Citrus Sinensis ID: 022525
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| 224085613 | 293 | predicted protein [Populus trichocarpa] | 0.983 | 0.989 | 0.746 | 1e-124 | |
| 255559965 | 293 | Protein mrp, putative [Ricinus communis] | 0.983 | 0.989 | 0.736 | 1e-123 | |
| 224062188 | 260 | predicted protein [Populus trichocarpa] | 0.867 | 0.984 | 0.800 | 1e-118 | |
| 356545830 | 277 | PREDICTED: iron-sulfur protein NUBPL-lik | 0.922 | 0.981 | 0.713 | 1e-114 | |
| 297804198 | 312 | hypothetical protein ARALYDRAFT_492911 [ | 0.898 | 0.849 | 0.720 | 1e-114 | |
| 15235067 | 313 | ATP-binding protein involved in chromoso | 0.898 | 0.846 | 0.720 | 1e-113 | |
| 356536802 | 277 | PREDICTED: iron-sulfur protein NUBPL-lik | 0.901 | 0.960 | 0.722 | 1e-113 | |
| 21537349 | 313 | ATP binding protein-like [Arabidopsis th | 0.877 | 0.827 | 0.737 | 1e-113 | |
| 388502488 | 279 | unknown [Lotus japonicus] | 0.922 | 0.974 | 0.702 | 1e-111 | |
| 147777913 | 341 | hypothetical protein VITISV_031406 [Viti | 0.918 | 0.794 | 0.693 | 1e-111 |
| >gi|224085613|ref|XP_002307635.1| predicted protein [Populus trichocarpa] gi|222857084|gb|EEE94631.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 450 bits (1158), Expect = e-124, Method: Compositional matrix adjust.
Identities = 218/292 (74%), Positives = 247/292 (84%), Gaps = 2/292 (0%)
Query: 1 MKNSFRIFTRLGGVRYYAA-FGSKDLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASK 59
MK +RLG +R Y+ F L+++GVKDVIAVASGKGGVGKSTTAVNLAVALA K
Sbjct: 1 MKGFLGPLSRLGSIRSYSGTFKRSQLRLEGVKDVIAVASGKGGVGKSTTAVNLAVALAIK 60
Query: 60 CQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVW 119
CQLKVGLLDADVYGPSVPMMMKID+KP++T+D KM+PIENYGVKCMSMGFLV +P+VW
Sbjct: 61 CQLKVGLLDADVYGPSVPMMMKIDRKPDITEDKKMIPIENYGVKCMSMGFLVEKDAPIVW 120
Query: 120 RGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALI 179
RGPMVMSAL KM+R VDWGNLDILV+DMPPGTGDAQLT TQ LQLSGALIVSTPQD+AL+
Sbjct: 121 RGPMVMSALVKMTRGVDWGNLDILVVDMPPGTGDAQLTMTQNLQLSGALIVSTPQDIALL 180
Query: 180 DARKGITMFSKVQVPILGLVENMSCFICPHCSEPSFIFGKGGTHRTAAEMGLKVIGEIPI 239
DAR+G MFSKV VPILG VENMS F CPHC EPSFIFGKGG AA MG +GEIP+
Sbjct: 181 DARRGANMFSKVGVPILGFVENMSFFKCPHCGEPSFIFGKGGARNAAASMGHNFLGEIPL 240
Query: 240 EMDIRKGSDDGVPVVISAPDSTVSRAYGEVAVNVVNRLQELAKEQE-HPESN 290
E+D+RKGSD+G+PVVISAPDS +S+AYG+ A NVVN+L+ELAKE HPE N
Sbjct: 241 EVDVRKGSDEGIPVVISAPDSAISKAYGDTAQNVVNKLEELAKEPSLHPEIN 292
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255559965|ref|XP_002521001.1| Protein mrp, putative [Ricinus communis] gi|223539838|gb|EEF41418.1| Protein mrp, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224062188|ref|XP_002300792.1| predicted protein [Populus trichocarpa] gi|222842518|gb|EEE80065.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356545830|ref|XP_003541337.1| PREDICTED: iron-sulfur protein NUBPL-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297804198|ref|XP_002869983.1| hypothetical protein ARALYDRAFT_492911 [Arabidopsis lyrata subsp. lyrata] gi|297315819|gb|EFH46242.1| hypothetical protein ARALYDRAFT_492911 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15235067|ref|NP_193689.1| ATP-binding protein involved in chromosome partitioning [Arabidopsis thaliana] gi|2853081|emb|CAA16931.1| ATP binding protein-like [Arabidopsis thaliana] gi|7268750|emb|CAB78956.1| ATP binding protein-like [Arabidopsis thaliana] gi|110737938|dbj|BAF00906.1| ATP binding protein - like [Arabidopsis thaliana] gi|332658796|gb|AEE84196.1| ATP-binding protein involved in chromosome partitioning [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356536802|ref|XP_003536923.1| PREDICTED: iron-sulfur protein NUBPL-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|21537349|gb|AAM61690.1| ATP binding protein-like [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388502488|gb|AFK39310.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|147777913|emb|CAN75726.1| hypothetical protein VITISV_031406 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| TAIR|locus:2122995 | 313 | INDH "iron-sulfur protein requ | 0.891 | 0.840 | 0.710 | 1.1e-101 | |
| UNIPROTKB|Q8TB37 | 319 | NUBPL "Iron-sulfur protein NUB | 0.864 | 0.799 | 0.578 | 1.3e-75 | |
| UNIPROTKB|E1BE32 | 331 | NUBPL "Uncharacterized protein | 0.864 | 0.770 | 0.570 | 1.5e-74 | |
| DICTYBASE|DDB_G0291193 | 323 | nubpl "Mrp/NBP35 family protei | 0.884 | 0.808 | 0.520 | 6.5e-74 | |
| RGD|1307232 | 319 | Nubpl "nucleotide binding prot | 0.867 | 0.802 | 0.564 | 8.4e-74 | |
| UNIPROTKB|E2REF1 | 333 | NUBPL "Uncharacterized protein | 0.884 | 0.783 | 0.549 | 1.7e-73 | |
| MGI|MGI:1924076 | 319 | Nubpl "nucleotide binding prot | 0.867 | 0.802 | 0.564 | 2.8e-73 | |
| ZFIN|ZDB-GENE-040718-140 | 330 | nubpl "nucleotide binding prot | 0.881 | 0.787 | 0.545 | 3.8e-69 | |
| UNIPROTKB|Q60CU7 | 361 | MCA0052 "MrP protein" [Methylo | 0.877 | 0.717 | 0.480 | 3.7e-68 | |
| UNIPROTKB|F1NG62 | 289 | NUBPL "Uncharacterized protein | 0.755 | 0.771 | 0.584 | 5.1e-67 |
| TAIR|locus:2122995 INDH "iron-sulfur protein required for NADH dehydrogenase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1008 (359.9 bits), Expect = 1.1e-101, P = 1.1e-101
Identities = 189/266 (71%), Positives = 230/266 (86%)
Query: 24 DLKIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKID 83
+L++ GVKD+IAVASGKGGVGKS+TAVNLAVALA+KC+LK+GLLDADVYGPSVP+MM I+
Sbjct: 36 ELRLHGVKDIIAVASGKGGVGKSSTAVNLAVALANKCELKIGLLDADVYGPSVPIMMNIN 95
Query: 84 QKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDIL 143
QKP+V +DMKM+P+ENYGVKCMSMG LV +P+VWRGPMVMSAL KM++ VDWG+LDIL
Sbjct: 96 QKPQVNQDMKMIPVENYGVKCMSMGLLVEKDAPLVWRGPMVMSALAKMTKGVDWGDLDIL 155
Query: 144 VIDMPPGTGDAXXXXXXXXXXSGALIVSTPQDVALIDARKGITMFSKVQVPILGLVENMS 203
V+DMPPGTGDA SGA+IVSTPQDVAL DA +GI+MF KV+VPILGLVENMS
Sbjct: 156 VVDMPPGTGDAQISISQNLKLSGAVIVSTPQDVALADANRGISMFDKVRVPILGLVENMS 215
Query: 204 CFICPHCSEPSFIFGKGGTHRTAAEMGLKVIGEIPIEMDIRKGSDDGVPVVISAPDSTVS 263
CF+CPHC+EPSFIFGK G RTAA+ GLK+IGEIP+EM IR+GSD+GVPVV+S+P S VS
Sbjct: 216 CFVCPHCNEPSFIFGKEGARRTAAKKGLKLIGEIPLEMSIREGSDEGVPVVVSSPGSIVS 275
Query: 264 RAYGEVAVNVVNRLQELAKEQEHPES 289
+AY ++A NVV L+EL +E+P++
Sbjct: 276 KAYQDLAQNVVKGLKEL---RENPDN 298
|
|
| UNIPROTKB|Q8TB37 NUBPL "Iron-sulfur protein NUBPL" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BE32 NUBPL "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291193 nubpl "Mrp/NBP35 family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| RGD|1307232 Nubpl "nucleotide binding protein-like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2REF1 NUBPL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1924076 Nubpl "nucleotide binding protein-like" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-140 nubpl "nucleotide binding protein-like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60CU7 MCA0052 "MrP protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NG62 NUBPL "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00051274 | hypothetical protein (293 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_Genewise1_v1.C_LG_VII0255 | • | • | 0.445 | ||||||||
| fgenesh4_pg.C_scaffold_15960000001 | • | • | 0.425 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| PRK11670 | 369 | PRK11670, PRK11670, antiporter inner membrane prot | 1e-102 | |
| cd02037 | 169 | cd02037, MRP-like, MRP (Multiple Resistance and pH | 2e-94 | |
| COG0489 | 265 | COG0489, Mrp, ATPases involved in chromosome parti | 5e-71 | |
| pfam10609 | 81 | pfam10609, ParA, ParA/MinD ATPase like | 5e-48 | |
| COG0455 | 262 | COG0455, flhG, Antiactivator of flagellar biosynth | 7e-23 | |
| cd02036 | 179 | cd02036, MinD, Bacterial cell division requires th | 7e-21 | |
| TIGR01969 | 251 | TIGR01969, minD_arch, cell division ATPase MinD, a | 1e-20 | |
| COG1192 | 259 | COG1192, Soj, ATPases involved in chromosome parti | 1e-15 | |
| COG1149 | 284 | COG1149, COG1149, MinD superfamily P-loop ATPase c | 2e-15 | |
| pfam01656 | 217 | pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide bi | 5e-15 | |
| cd03110 | 179 | cd03110, Fer4_NifH_child, This protein family's fu | 2e-12 | |
| cd02042 | 104 | cd02042, ParA, ParA and ParB of Caulobacter cresce | 3e-12 | |
| cd02038 | 139 | cd02038, FleN-like, FleN is a member of the Fer4_N | 1e-11 | |
| pfam13614 | 145 | pfam13614, AAA_31, AAA domain | 1e-10 | |
| COG2894 | 272 | COG2894, MinD, Septum formation inhibitor-activati | 3e-08 | |
| cd03111 | 106 | cd03111, CpaE_like, This protein family consists o | 5e-08 | |
| cd01983 | 99 | cd01983, Fer4_NifH, The Fer4_NifH superfamily cont | 1e-07 | |
| TIGR03018 | 207 | TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP- | 1e-07 | |
| TIGR01968 | 261 | TIGR01968, minD_bact, septum site-determining prot | 1e-06 | |
| cd02035 | 217 | cd02035, ArsA, ArsA ATPase functionas as an efflux | 1e-06 | |
| CHL00175 | 281 | CHL00175, minD, septum-site determining protein; V | 3e-06 | |
| pfam09140 | 262 | pfam09140, MipZ, ATPase MipZ | 5e-06 | |
| COG0003 | 322 | COG0003, ArsA, Predicted ATPase involved in chromo | 5e-05 | |
| PHA02518 | 211 | PHA02518, PHA02518, ParA-like protein; Provisional | 7e-05 | |
| TIGR01007 | 204 | TIGR01007, eps_fam, capsular exopolysaccharide fam | 1e-04 | |
| TIGR03029 | 274 | TIGR03029, EpsG, chain length determinant protein | 1e-04 | |
| pfam00142 | 272 | pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster b | 2e-04 | |
| TIGR03815 | 322 | TIGR03815, CpaE_hom_Actino, helicase/secretion nei | 2e-04 | |
| PRK13185 | 270 | PRK13185, chlL, protochlorophyllide reductase iron | 3e-04 | |
| cd02040 | 270 | cd02040, NifH, NifH gene encodes component II (iro | 3e-04 | |
| PRK13230 | 279 | PRK13230, PRK13230, nitrogenase reductase-like pro | 4e-04 | |
| cd02034 | 116 | cd02034, CooC, The accessory protein CooC, which c | 6e-04 | |
| cd02117 | 212 | cd02117, NifH_like, This family contains the NifH | 7e-04 | |
| cd02032 | 267 | cd02032, Bchl_like, This family of proteins contai | 8e-04 | |
| PRK13231 | 264 | PRK13231, PRK13231, nitrogenase reductase-like pro | 8e-04 | |
| TIGR03371 | 246 | TIGR03371, cellulose_yhjQ, cellulose synthase oper | 0.003 | |
| COG1348 | 278 | COG1348, NifH, Nitrogenase subunit NifH (ATPase) [ | 0.004 | |
| TIGR01281 | 268 | TIGR01281, DPOR_bchL, light-independent protochlor | 0.004 |
| >gnl|CDD|183270 PRK11670, PRK11670, antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
Score = 302 bits (775), Expect = e-102
Identities = 126/252 (50%), Positives = 179/252 (71%), Gaps = 2/252 (0%)
Query: 27 IDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKI-DQK 85
++GVK++IAV+SGKGGVGKS+TAVNLA+ALA++ KVG+LDAD+YGPS+P M+ DQ+
Sbjct: 103 VNGVKNIIAVSSGKGGVGKSSTAVNLALALAAE-GAKVGILDADIYGPSIPTMLGAEDQR 161
Query: 86 PEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVI 145
P M PI +G+ S+G+LV + +VWRGPM AL +M +E W +LD LV+
Sbjct: 162 PTSPDGTHMAPIMAHGLATNSIGYLVTDDNAMVWRGPMASKALMQMLQETLWPDLDYLVL 221
Query: 146 DMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPILGLVENMSCF 205
DMPPGTGD QLT Q + ++GA++V+TPQD+ALIDA+KGI MF KV+VP+LG+VENMS
Sbjct: 222 DMPPGTGDIQLTLAQNIPVTGAVVVTTPQDIALIDAKKGIVMFEKVEVPVLGIVENMSMH 281
Query: 206 ICPHCSEPSFIFGKGGTHRTAAEMGLKVIGEIPIEMDIRKGSDDGVPVVISAPDSTVSRA 265
IC +C IFG GG + A + +++G++P+ + +R+ D G P V+S P+S +
Sbjct: 282 ICSNCGHHEPIFGTGGAEKLAEKYHTQLLGQMPLHISLREDLDRGTPTVVSRPESEFTAI 341
Query: 266 YGEVAVNVVNRL 277
Y ++A V +L
Sbjct: 342 YRQLADRVAAQL 353
|
Length = 369 |
| >gnl|CDD|238994 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223563 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|204531 pfam10609, ParA, ParA/MinD ATPase like | Back alignment and domain information |
|---|
| >gnl|CDD|223531 COG0455, flhG, Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >gnl|CDD|238993 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >gnl|CDD|131024 TIGR01969, minD_arch, cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >gnl|CDD|224113 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|216631 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239384 cd03110, Fer4_NifH_child, This protein family's function is unkown | Back alignment and domain information |
|---|
| >gnl|CDD|238997 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >gnl|CDD|238995 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|222264 pfam13614, AAA_31, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|225447 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|239385 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >gnl|CDD|238941 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132063 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEP-CTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >gnl|CDD|131023 TIGR01968, minD_bact, septum site-determining protein MinD | Back alignment and domain information |
|---|
| >gnl|CDD|238992 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >gnl|CDD|214385 CHL00175, minD, septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220125 pfam09140, MipZ, ATPase MipZ | Back alignment and domain information |
|---|
| >gnl|CDD|223082 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|222854 PHA02518, PHA02518, ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130080 TIGR01007, eps_fam, capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >gnl|CDD|132074 TIGR03029, EpsG, chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >gnl|CDD|201032 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family | Back alignment and domain information |
|---|
| >gnl|CDD|234363 TIGR03815, CpaE_hom_Actino, helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|237293 PRK13185, chlL, protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238996 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|183903 PRK13230, PRK13230, nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238991 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >gnl|CDD|239034 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >gnl|CDD|238989 cd02032, Bchl_like, This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >gnl|CDD|183904 PRK13231, PRK13231, nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234188 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >gnl|CDD|224267 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130348 TIGR01281, DPOR_bchL, light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| KOG3022 | 300 | consensus Predicted ATPase, nucleotide-binding [Ce | 100.0 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 100.0 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 100.0 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 100.0 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 100.0 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 100.0 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 100.0 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 100.0 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 100.0 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 100.0 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 100.0 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 100.0 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 100.0 | |
| COG2894 | 272 | MinD Septum formation inhibitor-activating ATPase | 100.0 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 100.0 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 100.0 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 100.0 | |
| PRK13869 | 405 | plasmid-partitioning protein RepA; Provisional | 100.0 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 100.0 | |
| PRK10037 | 250 | cell division protein; Provisional | 100.0 | |
| COG0455 | 262 | flhG Antiactivator of flagellar biosynthesis FleN, | 100.0 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 100.0 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 100.0 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 100.0 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 100.0 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 100.0 | |
| PHA02519 | 387 | plasmid partition protein SopA; Reviewed | 99.98 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 99.98 | |
| PRK13705 | 388 | plasmid-partitioning protein SopA; Provisional | 99.98 | |
| TIGR03453 | 387 | partition_RepA plasmid partitioning protein RepA. | 99.97 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 99.97 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 99.97 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 99.97 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 99.97 | |
| TIGR02016 | 296 | BchX chlorophyllide reductase iron protein subunit | 99.97 | |
| COG0489 | 265 | Mrp ATPases involved in chromosome partitioning [C | 99.96 | |
| cd02033 | 329 | BchX Chlorophyllide reductase converts chlorophyll | 99.96 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 99.96 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 99.96 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 99.96 | |
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 99.95 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 99.95 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 99.95 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 99.95 | |
| PF00142 | 273 | Fer4_NifH: 4Fe-4S iron sulfur cluster binding prot | 99.93 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 99.93 | |
| COG4963 | 366 | CpaE Flp pilus assembly protein, ATPase CpaE [Intr | 99.93 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 99.92 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 99.92 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 99.92 | |
| COG1348 | 278 | NifH Nitrogenase subunit NifH (ATPase) [Inorganic | 99.92 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 99.89 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 99.89 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 99.88 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 99.85 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 99.85 | |
| PF09140 | 261 | MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi | 99.82 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 99.82 | |
| PF13614 | 157 | AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ | 99.8 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 99.67 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 99.59 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 99.57 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 99.54 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 99.52 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 99.5 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 99.49 | |
| PRK13886 | 241 | conjugal transfer protein TraL; Provisional | 99.48 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 99.47 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 99.46 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 99.43 | |
| PRK01077 | 451 | cobyrinic acid a,c-diamide synthase; Validated | 99.42 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 99.41 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 99.41 | |
| PRK13768 | 253 | GTPase; Provisional | 99.41 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 99.4 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 99.38 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 99.38 | |
| KOG2825 | 323 | consensus Putative arsenite-translocating ATPase [ | 99.37 | |
| PRK12374 | 231 | putative dithiobiotin synthetase; Provisional | 99.36 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 99.29 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 99.29 | |
| PF13500 | 199 | AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R | 99.28 | |
| TIGR00313 | 475 | cobQ cobyric acid synthase CobQ. | 99.26 | |
| PRK13505 | 557 | formate--tetrahydrofolate ligase; Provisional | 99.24 | |
| COG0132 | 223 | BioD Dethiobiotin synthetase [Coenzyme metabolism] | 99.22 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 99.19 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 99.19 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 99.19 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 99.17 | |
| PRK05632 | 684 | phosphate acetyltransferase; Reviewed | 99.17 | |
| PF10609 | 81 | ParA: ParA/MinD ATPase like; InterPro: IPR019591 T | 99.17 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 99.16 | |
| PRK00784 | 488 | cobyric acid synthase; Provisional | 99.14 | |
| TIGR00379 | 449 | cobB cobyrinic acid a,c-diamide synthase. This mod | 99.11 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 99.09 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 99.07 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 99.07 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 99.06 | |
| COG1797 | 451 | CobB Cobyrinic acid a,c-diamide synthase [Coenzyme | 99.06 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 99.03 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 99.0 | |
| TIGR00345 | 284 | arsA arsenite-activated ATPase (arsA). The N-termi | 98.99 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 98.98 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 98.89 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 98.88 | |
| PRK06278 | 476 | cobyrinic acid a,c-diamide synthase; Validated | 98.85 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.82 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 98.74 | |
| PRK13896 | 433 | cobyrinic acid a,c-diamide synthase; Provisional | 98.64 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 98.64 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 98.62 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 98.57 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 98.53 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 98.43 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 98.42 | |
| KOG0781 | 587 | consensus Signal recognition particle receptor, al | 98.4 | |
| COG1492 | 486 | CobQ Cobyric acid synthase [Coenzyme metabolism] | 98.37 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 98.26 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 98.21 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 98.14 | |
| cd00477 | 524 | FTHFS Formyltetrahydrofolate synthetase (FTHFS) ca | 98.09 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 98.06 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 97.98 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.97 | |
| PRK13506 | 578 | formate--tetrahydrofolate ligase; Provisional | 97.97 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 97.88 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 97.86 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 97.85 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 97.83 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 97.81 | |
| PLN02974 | 817 | adenosylmethionine-8-amino-7-oxononanoate transami | 97.8 | |
| COG0857 | 354 | Pta BioD-like N-terminal domain of phosphotransace | 97.8 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 97.73 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 97.72 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 97.72 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 97.71 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 97.69 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 97.69 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 97.69 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 97.65 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 97.61 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 97.6 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 97.54 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 97.48 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 97.47 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 97.44 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 97.44 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 97.41 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 97.39 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 97.37 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 97.37 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 97.36 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.35 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 97.35 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 97.33 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 97.33 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 97.32 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 97.31 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 97.3 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 97.28 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 97.27 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 97.27 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 97.26 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 97.26 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 97.25 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 97.23 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 97.22 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 97.2 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 97.19 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 97.19 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 97.17 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 97.12 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.1 | |
| PRK07667 | 193 | uridine kinase; Provisional | 97.1 | |
| KOG1534 | 273 | consensus Putative transcription factor FET5 [Tran | 97.09 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 97.08 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.07 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 97.06 | |
| PRK14495 | 452 | putative molybdopterin-guanine dinucleotide biosyn | 97.05 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 97.04 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 97.04 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 97.04 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 97.03 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 97.0 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 96.99 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 96.99 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.98 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 96.96 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 96.95 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 96.94 | |
| COG2403 | 449 | Predicted GTPase [General function prediction only | 96.92 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.91 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.91 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 96.88 | |
| PF02606 | 326 | LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr | 96.88 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 96.88 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 96.87 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 96.87 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 96.85 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 96.85 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 96.85 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 96.84 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 96.81 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.8 | |
| CHL00071 | 409 | tufA elongation factor Tu | 96.78 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 96.78 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 96.78 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 96.77 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 96.74 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 96.74 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 96.73 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 96.73 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 96.72 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.72 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 96.71 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 96.7 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 96.68 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 96.67 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 96.67 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 96.66 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.65 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 96.65 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 96.63 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 96.62 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 96.62 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 96.61 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 96.61 | |
| KOG2749 | 415 | consensus mRNA cleavage and polyadenylation factor | 96.61 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 96.61 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 96.61 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 96.6 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 96.59 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 96.57 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 96.55 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.54 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 96.54 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 96.53 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 96.52 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 96.52 | |
| PRK14491 | 597 | putative bifunctional molybdopterin-guanine dinucl | 96.51 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 96.5 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 96.48 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 96.47 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 96.47 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 96.46 | |
| TIGR00682 | 311 | lpxK tetraacyldisaccharide 4'-kinase. Also called | 96.44 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.44 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 96.43 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 96.42 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 96.41 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 96.41 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 96.39 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 96.39 | |
| PRK00652 | 325 | lpxK tetraacyldisaccharide 4'-kinase; Reviewed | 96.38 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 96.38 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 96.37 | |
| PF07755 | 301 | DUF1611: Protein of unknown function (DUF1611); In | 96.36 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 96.36 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 96.35 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 96.33 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 96.33 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 96.31 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 96.29 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.28 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 96.25 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 96.24 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 96.21 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 96.2 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 96.2 | |
| COG3367 | 339 | Uncharacterized conserved protein [Function unknow | 96.19 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 96.18 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 96.16 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 96.12 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 96.12 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 96.11 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 96.11 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 96.1 | |
| PLN03118 | 211 | Rab family protein; Provisional | 96.09 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 96.09 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.07 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 96.06 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.05 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.05 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.05 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 96.04 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 96.03 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.02 | |
| KOG0460 | 449 | consensus Mitochondrial translation elongation fac | 96.01 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.98 | |
| cd03113 | 255 | CTGs CTP synthetase (CTPs) is a two-domain protein | 95.97 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 95.96 | |
| PRK06526 | 254 | transposase; Provisional | 95.95 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 95.95 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 95.95 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 95.94 | |
| PLN03108 | 210 | Rab family protein; Provisional | 95.91 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 95.88 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 95.88 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 95.88 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 95.86 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 95.84 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 95.84 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.8 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 95.79 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 95.79 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 95.78 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 95.72 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 95.72 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 95.68 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 95.68 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 95.67 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 95.66 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 95.66 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.64 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 95.61 | |
| KOG0461 | 522 | consensus Selenocysteine-specific elongation facto | 95.6 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 95.58 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 95.55 | |
| PRK11537 | 318 | putative GTP-binding protein YjiA; Provisional | 95.53 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.53 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 95.52 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 95.5 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.49 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 95.47 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 95.46 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 95.46 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.43 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 95.41 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 95.41 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.4 | |
| PRK12377 | 248 | putative replication protein; Provisional | 95.39 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 95.38 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.38 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.37 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 95.37 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 95.37 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 95.36 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.36 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 95.31 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 95.31 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 95.31 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 95.3 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 95.29 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 95.28 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 95.14 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.14 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.13 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 95.12 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 95.12 | |
| PRK06749 | 428 | replicative DNA helicase; Provisional | 95.1 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.06 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 95.06 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 95.05 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 95.05 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.04 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 95.02 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.01 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 95.0 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.0 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 94.97 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 94.95 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 94.94 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 94.94 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 94.93 | |
| PRK01906 | 338 | tetraacyldisaccharide 4'-kinase; Provisional | 94.91 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 94.89 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 94.89 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 94.89 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 94.88 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 94.88 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 94.87 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 94.85 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 94.82 | |
| COG2759 | 554 | MIS1 Formyltetrahydrofolate synthetase [Nucleotide | 94.81 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 94.78 | |
| COG2874 | 235 | FlaH Predicted ATPases involved in biogenesis of a | 94.77 | |
| PRK08181 | 269 | transposase; Validated | 94.77 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 94.77 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 94.72 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 94.71 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 94.7 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 94.68 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 94.66 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 94.65 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.61 | |
| PRK06321 | 472 | replicative DNA helicase; Provisional | 94.59 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 94.56 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 94.55 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 94.51 | |
| PLN02924 | 220 | thymidylate kinase | 94.49 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 94.48 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 94.46 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 94.46 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 94.45 | |
| PRK08116 | 268 | hypothetical protein; Validated | 94.45 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 94.42 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 94.42 | |
| PLN02759 | 637 | Formate--tetrahydrofolate ligase | 94.37 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.36 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.35 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 94.34 | |
| TIGR02475 | 341 | CobW cobalamin biosynthesis protein CobW. A broade | 94.33 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 94.33 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 94.32 | |
| PRK05636 | 505 | replicative DNA helicase; Provisional | 94.31 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 94.29 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.26 | |
| COG1663 | 336 | LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell env | 94.23 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 94.23 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 94.23 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 94.23 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 94.22 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 94.19 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 94.19 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 94.18 | |
| PRK06217 | 183 | hypothetical protein; Validated | 94.17 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 94.16 | |
| KOG3220 | 225 | consensus Similar to bacterial dephospho-CoA kinas | 94.15 | |
| PRK13507 | 587 | formate--tetrahydrofolate ligase; Provisional | 94.12 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 94.12 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 94.1 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 94.09 | |
| KOG0448 | 749 | consensus Mitofusin 1 GTPase, involved in mitochon | 94.09 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 94.03 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 94.02 | |
| PF01268 | 557 | FTHFS: Formate--tetrahydrofolate ligase; InterPro: | 93.95 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 93.94 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 93.93 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 93.88 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 93.83 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 93.83 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 93.81 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 93.77 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 93.77 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 93.74 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 93.72 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 93.68 | |
| COG0523 | 323 | Putative GTPases (G3E family) [General function pr | 93.67 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 93.64 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 93.59 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.59 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 93.57 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 93.56 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 93.55 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.53 | |
| KOG0462 | 650 | consensus Elongation factor-type GTP-binding prote | 93.51 | |
| PLN02200 | 234 | adenylate kinase family protein | 93.51 | |
| KOG0468 | 971 | consensus U5 snRNP-specific protein [Translation, | 93.47 | |
| KOG3062 | 281 | consensus RNA polymerase II elongator associated p | 93.44 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 93.43 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.42 | |
| PF13173 | 128 | AAA_14: AAA domain | 93.39 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 93.3 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 93.27 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 93.24 | |
| PLN02348 | 395 | phosphoribulokinase | 93.21 | |
| PTZ00386 | 625 | formyl tetrahydrofolate synthetase; Provisional | 93.17 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 93.12 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 93.1 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 93.07 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 93.06 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 93.03 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 93.01 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 92.96 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 92.91 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 92.91 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 92.9 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 92.86 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 92.83 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 92.82 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 92.82 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 92.78 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 92.78 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 92.77 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.74 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 92.74 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 92.67 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 92.67 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 92.66 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 92.56 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 92.53 | |
| TIGR03172 | 232 | probable selenium-dependent hydroxylase accessory | 92.5 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 92.48 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 92.42 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 92.32 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 92.3 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 92.24 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 92.19 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 92.17 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 92.13 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.12 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 92.11 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 92.03 | |
| PRK07773 | 886 | replicative DNA helicase; Validated | 92.02 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 92.0 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 92.0 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 91.96 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 91.94 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 91.92 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 91.82 |
| >KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-41 Score=274.19 Aligned_cols=253 Identities=50% Similarity=0.839 Sum_probs=231.3
Q ss_pred ccCCCCeEEEEeeCCCCCcHHHHHHHHHHHHHHhCCCeEEEEEeCCCCCCcccccccCCCccccccCcccc-cccCCcee
Q 022525 26 KIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKDMKMVP-IENYGVKC 104 (295)
Q Consensus 26 ~~~~~~~vI~i~s~kGGvGKTt~a~~LA~~la~~~g~~VlliD~D~~~~~~~~~~g~~~~~~~~~~~~~~~-~~~~~~~~ 104 (295)
++.+...+|+|.|+||||||||+|+|||++||. .|++|.++|.|..+|+++.++|.+.+.-........| ....++.+
T Consensus 42 ~l~~vk~iI~VlSGKGGVGKSTvt~nla~~La~-~g~~vglLD~Dl~GPSiP~m~g~e~~~~~~~~~g~~Pv~~~~~l~~ 120 (300)
T KOG3022|consen 42 NLSGVKHIILVLSGKGGVGKSTVTVNLALALAS-EGKKVGLLDADLCGPSIPRMMGLEGEVVHQSDNGWIPVVVNKNLKL 120 (300)
T ss_pred cccccceEEEEEeCCCCCchhHHHHHHHHHHhc-CCCcEEEEeecccCCCchhhcCCCCceeeecCCCceeeeecCCeEE
Confidence 455567999999999999999999999999999 9999999999999999999999998875555666666 67889999
Q ss_pred eccccccCC-CCCCccCCchHHHHHHHHHHhccCCCccEEEEcCCCCCCccchhhhhhcc-CceEEEeeCCCcchHHHHH
Q 022525 105 MSMGFLVPS-SSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQ-LSGALIVSTPQDVALIDAR 182 (295)
Q Consensus 105 ~~~~~~~~~-~~~~~~~~~~~~~~l~~~~~~l~~~~yD~iiiD~~~~~~~~~~~~~~l~~-ad~viiv~~~~~~s~~~~~ 182 (295)
++.+++... +....|++......++++++...|.+.||+|||||||.++..+++..-.. +|..|||++|...++.++.
T Consensus 121 mS~gfLl~~~~~~vIwRGpkk~~~I~qflk~vdwg~lDyLviDtPPGtsDehls~~~~~~~~~gAviVTTPQ~vAl~Dv~ 200 (300)
T KOG3022|consen 121 MSMGFLLKPRDDSVIWRGPKKNSMIKQFLKDVDWGELDYLVIDTPPGTSDEHLSLVQFLRESDGAVIVTTPQEVALQDVR 200 (300)
T ss_pred EEeeeecCCCCccceeechHHHHHHHHHHhcCCCCCcCEEEEeCCCCCChhhhheeecccccCceEEEeCchhhhhHHHH
Confidence 999998877 67888999999999999999999999999999999999976665544333 3779999999999999999
Q ss_pred HHHHHHhcCCCCeeeEEeccccCCCCCCCCCccccCCchhhHHHHHhCCcEEEeecCCccccccccCCCceEEcCCCChH
Q 022525 183 KGITMFSKVQVPILGLVENMSCFICPHCSEPSFIFGKGGTHRTAAEMGLKVIGEIPIEMDIRKGSDDGVPVVISAPDSTV 262 (295)
Q Consensus 183 ~~~~~l~~~~~~~~~~ViN~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~Ip~~~~~~~a~~~g~~i~~~~~~s~~ 262 (295)
+.++++++.+++++|+|-||....++.+++..+.|...-.+++++.+|+++++.||-++.+.++.+.|.|+++.+|++++
T Consensus 201 K~i~fc~K~~I~ilGvVENMs~f~Cp~C~~~~~iF~~gGg~~l~~~~glp~Lg~iPld~~i~~~~d~G~~~v~~~p~s~~ 280 (300)
T KOG3022|consen 201 KEIDFCRKAGIPILGVVENMSGFVCPKCGHSTNIFGSGGGERLAEELGLPLLGSLPLDPLIAESSDSGVPFVEEYPDSPA 280 (300)
T ss_pred hhhhhhhhcCCceEEEEeccccccCCCCCCcceeccCccHHHHHHHcCCCeEeecCCCHHHHHhccCCCeeEecCCCchH
Confidence 99999999999999999999999999999999999988889999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHH
Q 022525 263 SRAYGEVAVNVVNRLQE 279 (295)
Q Consensus 263 ~~~~~~l~~~l~~~~~~ 279 (295)
+..|++++.+|.+.+..
T Consensus 281 ~~af~~i~~~i~~~~~~ 297 (300)
T KOG3022|consen 281 SEAFEDIAEKLVEQLSS 297 (300)
T ss_pred HHHHHHHHHHHHHhhcc
Confidence 99999999999987754
|
|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >PRK13869 plasmid-partitioning protein RepA; Provisional | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PHA02519 plasmid partition protein SopA; Reviewed | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13705 plasmid-partitioning protein SopA; Provisional | Back alignment and domain information |
|---|
| >TIGR03453 partition_RepA plasmid partitioning protein RepA | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >TIGR02016 BchX chlorophyllide reductase iron protein subunit X | Back alignment and domain information |
|---|
| >COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >PF00142 Fer4_NifH: 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family; InterPro: IPR000392 This entry represents members of the NifH/BchL/ChlL family | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK13886 conjugal transfer protein TraL; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK01077 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2825 consensus Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12374 putative dithiobiotin synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >PF13500 AAA_26: AAA domain; PDB: 3OF5_A 2IOJ_A 4A0G_B 4A0R_A 4A0H_B 4A0F_B 3FMI_C 3FPA_D 3FMF_C 3FGN_A | Back alignment and domain information |
|---|
| >TIGR00313 cobQ cobyric acid synthase CobQ | Back alignment and domain information |
|---|
| >PRK13505 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK05632 phosphate acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK00784 cobyric acid synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00379 cobB cobyrinic acid a,c-diamide synthase | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00345 arsA arsenite-activated ATPase (arsA) | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK06278 cobyrinic acid a,c-diamide synthase; Validated | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13896 cobyrinic acid a,c-diamide synthase; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >cd00477 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13506 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase | Back alignment and domain information |
|---|
| >COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1534 consensus Putative transcription factor FET5 [Transcription] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >COG2403 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >KOG2749 consensus mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >TIGR00682 lpxK tetraacyldisaccharide 4'-kinase | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK00652 lpxK tetraacyldisaccharide 4'-kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >PF07755 DUF1611: Protein of unknown function (DUF1611); InterPro: IPR011669 This entry contains a number of hypothetical bacterial and archaeal proteins | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >COG3367 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03113 CTGs CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11537 putative GTP-binding protein YjiA; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK06749 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >PRK01906 tetraacyldisaccharide 4'-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >COG2759 MIS1 Formyltetrahydrofolate synthetase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK06321 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PLN02759 Formate--tetrahydrofolate ligase | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02475 CobW cobalamin biosynthesis protein CobW | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13507 formate--tetrahydrofolate ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >PF01268 FTHFS: Formate--tetrahydrofolate ligase; InterPro: IPR000559 Formate--tetrahydrofolate ligase (6 | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG0523 Putative GTPases (G3E family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PTZ00386 formyl tetrahydrofolate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07773 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 295 | ||||
| 3kb1_A | 262 | Crystal Structure Of The Nucleotide-Binding Protein | 1e-45 | ||
| 2ph1_A | 262 | Crystal Structure Of Nucleotide-Binding Protein Af2 | 3e-44 | ||
| 3vx3_A | 248 | Crystal Structure Of [nife] Hydrogenase Maturation | 1e-23 | ||
| 1hyq_A | 263 | Mind Bacterial Cell Division Regulator From A. Fulg | 4e-09 | ||
| 1g3q_A | 237 | Crystal Structure Analysis Of Pyrococcus Furiosus C | 7e-07 | ||
| 1ion_A | 243 | The Septum Site-Determining Protein Mind Complexed | 1e-05 |
| >pdb|3KB1|A Chain A, Crystal Structure Of The Nucleotide-Binding Protein Af_226 In Complex With Adp From Archaeoglobus Fulgidus, Northeast Structural Genomics Consortium Target Gr157 Length = 262 | Back alignment and structure |
|
| >pdb|2PH1|A Chain A, Crystal Structure Of Nucleotide-Binding Protein Af2382 From Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr165 Length = 262 | Back alignment and structure |
| >pdb|3VX3|A Chain A, Crystal Structure Of [nife] Hydrogenase Maturation Protein Hypb From Thermococcus Kodakarensis Kod1 Length = 248 | Back alignment and structure |
| >pdb|1HYQ|A Chain A, Mind Bacterial Cell Division Regulator From A. Fulgidus Length = 263 | Back alignment and structure |
| >pdb|1G3Q|A Chain A, Crystal Structure Analysis Of Pyrococcus Furiosus Cell Division Atpase Mind Length = 237 | Back alignment and structure |
| >pdb|1ION|A Chain A, The Septum Site-Determining Protein Mind Complexed With Mg-Adp From Pyrococcus Horikoshii Ot3 Length = 243 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 1e-138 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 2e-27 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 5e-26 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 1e-24 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 2e-21 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 1e-19 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 9e-19 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 8e-13 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 9e-13 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 8e-12 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 9e-11 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 1e-10 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 2e-10 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 2e-10 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 7e-10 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 1e-09 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 1e-09 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 6e-09 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 4e-06 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 1e-05 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 4e-05 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 8e-05 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 1e-04 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 4e-04 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 4e-04 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 7e-04 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 7e-04 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 8e-04 |
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Length = 262 | Back alignment and structure |
|---|
Score = 390 bits (1005), Expect = e-138
Identities = 101/250 (40%), Positives = 144/250 (57%), Gaps = 5/250 (2%)
Query: 26 KIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQK 85
++ +K IAV SGKGGVGKST LAV A + KVG+LDAD GPS+P++ +
Sbjct: 13 RLGKIKSRIAVMSGKGGVGKSTVTALLAVHYARQG-KKVGILDADFLGPSIPILFGLRNA 71
Query: 86 PEVTKDMKMVPI--ENYGVKCMSMGFLVPS-SSPVVWRGPMVMSALRKMSREVDWGNLDI 142
+ P+ + YG+K MSM FL+P ++PV+WRGP++ +R+ V WG LD
Sbjct: 72 RIAVSAEGLEPVLTQKYGIKVMSMQFLLPKENTPVIWRGPLIAGMIREFLGRVAWGELDH 131
Query: 143 LVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDARKGITMFSKVQVPILGLVENM 202
L+ID+PPGTGDA LT Q + +G ++VSTPQ++ + K I M + +LGLVENM
Sbjct: 132 LLIDLPPGTGDAPLTVMQDAKPTGVVVVSTPQELTAVIVEKAINMAEETNTSVLGLVENM 191
Query: 203 SCFICPHCSEPSFIFGKGGTHRTAAEMGLKVIGEIPIEMDIRKGSDDGVPVVISAPDSTV 262
S F+CP+C S+IFG+G A + + IPIE ++ K +D G D
Sbjct: 192 SYFVCPNCGHKSYIFGEGKGESLAKKYNIGFFTSIPIEEELIKLADSGRIEEYE-KDWFE 250
Query: 263 SRAYGEVAVN 272
S + E +
Sbjct: 251 SAPFLEHHHH 260
|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Length = 245 | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Length = 254 | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Length = 263 | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Length = 260 | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Length = 373 | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Length = 237 | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Length = 209 | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Length = 206 | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Length = 286 | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Length = 299 | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Length = 267 | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Length = 271 | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Length = 286 | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Length = 298 | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Length = 257 | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Length = 398 | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Length = 361 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Length = 403 | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Length = 334 | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Length = 349 | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Length = 289 | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Length = 589 | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Length = 374 | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Length = 354 | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Length = 348 | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Length = 329 | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 324 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 100.0 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 100.0 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 100.0 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 100.0 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 100.0 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 100.0 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 100.0 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 100.0 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 100.0 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 100.0 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 100.0 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 100.0 | |
| 3pg5_A | 361 | Uncharacterized protein; structural genomics, PSI- | 100.0 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 99.98 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 99.97 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 99.97 | |
| 3ez2_A | 398 | Plasmid partition protein A; type IA, DNA binding, | 99.97 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 99.97 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 99.97 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 99.97 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 99.96 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 99.96 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 99.94 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 99.93 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 99.91 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 99.88 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 99.88 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 99.88 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 99.87 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 99.85 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.78 | |
| 3igf_A | 374 | ALL4481 protein; two-domained protein consisting o | 99.77 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 99.76 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 99.7 | |
| 3of5_A | 228 | Dethiobiotin synthetase; structural genomics, cent | 99.63 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 99.63 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 99.6 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 99.58 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 99.56 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 99.54 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 99.53 | |
| 3qxc_A | 242 | Dethiobiotin synthetase; DTBS, structural genomics | 99.53 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 99.49 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 99.46 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 99.44 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 99.39 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 99.29 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 99.26 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 99.13 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 99.11 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 98.92 | |
| 4a0g_A | 831 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 98.62 | |
| 3pzx_A | 557 | Formate--tetrahydrofolate ligase; HET: TOE; 2.20A | 98.56 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 98.49 | |
| 2obn_A | 349 | Hypothetical protein; structural genomics, joint c | 98.48 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 98.42 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 98.31 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 98.21 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.06 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 97.93 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.92 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 97.74 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 97.72 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 97.72 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 97.69 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 97.69 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 97.68 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 97.67 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.62 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.61 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 97.6 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.56 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 97.51 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 97.5 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 97.43 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 97.42 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 97.42 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 97.41 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 97.38 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 97.37 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 97.36 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 97.36 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 97.35 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 97.34 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 97.33 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 97.28 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 97.26 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 97.26 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 97.25 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 97.24 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 97.23 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 97.2 | |
| 2g0t_A | 350 | Conserved hypothetical protein; structural genomic | 97.17 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 97.17 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.16 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 97.16 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 97.15 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 97.12 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 97.11 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 97.11 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 97.11 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 97.1 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 97.09 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 97.09 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 97.06 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 97.05 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 97.05 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 97.04 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 97.0 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 96.99 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 96.99 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 96.98 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 96.98 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 96.97 | |
| 1s1m_A | 545 | CTP synthase; CTP synthetase, UTP:ammonia ligase ( | 96.96 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 96.95 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 96.95 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 96.94 | |
| 1vco_A | 550 | CTP synthetase; tetramer, riken structural genomic | 96.9 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 96.9 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 96.89 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 96.88 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 96.88 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.88 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 96.88 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 96.87 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 96.86 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 96.84 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 96.84 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 96.83 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 96.8 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 96.8 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 96.79 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.79 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 96.76 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 96.76 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.75 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 96.74 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 96.73 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 96.71 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 96.71 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 96.7 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 96.68 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 96.67 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 96.65 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 96.63 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 96.62 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 96.61 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 96.6 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 96.59 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 96.59 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 96.57 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 96.56 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 96.49 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 96.48 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 96.41 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.37 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.36 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.33 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.33 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 96.31 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 96.22 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.2 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.18 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 96.18 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.16 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.16 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.15 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 96.14 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 96.13 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 96.13 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 96.12 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 96.1 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.04 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 96.02 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 96.02 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.02 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 96.0 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 95.98 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 95.95 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 95.91 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 95.83 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 95.78 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 95.77 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 95.77 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 95.75 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 95.75 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 95.75 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.65 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.62 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 95.55 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.55 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 95.54 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 95.53 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 95.39 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 95.37 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 95.35 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 95.34 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 95.32 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.29 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 95.23 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 95.2 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 95.13 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 95.13 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.09 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 95.07 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 95.04 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 95.02 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 95.01 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 94.94 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 94.79 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 94.76 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.74 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.71 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 94.7 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.69 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 94.67 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 94.66 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 94.6 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 94.55 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 94.52 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 94.48 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 94.43 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.39 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 94.35 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 94.27 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 94.27 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.27 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 94.25 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 94.24 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.14 | |
| 3do6_A | 543 | Formate--tetrahydrofolate ligase; TM1766, putative | 94.07 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 94.06 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 94.04 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 94.03 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 94.01 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 94.0 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 93.97 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 93.97 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 93.95 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 93.9 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 93.87 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 93.87 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 93.87 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 93.86 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 93.79 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 93.78 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 93.76 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 93.73 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 93.62 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 93.61 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 93.59 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 93.57 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 93.54 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 93.53 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 93.51 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 93.5 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 93.49 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 93.45 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 93.32 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 93.29 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 93.27 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 93.24 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 93.19 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 93.17 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 93.17 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 93.16 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 93.06 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 93.03 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 93.02 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 93.01 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 92.99 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 92.92 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 92.78 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 92.76 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 92.74 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 92.73 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 92.61 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 92.61 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 92.57 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 92.54 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 92.51 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 92.51 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 92.49 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 92.48 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 92.47 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 92.44 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 92.44 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 92.39 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 92.38 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 92.37 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 92.36 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 92.31 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 92.29 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 92.29 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 92.28 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 92.22 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 92.2 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 92.15 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 92.1 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 92.08 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 92.07 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 92.01 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 92.01 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 92.0 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 91.94 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 91.89 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 91.88 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 91.83 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 91.82 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 91.81 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 91.79 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 91.69 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 91.66 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 91.61 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 91.6 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 91.59 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 91.58 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 91.57 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 91.52 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 91.34 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 91.32 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 91.31 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 91.24 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 90.98 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 90.96 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 90.96 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 90.95 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 90.87 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 90.85 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 90.82 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 90.73 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 90.71 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 90.7 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 90.7 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 90.55 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 90.43 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 90.4 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 90.39 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 90.37 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 90.31 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 90.27 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 90.23 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 90.23 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 90.11 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 90.01 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 89.99 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 89.96 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 89.96 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 89.93 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 89.86 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 89.83 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 89.8 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 89.74 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 89.72 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 89.65 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 89.61 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 89.56 | |
| 3nrs_A | 437 | Dihydrofolate:folylpolyglutamate synthetase; struc | 89.55 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 89.54 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 89.53 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 89.52 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 89.51 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 89.49 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 89.47 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 89.43 | |
| 2c5m_A | 294 | CTP synthase; cytidine 5-prime triphosphate synthe | 89.33 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 89.33 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 89.27 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 89.18 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 89.16 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.99 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 88.98 | |
| 1w78_A | 422 | FOLC bifunctional protein; DHFS, dihydrofolate syn | 88.96 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 88.92 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 88.85 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 88.83 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 88.79 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.76 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 88.71 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 88.71 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 88.68 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 88.66 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 88.58 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 88.56 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 88.54 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 88.48 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 88.43 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 88.37 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 88.36 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 88.33 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 88.32 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 88.28 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 88.16 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 88.11 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 88.07 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 87.97 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 87.93 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 87.89 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 87.77 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 87.69 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 87.37 | |
| 2vos_A | 487 | Folylpolyglutamate synthase protein FOLC; ligase, | 87.31 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 87.16 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 87.14 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 87.13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 87.07 | |
| 1jbw_A | 428 | Folylpolyglutamate synthase; FPGS folate AMPPCP te | 87.03 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 86.99 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 86.97 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 86.79 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 86.7 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 86.69 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 86.5 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 86.44 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 86.18 | |
| 3nva_A | 535 | CTP synthase; rossman fold, nucleotide binding, LI | 86.16 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 86.12 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 85.97 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 85.89 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 85.71 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 85.63 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 85.57 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 85.57 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 85.49 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 85.45 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 85.45 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 85.32 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 85.17 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 85.05 | |
| 1e8c_A | 498 | UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diami | 85.04 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 84.95 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 84.68 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 84.65 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 84.59 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 84.59 | |
| 2vo1_A | 295 | CTP synthase 1; pyrimidine biosynthesis, glutamine | 84.57 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 84.53 | |
| 1o5z_A | 442 | Folylpolyglutamate synthase/dihydrofolate synthas; | 84.41 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 84.36 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 84.18 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 84.17 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 84.12 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 84.11 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 84.06 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 84.0 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 83.83 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 83.7 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 83.66 | |
| 2wtz_A | 535 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-di | 83.5 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 83.49 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 83.4 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 83.27 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 83.19 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 82.94 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 82.92 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 82.89 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 82.81 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 82.8 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 82.68 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 82.64 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 82.54 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 82.53 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 82.46 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 82.38 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 82.31 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 82.27 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 82.06 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 82.06 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 82.03 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 81.98 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 81.97 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 81.83 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 81.81 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 81.72 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 81.64 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 81.61 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 81.57 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 81.55 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 81.49 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 81.46 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 81.42 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 81.33 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 81.27 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 81.21 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 81.16 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 81.11 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 81.03 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 81.02 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 80.79 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 80.77 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 80.68 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 80.59 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 80.59 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 80.53 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 80.52 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 80.48 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 80.45 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 80.38 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 80.31 |
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.3e-36 Score=251.29 Aligned_cols=226 Identities=17% Similarity=0.167 Sum_probs=179.6
Q ss_pred CCCeEEEEeeCCCCCcHHHHHHHHHHHHHHhC-CCeEEEEEeCCCCCCccccc-ccCCCccccccCc------------c
Q 022525 29 GVKDVIAVASGKGGVGKSTTAVNLAVALASKC-QLKVGLLDADVYGPSVPMMM-KIDQKPEVTKDMK------------M 94 (295)
Q Consensus 29 ~~~~vI~i~s~kGGvGKTt~a~~LA~~la~~~-g~~VlliD~D~~~~~~~~~~-g~~~~~~~~~~~~------------~ 94 (295)
+++++|+|+|.|||+||||+|+|||..||+ . |+||++||+|+|.++++.++ +..+..++.+... .
T Consensus 2 ~~~~vI~v~s~kGGvGKTt~a~~LA~~la~-~~g~~VlliD~D~~~~~l~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~ 80 (245)
T 3ea0_A 2 NAKRVFGFVSAKGGDGGSCIAANFAFALSQ-EPDIHVLAVDISLPFGDLDMYLSGNTHSQDLADISNASDRLDKSLLDTM 80 (245)
T ss_dssp -CCEEEEEEESSTTSSHHHHHHHHHHHHTT-STTCCEEEEECCTTTCCGGGGTCSSCCSCCHHHHHHTGGGCCHHHHHHH
T ss_pred CCCeEEEEECCCCCcchHHHHHHHHHHHHh-CcCCCEEEEECCCCCCCHHHHhCCCCCCCCHHHHHhhHhhhhHHHHHHH
Confidence 357999999999999999999999999999 8 99999999999988988888 5555544443211 1
Q ss_pred cccccCCceeeccccccCCCCCCccCCchHHHHHHHHHHhccCCCccEEEEcCCCCCCccchhhhhhccCceEEEeeCCC
Q 022525 95 VPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQ 174 (295)
Q Consensus 95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~yD~iiiD~~~~~~~~~~~~~~l~~ad~viiv~~~~ 174 (295)
......++++++.+.. ...........+..+++.++ +.||+|||||||+++ ......+..+|.+|+|+.++
T Consensus 81 ~~~~~~~l~~l~~~~~------~~~~~~~~~~~l~~~l~~l~-~~yD~viiD~p~~~~--~~~~~~l~~ad~viiv~~~~ 151 (245)
T 3ea0_A 81 VQHISPSLDLIPSPAT------FEKIVNIEPERVSDLIHIAA-SFYDYIIVDFGASID--HVGVWVLEHLDELCIVTTPS 151 (245)
T ss_dssp SEEEETTEEEECCCSS------HHHHHHCCHHHHHHHHHHHH-HHCSEEEEEEESSCC--TTHHHHGGGCSEEEEEECSS
T ss_pred hEecCCCeEEEcCCCC------hHhhhcCCHHHHHHHHHHHH-hhCCEEEEeCCCCCc--hHHHHHHHHCCEEEEEecCc
Confidence 1223356666654321 11111122467888888888 799999999999987 45566788899999999999
Q ss_pred cchHHHHHHHHHHHhcCC--CCeeeEEeccccCCCCCCCCCccccCCchhhHHHHHhCCcEEEeecCCc-cccccccCCC
Q 022525 175 DVALIDARKGITMFSKVQ--VPILGLVENMSCFICPHCSEPSFIFGKGGTHRTAAEMGLKVIGEIPIEM-DIRKGSDDGV 251 (295)
Q Consensus 175 ~~s~~~~~~~~~~l~~~~--~~~~~~ViN~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~Ip~~~-~~~~a~~~g~ 251 (295)
..++..+.++++.+++.+ ...+++|+|+++.... ...+++.+.+|.++++.||++. .+.++...|+
T Consensus 152 ~~~~~~~~~~~~~l~~~~~~~~~~~~v~N~~~~~~~-----------~~~~~~~~~~~~~v~~~ip~~~~~~~~a~~~g~ 220 (245)
T 3ea0_A 152 LQSLRRAGQLLKLCKEFEKPISRIEIILNRADTNSR-----------ITSDEIEKVIGRPISKRIPQDEDAMQESLLSGQ 220 (245)
T ss_dssp HHHHHHHHHHHHHHHTCSSCCSCEEEEEESTTSCTT-----------SCHHHHHHHHTSCEEEEECCCHHHHHHHHHHTS
T ss_pred HHHHHHHHHHHHHHHHhCCCccceEEEEecCCCCCC-----------CCHHHHHHHhCCCeEEECCCChHHHHHHHHcCC
Confidence 999999999999998876 5678999999974311 1246788889999999999996 7999999999
Q ss_pred ceEEcCCCChHHHHHHHHHHHHHH
Q 022525 252 PVVISAPDSTVSRAYGEVAVNVVN 275 (295)
Q Consensus 252 ~i~~~~~~s~~~~~~~~l~~~l~~ 275 (295)
|++++.|+++++++|++|+++|++
T Consensus 221 ~v~~~~~~s~~~~~~~~la~~l~g 244 (245)
T 3ea0_A 221 SVLKVAPKSQLSKTIVDWALHLNG 244 (245)
T ss_dssp CHHHHCTTSHHHHHHHHHHHCC--
T ss_pred CccccCCCCHHHHHHHHHHHHHhC
Confidence 999999999999999999998865
|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3of5_A Dethiobiotin synthetase; structural genomics, center for structural genomics of infec diseases, csgid, ligase; 1.52A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3qxc_A Dethiobiotin synthetase; DTBS, structural genomics, ATP BIND biology, protein structure initiative, midwest center for S genomics, MCSG; HET: ATP; 1.34A {Helicobacter pylori} PDB: 3mle_A* 3qxh_A* 3qxj_A* 3qxs_A* 3qxx_A* 3qy0_A* 2qmo_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2obn_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: PG4; 2.30A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2g0t_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.67A {Thermotoga maritima} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3do6_A Formate--tetrahydrofolate ligase; TM1766, putative formyltetrahydrofolate synthetase, structural genomics; HET: MSE; 1.85A {Thermotoga maritima} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* 3pyz_A* 3qcz_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2vos_A Folylpolyglutamate synthase protein FOLC; ligase, peptidoglycan synthesis, cell division; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2vo1_A CTP synthase 1; pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphos synthetase, UTP; 2.8A {Homo sapiens} SCOP: c.37.1.10 PDB: 3ihl_A* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1o5z_A Folylpolyglutamate synthase/dihydrofolate synthas; TM0166, structural genomics, JC protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, C shape; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} PDB: 2xja_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 295 | ||||
| d1ihua2 | 279 | c.37.1.10 (A:308-586) Arsenite-translocating ATPas | 4e-35 | |
| d1cp2a_ | 269 | c.37.1.10 (A:) Nitrogenase iron protein {Clostridi | 9e-35 | |
| d1g3qa_ | 237 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 2e-34 | |
| d2afhe1 | 289 | c.37.1.10 (E:1-289) Nitrogenase iron protein {Azot | 7e-33 | |
| d1hyqa_ | 232 | c.37.1.10 (A:) Cell division regulator MinD {Archa | 8e-31 | |
| d1ihua1 | 296 | c.37.1.10 (A:1-296) Arsenite-translocating ATPase | 3e-24 | |
| d1byia_ | 224 | c.37.1.10 (A:) Dethiobiotin synthetase {Escherichi | 2e-21 | |
| d1ls1a2 | 207 | c.37.1.10 (A:89-295) GTPase domain of the signal s | 3e-06 | |
| d1bifa1 | 213 | c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct | 0.002 |
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 279 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Arsenite-translocating ATPase ArsA species: Escherichia coli [TaxId: 562]
Score = 126 bits (316), Expect = 4e-35
Identities = 36/219 (16%), Positives = 66/219 (30%), Gaps = 33/219 (15%)
Query: 26 KIDGVKDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDAD-------VYGPSVPM 78
I + + + GKGGVGK+T A +AV LA V L +D S+
Sbjct: 14 DIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADM-GFDVHLTTSDPAAHLSMTLNGSLNN 72
Query: 79 MMKIDQKPEVTKDMKMVPIENYGVKCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWG 138
+ P + + K + + ++ + SR +
Sbjct: 73 LQVSRIDPHEETERYRQHVLETKGKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREA 132
Query: 139 NLDILVIDMPP-------------------------GTGDAQLTTTQTLQLSGALIVSTP 173
+V+D P G + Q + + L+V+ P
Sbjct: 133 GKRFVVMDTAPTGHTLLLLDATGAYHREIAKKMGEKGHFTTPMMLLQDPERTKVLLVTLP 192
Query: 174 QDVALIDARKGITMFSKVQVPILGLVENMSCFICPHCSE 212
+ +++A + + G + N S I S
Sbjct: 193 ETTPVLEAANLQADLERAGIHPWGWIINNSLSIADTRSP 231
|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Length = 269 | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 237 | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Length = 289 | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 232 | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Length = 296 | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Length = 224 | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Length = 207 | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 100.0 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 100.0 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 100.0 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 100.0 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.89 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 99.87 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 99.85 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 99.2 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 99.13 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 99.11 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 99.03 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 98.99 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 98.75 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 98.54 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 98.45 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.35 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 98.2 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 98.18 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.92 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 97.86 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 97.68 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.6 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 97.26 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.24 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.24 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.17 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 97.16 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 97.15 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 97.12 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 97.09 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.09 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 96.9 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 96.87 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 96.83 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 96.82 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 96.8 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 96.74 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.73 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 96.72 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.69 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 96.65 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 96.64 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 96.63 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.63 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 96.62 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.58 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.57 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 96.54 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.51 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 96.5 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 96.47 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 96.42 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.39 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.37 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 96.34 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 96.31 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.3 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.28 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 96.28 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 96.28 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 96.27 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 96.27 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 96.22 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.11 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 96.11 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 96.01 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.0 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 95.98 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.86 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 95.86 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 95.86 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.81 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.78 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.71 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 95.7 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 95.64 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.61 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 95.6 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.58 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.5 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.48 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 95.39 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 95.38 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.37 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 95.32 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.32 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.27 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.07 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 95.06 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 94.83 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 94.75 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.66 | |
| d1e8ca3 | 234 | UDP-N-acetylmuramyl tripeptide synthetase MurE {Es | 94.65 | |
| d1eg7a_ | 549 | Formyltetrahydrofolate synthetase {Moorella thermo | 94.64 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 94.41 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 94.4 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.36 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.24 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 94.09 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 94.09 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 93.97 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 93.88 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.83 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 93.73 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.58 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 93.56 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 93.52 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 93.46 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 93.43 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.29 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 93.19 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 93.13 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 93.08 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 93.06 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.04 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 92.94 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 92.91 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.63 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.5 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 92.41 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 92.37 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 92.25 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 92.12 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 92.1 | |
| d1s1ma2 | 266 | CTP synthase PyrG, N-terminal domain {Escherichia | 92.08 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.96 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 91.82 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 91.75 | |
| d2gc6a2 | 296 | Folylpolyglutamate synthetase {Lactobacillus casei | 91.74 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.51 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 91.39 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 91.2 | |
| d1o5za2 | 296 | Folylpolyglutamate synthetase {Thermotoga maritima | 91.19 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 91.17 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 90.94 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 90.88 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 90.72 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 90.63 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.42 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 90.12 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 89.83 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 89.82 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 89.66 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 89.52 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 89.49 | |
| d2jfga3 | 204 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 89.4 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 89.25 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 89.1 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 88.93 | |
| d2g0ta1 | 338 | Hypothetical protein TM0796 {Thermotoga maritima [ | 88.83 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 88.65 | |
| d1j6ua3 | 207 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 88.54 | |
| d1gg4a4 | 214 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 88.44 | |
| d1p3da3 | 215 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 88.3 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 88.17 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 88.08 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 88.07 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 88.04 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 87.97 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 87.86 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 87.67 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 87.43 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 87.41 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 87.28 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 87.01 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 86.97 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 86.77 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 86.63 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 86.61 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 86.44 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 86.39 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 86.03 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 86.01 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 85.61 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 85.5 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 85.13 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 85.0 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 84.91 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 84.67 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 84.43 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 84.43 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 84.42 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 84.22 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 84.05 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 83.94 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 83.88 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 83.8 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 83.8 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 83.6 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 83.53 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 83.39 | |
| d2vo1a1 | 273 | CTP synthase PyrG, N-terminal domain {Human (Homo | 83.34 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 83.19 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 83.09 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 83.04 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 82.99 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 82.91 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 82.87 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 82.87 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 82.66 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 82.56 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 82.41 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 82.17 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 82.16 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 82.09 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 81.96 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 81.94 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 81.81 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 81.72 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 81.72 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 81.71 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 81.7 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 81.66 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 81.57 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 81.56 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 81.44 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 81.44 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 81.43 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 81.43 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 81.37 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 81.3 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 81.2 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 80.82 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 80.75 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.49 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 80.34 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 80.33 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 80.29 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 80.24 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.03 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 80.03 | |
| d1vcoa2 | 272 | CTP synthase PyrG, N-terminal domain {Thermus ther | 80.02 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 80.01 |
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nitrogenase iron protein-like domain: Cell division regulator MinD species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
Probab=100.00 E-value=2.5e-38 Score=262.24 Aligned_cols=223 Identities=27% Similarity=0.387 Sum_probs=180.8
Q ss_pred CeEEEEeeCCCCCcHHHHHHHHHHHHHHhCCCeEEEEEeCCCCCCcccccccCCCcccccc--------CcccccccCCc
Q 022525 31 KDVIAVASGKGGVGKSTTAVNLAVALASKCQLKVGLLDADVYGPSVPMMMKIDQKPEVTKD--------MKMVPIENYGV 102 (295)
Q Consensus 31 ~~vI~i~s~kGGvGKTt~a~~LA~~la~~~g~~VlliD~D~~~~~~~~~~g~~~~~~~~~~--------~~~~~~~~~~~ 102 (295)
||+|+|+|+||||||||+|+|||.+||+ +|++|++||+|+++++++.++|.++....... .........++
T Consensus 1 ~kvIav~s~KGGvGKTtia~nlA~~la~-~g~~VlliD~D~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (232)
T d1hyqa_ 1 VRTITVASGKGGTGKTTITANLGVALAQ-LGHDVTIVDADITMANLELILGMEGLPVTLQNVLAGEARIDEAIYVGPGGV 79 (232)
T ss_dssp CEEEEEEESSSCSCHHHHHHHHHHHHHH-TTCCEEEEECCCSSSSHHHHTTCCCCCCCHHHHHTTSSCGGGGCEECGGGC
T ss_pred CEEEEEECCCCCChHHHHHHHHHHHHHh-CCCCEEEEeCCCCCCCHHHHhCCCcCcchhhhhhccccccccccccCCccc
Confidence 6999999999999999999999999999 99999999999999999999998764332211 11112223344
Q ss_pred eeeccccccCCCCCCccCCchHHHHHHHHHHhccCCCccEEEEcCCCCCCccchhhhhhccCceEEEeeCCCcchHHHHH
Q 022525 103 KCMSMGFLVPSSSPVVWRGPMVMSALRKMSREVDWGNLDILVIDMPPGTGDAQLTTTQTLQLSGALIVSTPQDVALIDAR 182 (295)
Q Consensus 103 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~yD~iiiD~~~~~~~~~~~~~~l~~ad~viiv~~~~~~s~~~~~ 182 (295)
.+++.+ .............+..+++.++ ..||+||+|+||+++ ......+..+|.+++|+.++..++..+.
T Consensus 80 ~~l~~~------~~~~~~~~~~~~~l~~~l~~l~-~~~D~viiD~~~~~~--~~~~~~l~~ad~v~~v~~~~~~~~~~~~ 150 (232)
T d1hyqa_ 80 KVVPAG------VSLEGLRKANPEKLEDVLTQIM-ESTDILLLDAPAGLE--RSAVIAIAAAQELLLVVNPEISSITDGL 150 (232)
T ss_dssp EEEECC------SCHHHHHHHCHHHHHHHHHHHH-HTCSEEEEECCSSSS--HHHHHHHHHSSEEEEEECSSHHHHHHHH
T ss_pred eeEeee------cccccccccchhhHHHHHHHHh-hccceeeeccccccc--chhHHHhhhhheeeeeccccccchhhhh
Confidence 444432 2211122233567888888888 899999999999998 5566677789999999999999999999
Q ss_pred HHHHHHhcCCCCeeeEEeccccCCCCCCCCCccccCCchhhHHHHHhCCcEEEeecCCccccccccCCCceEEcCCCChH
Q 022525 183 KGITMFSKVQVPILGLVENMSCFICPHCSEPSFIFGKGGTHRTAAEMGLKVIGEIPIEMDIRKGSDDGVPVVISAPDSTV 262 (295)
Q Consensus 183 ~~~~~l~~~~~~~~~~ViN~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~Ip~~~~~~~a~~~g~~i~~~~~~s~~ 262 (295)
+.+..+++.+.+++++|+|+++.. .. ....+++.+.++.++++.||+++.+.++...|+|+.++.|++++
T Consensus 151 ~~~~~~~~~~~~~~~iv~N~~~~~-------~~---~~~~~~i~~~~~~~~~~~IP~d~~~~~a~~~g~p~~~~~p~s~~ 220 (232)
T d1hyqa_ 151 KTKIVAERLGTKVLGVVVNRITTL-------GI---EMAKNEIEAILEAKVIGLIPEDPEVRRAAAYGKPVVLRSPNSPA 220 (232)
T ss_dssp HHHHHHHHHTCEEEEEEEEEECTT-------TH---HHHHHHHHHHTTSCEEEEEECCHHHHHHHHHTSCHHHHCTTSHH
T ss_pred hhhhhhhhcccccccccccccccc-------cc---cchhhhHHhhcCCeEEEECCCCHHHHHHHHCCceEEEECCCCHH
Confidence 999999999999999999998631 11 12356788889999999999999999999999999999999999
Q ss_pred HHHHHHHHHHH
Q 022525 263 SRAYGEVAVNV 273 (295)
Q Consensus 263 ~~~~~~l~~~l 273 (295)
+++|++||++|
T Consensus 221 a~~~~~lA~~i 231 (232)
T d1hyqa_ 221 ARAIVELANYI 231 (232)
T ss_dssp HHHHHHHHHHH
T ss_pred HHHHHHHHHHh
Confidence 99999999987
|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1e8ca3 c.72.2.1 (A:104-337) UDP-N-acetylmuramyl tripeptide synthetase MurE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eg7a_ c.37.1.10 (A:) Formyltetrahydrofolate synthetase {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1s1ma2 c.37.1.10 (A:1-266) CTP synthase PyrG, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2gc6a2 c.72.2.2 (A:1-296) Folylpolyglutamate synthetase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jfga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g0ta1 c.37.1.10 (A:1-338) Hypothetical protein TM0796 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p3da3 c.72.2.1 (A:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2vo1a1 c.37.1.10 (A:1-273) CTP synthase PyrG, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|