predicted Zn2+-binding protein, contains FYVE domain [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0230 consensus Phosphatidylinositol-4-phosphate 5-kinase and related FYVE finger-containing proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0230 consensus Phosphatidylinositol-4-phosphate 5-kinase and related FYVE finger-containing proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG1729 consensus FYVE finger containing protein [General function prediction only] Back     alignment and domain information
>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG1841 consensus Smad anchor for receptor activation [Defense mechanisms] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>smart00154 ZnF_AN1 AN1-like Zinc finger Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-07
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 9e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-06
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 6e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-06
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 8e-06
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-06
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-05
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-05
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-05
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-05
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 3e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-05
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 6e-05
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 7e-05
1uoh_A226 Human Gankyrin Length = 226 7e-05
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-05
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-04
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-04
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-04
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 6e-04
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 7e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 8e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 8e-04
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure

Iteration: 1

Score = 53.5 bits (127), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 29/78 (37%), Positives = 44/78 (56%) Query: 202 LRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKN 261 L +A KNG A VKKLLS+G D N K G + LHLAA +I +L+ GA+++ ++ Sbjct: 13 LHNAAKNGHAEEVKKLLSKGADVNARSKDGNTPLHLAAKNGHAEIVKLLLAKGADVNARS 72 Query: 262 AQGESPLDCAPVTLQYKM 279 G +P A +++ Sbjct: 73 KDGNTPEHLAKKNGHHEI 90
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 2e-25
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 2e-20
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 1e-18
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 2e-18
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 3e-18
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 3e-17
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 9e-17
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 5e-16
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 3e-15
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-14
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-12
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-12
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-04
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-08
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 3e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-12
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-12
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-13
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 7e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 3e-06
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-07
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-10
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-08
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-13
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-11
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-09
3hra_A 201 Ankyrin repeat family protein; structural protein; 1e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-12
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 7e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-10
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 9e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-10
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 1e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-08
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-04
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-12
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-08
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-11
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-10
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-09
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-05
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-09
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 4e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-08
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 6e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-10
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-07
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-04
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 7e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-09
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 6e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-08
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-08
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-04
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 2e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 2e-11
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-11
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-09
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-08
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-11
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-11
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-11
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-10
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-07
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-06
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-10
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-10
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-05
2rfa_A 232 Transient receptor potential cation channel subfa 4e-10
2rfa_A232 Transient receptor potential cation channel subfa 1e-09
2rfa_A232 Transient receptor potential cation channel subfa 4e-08
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-09
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 7e-09
2etb_A256 Transient receptor potential cation channel subfam 1e-08
2etb_A256 Transient receptor potential cation channel subfam 4e-08
2etb_A 256 Transient receptor potential cation channel subfam 4e-06
2etb_A256 Transient receptor potential cation channel subfam 6e-06
2etb_A 256 Transient receptor potential cation channel subfam 8e-05
2pnn_A273 Transient receptor potential cation channel subfa 5e-08
2pnn_A273 Transient receptor potential cation channel subfa 3e-06
2pnn_A 273 Transient receptor potential cation channel subfa 7e-05
2pnn_A273 Transient receptor potential cation channel subfa 3e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-08
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-07
3jxi_A 260 Vanilloid receptor-related osmotically activated p 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-04
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 4e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 5e-04
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Length = 73 Back     alignment and structure
 Score = 95.5 bits (238), Expect = 2e-25
 Identities = 27/64 (42%), Positives = 36/64 (56%)

Query: 2  SIEPPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVCA 61
          S  P  + ++  C +C   F+   R+HHCR CG   C EHSS+ + LP  GI+  VRVC 
Sbjct: 2  SKTPADWIDSDACMICSKKFSLLNRKHHCRSCGGVFCQEHSSNSIPLPDLGIYEPVRVCD 61

Query: 62 DCFN 65
           CF 
Sbjct: 62 SCFE 65


>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Length = 84 Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Length = 226 Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Length = 88 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Length = 220 Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Length = 90 Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Length = 82 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Length = 125 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Length = 120 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.92
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.9
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.9
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.89
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.89
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.89
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.89
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 99.89
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.88
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.88
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.88
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.88
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.88
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.87
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.87
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.87
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.87
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.87
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.87
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 99.87
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.87
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
2rfa_A232 Transient receptor potential cation channel subfa 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.86
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.86
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.86
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.85
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.85
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.85
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.85
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.85
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.85
3hra_A201 Ankyrin repeat family protein; structural protein; 99.85
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 99.85
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.85
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.85
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.85
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 99.85
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.85
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.85
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.85
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.85
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
2etb_A256 Transient receptor potential cation channel subfam 99.85
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.84
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
2rfa_A232 Transient receptor potential cation channel subfa 99.84
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.84
2pnn_A273 Transient receptor potential cation channel subfa 99.84
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.84
3hra_A201 Ankyrin repeat family protein; structural protein; 99.84
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.84
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.84
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.84
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.84
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.84
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.83
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.83
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.83
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.83
2etb_A256 Transient receptor potential cation channel subfam 99.83
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.83
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 99.83
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.83
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.83
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.83
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.83
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.83
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.82
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.82
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.82
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.81
2pnn_A273 Transient receptor potential cation channel subfa 99.81
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.81
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.81
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.8
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.79
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.79
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.78
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.78
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 99.77
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.77
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 99.76
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 99.75
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.69
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.67
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.66
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.64
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.6
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.58
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.57
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.92
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 96.64
1wff_A85 Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc 96.28
1wfh_A64 Zinc finger (AN1-like) family protein; ZF-AN1 doma 96.21
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 95.88
1wfl_A74 Zinc finger protein 216; ZF-AN1 domain, zinc bindi 95.52
1wfp_A74 Zinc finger (AN1-like) family protein; ZF-AN1 doma 95.51
1wg2_A64 Zinc finger (AN1-like) family protein; riken struc 95.33
2csz_A76 Synaptotagmin-like protein 4; exophilin 2, granuph 95.24
1x4w_A67 Hypothetical protein FLJ13222; ZF-AN1 domain, zinc 92.72
1z60_A59 TFIIH basal transcription factor complex P44 subun 92.68
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.92
2a20_A62 Regulating synaptic membrane exocytosis protein 2; 91.27
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 90.88
2ect_A78 Ring finger protein 126; metal binding protein, st 87.54
2ecm_A55 Ring finger and CHY zinc finger domain- containing 86.43
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 85.8
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 85.57
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 85.43
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 85.42
2ysl_A73 Tripartite motif-containing protein 31; ring-type 84.68
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 84.51
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 84.09
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 83.83
2lv2_A85 Insulinoma-associated protein 1; structural genomi 83.8
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 83.76
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 81.54
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 81.24
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 80.91
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 80.5
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 80.47
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.94  E-value=1.5e-26  Score=188.41  Aligned_cols=95  Identities=27%  Similarity=0.391  Sum_probs=69.1

Q ss_pred             ChHHHHHHHHcCCHHHHHHHHHcCCCCcccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCccCCCCCCHhhHhhhcCcH
Q 022481          198 NGEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQY  277 (296)
Q Consensus       198 ~~t~Lh~A~~~g~~~~v~~Ll~~gadvn~~d~~g~TpLh~A~~~g~~~iv~~LL~~ga~~~~~d~~g~TpL~~A~~~g~~  277 (296)
                      |.||||+|+..|+.++|++||++|+++|.+|..|+||||+|+..|+.+++++||++|++++.+|.+|+||||+|+..|+.
T Consensus        70 g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~  149 (169)
T 4gpm_A           70 GRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNE  149 (169)
T ss_dssp             SCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCH
T ss_pred             CCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCH
Confidence            34477777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHHHHHHcCCCCCC
Q 022481          278 KMRQKMEEDKNNVGS  292 (296)
Q Consensus       278 ~iv~~Ll~~gadi~~  292 (296)
                      +++++|+++||+++.
T Consensus       150 ~iv~~Ll~~GA~ie~  164 (169)
T 4gpm_A          150 EVVKLLEKQGGWLEH  164 (169)
T ss_dssp             HHHHHHHTC------
T ss_pred             HHHHHHHHCCCCcCC
Confidence            777777777777764



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>1wff_A Riken cDNA 2810002D23 protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wfh_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1wfl_A Zinc finger protein 216; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.80.1.1 Back     alignment and structure
>1wfp_A Zinc finger (AN1-like) family protein; ZF-AN1 domain, zinc binding, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>1wg2_A Zinc finger (AN1-like) family protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.80.1.1 Back     alignment and structure
>2csz_A Synaptotagmin-like protein 4; exophilin 2, granuphilin, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4w_A Hypothetical protein FLJ13222; ZF-AN1 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 296
d1dvpa272 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila me 3e-17
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-15
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-06
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.004
d1vfya_67 g.50.1.1 (A:) vps27p protein {Baker's yeast (Sacch 5e-15
d1wfka_88 g.50.1.1 (A:) Zinc finger FYVE domain containing p 5e-13
d1joca164 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) 9e-12
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-10
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-08
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.004
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-09
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-04
d1y02a251 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger pro 2e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-05
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-08
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-07
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-07
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-07
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1zbdb_124 g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat 3e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 72 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: FYVE, a phosphatidylinositol-3-phosphate binding domain
domain: Hrs
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score = 72.4 bits (177), Expect = 3e-17
 Identities = 24/69 (34%), Positives = 36/69 (52%)

Query: 1  MSIEPPAFQEATRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSDQMTLPQFGIHTNVRVC 60
           +   P + +   C  C+  F    R+HHCR CG+  C + ++ Q  LP++GI   VRVC
Sbjct: 3  TADTAPNWADGRVCHRCRVEFTFTNRKHHCRNCGQVFCGQCTAKQCPLPKYGIEKEVRVC 62

Query: 61 ADCFNSSSR 69
            CF +  R
Sbjct: 63 DGCFAALQR 71


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.86
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 99.84
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 99.84
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.83
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 99.82
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.82
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.81
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.81
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.79
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.79
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.78
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.78
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.78
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.78
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.78
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.78
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.77
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.76
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.75
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.75
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.75
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.73
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.73
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.73
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.73
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.73
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.72
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 99.61
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.57
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.55
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 99.08
d1wfha_64 Zinc finger A20 and AN1 domains containing protein 96.33
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 96.27
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 95.69
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 95.4
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 93.21
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 88.68
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 86.44
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 85.57
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 84.74
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 82.08
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.92  E-value=1.8e-25  Score=169.40  Aligned_cols=97  Identities=23%  Similarity=0.233  Sum_probs=94.4

Q ss_pred             hHHHHHHHHcCCHHHHHHHHHcCCCCcccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCccCCCCCCHhhHhhhcCcHH
Q 022481          199 GEGLRDAIKNGDAAAVKKLLSEGVDANFCDKQGMSLLHLAALFNRTDIAFILMESGANMDCKNAQGESPLDCAPVTLQYK  278 (296)
Q Consensus       199 ~t~Lh~A~~~g~~~~v~~Ll~~gadvn~~d~~g~TpLh~A~~~g~~~iv~~LL~~ga~~~~~d~~g~TpL~~A~~~g~~~  278 (296)
                      .|||+||++.|+.++|++|+++|+++|.+|..|+||||+|+..|+.+++++|+++|+++|.+|..|+||||+|+..|+.+
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~din~~d~~g~tpLh~A~~~~~~~   82 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVS   82 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTTTCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTTTCCSSSCSCHHHHHHTTTCCH
T ss_pred             ChHHHHHHHCCCHHHHHHHHHhhhccccccccccccccccccccccccccccccccceeeecccccccchhhhhhcCchh
Confidence            36999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCCCCCCC
Q 022481          279 MRQKMEEDKNNVGSTTS  295 (296)
Q Consensus       279 iv~~Ll~~gadi~~~n~  295 (296)
                      ++++|+++|+|++.+|+
T Consensus        83 ~v~~Ll~~Gad~~~~d~   99 (118)
T d1myoa_          83 CVKLLLSKGADKTVKGP   99 (118)
T ss_dssp             HHHHHHTTCCCSSSSSS
T ss_pred             hhhhhhcccccceeeCC
Confidence            99999999999998875



>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfha_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At2g36320 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure