Citrus Sinensis ID: 022567

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MQGGEELSIEELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQAAASDFQSKSLPAKLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQTTKGKTKKVGFFSGRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGGGIADTDD
ccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEEEEcccEEEEEEccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEccccccccccccccEEEccccccccccc
ccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcHHccccccccccccccccEEEEEEcccccEEEEEEEEEccccEEEEEEcccccEEEcHHHccccccHcccccccccccccHccccccccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccEEEEcccccccEEEEEcccccccccccccEEEEEEccccccccc
mqggeelsIEELFSNLSTYKEQLQQVRELLvhdpgnseyaDMEKELSEVIALTEELLATAKQNAISvsetgtsasaspnllqskenktesgsisdnqekLAVGTKVQAvysedgewydatieaitpngyyvtydswgnkeevdpanvrpvNLLVEAEKVAEATKLAIKRKIEQAAasdfqskslpaklhinpddpeDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQttkgktkkvgffsgrkresifkspddpygkvgvtgsgkgltdFQKREKHlhlkgggiadtdd
MQGGEELSIEELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSetgtsasaspnllqSKENKtesgsisdnqeklavGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQaaasdfqskslpaklhinpddpedVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAwqqfqttkgktkkvgffsgrkresifkspddpygkvgvtgsgkgltdfqkrekhlhlkgggiadtdd
MQGGEELSIEELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQAAASDFQSKSLPAKLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWqqfqttkgktkkvgffsgRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGGGIADTDD
****************************LL******************VIALTEELL*******************************************AVGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAI********************************************************************************************************************************
******L****LFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNA***********************TESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVR*************************************************************************************************************DDPYGKVGVTGSGKGLTD********************
********IEELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVS*******************************LAVGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQAAASDFQSKSLPAKLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQTTKGKTKKVGFFSGRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGGGIADTDD
*****ELSIEELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATA**************************************KLAVGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVRPVN*********************************P*KLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQTTKGKTKKVGFFSGRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGGEELSxxxxxxxxxxxxxxxxxxxxxLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAITPNGYYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQAAASDFQSKSLPAKLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQTTKGKTKKVGFFSGRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGGGIADTDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q7ZV80237 Survival of motor neuron- yes no 0.742 0.924 0.291 3e-15
Q6DEY1238 Survival of motor neuron- yes no 0.745 0.924 0.313 2e-13
O75940238 Survival of motor neuron- yes no 0.752 0.932 0.297 5e-11
Q5R591238 Survival of motor neuron- yes no 0.752 0.932 0.293 7e-11
Q4QQU6238 Survival of motor neuron- yes no 0.752 0.932 0.297 7e-11
Q8BGT7238 Survival of motor neuron- yes no 0.752 0.932 0.297 8e-11
Q3T045238 Survival of motor neuron- yes no 0.752 0.932 0.293 1e-10
>sp|Q7ZV80|SPF30_DANRE Survival of motor neuron-related-splicing factor 30 OS=Danio rerio GN=smndc1 PE=2 SV=1 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 127/281 (45%), Gaps = 62/281 (22%)

Query: 10  EELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSE 69
           EEL   LS YK QLQQV   L  DP N +   ++K+L EVI LT++LL +  Q A   + 
Sbjct: 3   EELMKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTS--QPAEGTTS 60

Query: 70  TGTSASASPNLLQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAI-TPNG 128
           T +S + +P+                      VG    A +S+DG+ Y+A IE I   NG
Sbjct: 61  TKSSETVAPS------------------HSWRVGDHCMATWSQDGQVYEAEIEEIDNENG 102

Query: 129 Y-YVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLAIKRKIEQAAASDFQSKSLPAK 187
              +T+  +GN      A V P+++L               +K+E+    D        +
Sbjct: 103 TAAITFAGYGN------AEVMPLHML---------------KKVEEGRIRD--------E 133

Query: 188 LHINPDDPEDVKAAKRKKIHAFKSK--MRFEQLEVTQNKRQNAWQQFQT-TKGKTKKVGF 244
           +   P   ++++A +R+       K   R ++LE  +  +++ WQQF      K KK   
Sbjct: 134 IDGKPKSKKELQAEQREYKKKKAQKKVQRMKELEQEREDQKSKWQQFNNKAYSKNKK--- 190

Query: 245 FSGRKRESIFKSPDDPYGKVGVTGSG---KGLTDFQKREKH 282
             G+ + SIF SP+   GKVGV   G   K +T +    K+
Sbjct: 191 --GQVKRSIFASPESVNGKVGVGTCGIADKPMTQYNDTSKY 229
Necessary for spliceosome assembly.
Danio rerio (taxid: 7955)
>sp|Q6DEY1|SPF30_XENTR Survival of motor neuron-related-splicing factor 30 OS=Xenopus tropicalis GN=smndc1 PE=2 SV=1 Back     alignment and function description
>sp|O75940|SPF30_HUMAN Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens GN=SMNDC1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R591|SPF30_PONAB Survival of motor neuron-related-splicing factor 30 OS=Pongo abelii GN=SMNDC1 PE=2 SV=1 Back     alignment and function description
>sp|Q4QQU6|SPF30_RAT Survival of motor neuron-related-splicing factor 30 OS=Rattus norvegicus GN=Smndc1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGT7|SPF30_MOUSE Survival of motor neuron-related-splicing factor 30 OS=Mus musculus GN=Smndc1 PE=2 SV=1 Back     alignment and function description
>sp|Q3T045|SPF30_BOVIN Survival of motor neuron-related-splicing factor 30 OS=Bos taurus GN=SMNDC1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
359486247301 PREDICTED: survival of motor neuron-rela 0.996 0.976 0.784 1e-129
449450113299 PREDICTED: survival of motor neuron-rela 0.979 0.966 0.773 1e-126
224129794287 predicted protein [Populus trichocarpa] 0.959 0.986 0.778 1e-125
388505896301 unknown [Lotus japonicus] 0.979 0.960 0.744 1e-122
356563614298 PREDICTED: survival of motor neuron-rela 0.983 0.973 0.758 1e-122
255637211298 unknown [Glycine max] 0.983 0.973 0.755 1e-121
297817882300 nucleic acid binding protein [Arabidopsi 0.989 0.973 0.735 1e-119
356522115298 PREDICTED: survival of motor neuron-rela 0.969 0.959 0.741 1e-118
30678010300 survival of motor neuron-related-splicin 1.0 0.983 0.723 1e-118
217074004302 unknown [Medicago truncatula] 0.945 0.923 0.730 1e-117
>gi|359486247|ref|XP_002269518.2| PREDICTED: survival of motor neuron-related-splicing factor 30-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  468 bits (1205), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 237/302 (78%), Positives = 260/302 (86%), Gaps = 8/302 (2%)

Query: 1   MQGGEELSIEELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATA 60
           MQGGEELSI+EL SNLSTYK+QLQQVR+LLV DPGNSEY DMEKEL EVI LTEELLATA
Sbjct: 1   MQGGEELSIDELASNLSTYKDQLQQVRKLLVDDPGNSEYVDMEKELEEVIVLTEELLATA 60

Query: 61  KQNAISVSETGTSASASPNLLQS---KENKTESGSISDNQEKLAVGTKVQAVYSEDGEWY 117
           KQ+ IS+   GT+A ASP   QS    E+  E G+ SD+  K  +GTKVQAV+SEDGEWY
Sbjct: 61  KQSEISLPAFGTNADASPIQHQSGGSSEHLMEPGNNSDHYGKFPIGTKVQAVWSEDGEWY 120

Query: 118 DATIEAITPNGYYVTYDSWGNKEEVDPANVRP----VNLLVEAEKVAEATKLAIKRKIEQ 173
           +ATI+++TP+GYYV+YD WGNKEEVDP NVRP    VN L+EAEK AEATK AIKRKI Q
Sbjct: 121 EATIDSLTPDGYYVSYDGWGNKEEVDPGNVRPIQEEVNALLEAEKEAEATKQAIKRKIAQ 180

Query: 174 AAASDFQSKSLPAKLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQ 233
           AAA+DFQS+SLPAKL I PDDPEDVK AKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQ
Sbjct: 181 AAATDFQSRSLPAKLRIEPDDPEDVKIAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQ 240

Query: 234 TTKGKTKKVGFFSGRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGGGIADT 293
           TTKG+ KK+GFFSGRKRESIFKSPDDP GKVGVTGSGKGLT+FQKREKHLHLKGG  ADT
Sbjct: 241 TTKGRAKKIGFFSGRKRESIFKSPDDPNGKVGVTGSGKGLTEFQKREKHLHLKGGS-ADT 299

Query: 294 DD 295
           DD
Sbjct: 300 DD 301

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449450113|ref|XP_004142808.1| PREDICTED: survival of motor neuron-related-splicing factor 30-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224129794|ref|XP_002328804.1| predicted protein [Populus trichocarpa] gi|118483337|gb|ABK93570.1| unknown [Populus trichocarpa] gi|222839102|gb|EEE77453.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388505896|gb|AFK41014.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356563614|ref|XP_003550056.1| PREDICTED: survival of motor neuron-related-splicing factor 30-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|255637211|gb|ACU18936.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297817882|ref|XP_002876824.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] gi|297322662|gb|EFH53083.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356522115|ref|XP_003529695.1| PREDICTED: survival of motor neuron-related-splicing factor 30-like [Glycine max] Back     alignment and taxonomy information
>gi|30678010|ref|NP_178361.2| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|30678012|ref|NP_849927.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|145328250|ref|NP_001077871.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|27754612|gb|AAO22752.1| unknown protein [Arabidopsis thaliana] gi|28393903|gb|AAO42359.1| unknown protein [Arabidopsis thaliana] gi|330250503|gb|AEC05597.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|330250504|gb|AEC05598.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] gi|330250506|gb|AEC05600.1| survival of motor neuron-related-splicing factor 30 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|217074004|gb|ACJ85362.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2065269300 AT2G02570 [Arabidopsis thalian 1.0 0.983 0.67 1.7e-100
DICTYBASE|DDB_G0293636324 DDB_G0293636 "putative splicin 0.705 0.641 0.319 1.9e-21
FB|FBgn0039977243 CG17454 [Drosophila melanogast 0.423 0.514 0.356 7.3e-11
ZFIN|ZDB-GENE-030131-614237 smndc1 "survival motor neuron 0.230 0.286 0.428 1e-10
UNIPROTKB|E1BQK7238 SMNDC1 "Uncharacterized protei 0.230 0.285 0.4 4e-09
UNIPROTKB|G4MVK7328 MGG_08894 "Uncharacterized pro 0.345 0.310 0.275 1.2e-08
MGI|MGI:1923729238 Smndc1 "survival motor neuron 0.227 0.281 0.376 2.4e-08
RGD|1309151238 Smndc1 "survival motor neuron 0.227 0.281 0.376 2.4e-08
WB|WBGene00004891239 smr-1 [Caenorhabditis elegans 0.155 0.192 0.456 3e-08
UNIPROTKB|F1S5M7238 SMNDC1 "Uncharacterized protei 0.227 0.281 0.376 3e-08
TAIR|locus:2065269 AT2G02570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 997 (356.0 bits), Expect = 1.7e-100, P = 1.7e-100
 Identities = 201/300 (67%), Positives = 235/300 (78%)

Query:     1 MQGG-EELSIEELFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLAT 59
             M GG EELSIE+L S++STYKEQL+QVR+LL  DP NSEYADMEKEL EVIALTEE+LAT
Sbjct:     1 MVGGVEELSIEQLASSISTYKEQLEQVRQLLSEDPRNSEYADMEKELKEVIALTEEVLAT 60

Query:    60 AKQNAISVSETGTSASASPNL--LQSKENKTESGSISDNQEKLAVGTKVQAVYSEDGEWY 117
             AKQN IS+S+ G SA A+P    L+    KT   +   ++ K  VGTKVQAV+S+DGEWY
Sbjct:    61 AKQNEISLSDAGVSAEATPGSPDLEGAWEKTGLRNDPIHEGKFPVGTKVQAVFSDDGEWY 120

Query:   118 DATIEAITPNGYYVTYDSWGNKEEVDPANVRPV--NLLVEAEKVAEATKLAIKRKIEQAA 175
             DATIEA T NGY+V YD WGNKEEVDP NVRP+  N +VEAE++A+ATK A+KRKIE+AA
Sbjct:   121 DATIEAHTANGYFVAYDEWGNKEEVDPDNVRPIEQNAIVEAERLAQATKNALKRKIEKAA 180

Query:   176 ASDFQSKSLPAKLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWXXXXXX 235
             +SD+Q+K+LPAKL I+P+DPEDVK AKRKKIHAFKSK RFEQLEV QNK+QN W      
Sbjct:   181 SSDYQTKTLPAKLKIDPNDPEDVKIAKRKKIHAFKSKARFEQLEVVQNKKQNDWQQFQTT 240

Query:   236 XXXXXXXXXXXXRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGGGIADTDD 295
                         RK+ESIFKSP+DP+GKVGVTGSGKGLTDFQKREKHLHLK G    TD+
Sbjct:   241 KAKTKKVGFFTGRKKESIFKSPEDPFGKVGVTGSGKGLTDFQKREKHLHLKSGNAEGTDE 300
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006397 "mRNA processing" evidence=IEA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
DICTYBASE|DDB_G0293636 DDB_G0293636 "putative splicing factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0039977 CG17454 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-614 smndc1 "survival motor neuron domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQK7 SMNDC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G4MVK7 MGG_08894 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
MGI|MGI:1923729 Smndc1 "survival motor neuron domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309151 Smndc1 "survival motor neuron domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00004891 smr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5M7 SMNDC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035349001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (301 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
cd0450848 cd04508, TUDOR, Tudor domains are found in many eu 4e-12
smart0033357 smart00333, TUDOR, Tudor domain 8e-12
pfam00567118 pfam00567, TUDOR, Tudor domain 2e-04
pfam06003264 pfam06003, SMN, Survival motor neuron protein (SMN 3e-04
PLN00104 450 PLN00104, PLN00104, MYST -like histone acetyltrans 0.002
>gnl|CDD|119391 cd04508, TUDOR, Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information 
 Score = 59.5 bits (145), Expect = 4e-12
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 103 GTKVQAVYSEDGEWYDATIEAITPNGYY-VTYDSWGNKEEVDPANVRP 149
           G    A YS+DG+WY A I +I  +G   V +  +GN E V  +++RP
Sbjct: 1   GDLCLAKYSDDGKWYRAKITSILSDGKVEVFFVDYGNTEVVPLSDLRP 48

For example, the Tudor domain of Survival of Motor Neuron (SMN) binds to symmetrically dimethylated arginines of arginine-glycine (RG) rich sequences found in the C-terminal tails of Sm proteins. The SMN protein is linked to spinal muscular atrophy. Another example is the tandem tudor domains of 53BP1, which bind to histone H4 specifically dimethylated at Lys20 (H4-K20me2). 53BP1 is a key transducer of the DNA damage checkpoint signal. Length = 48
>gnl|CDD|197660 smart00333, TUDOR, Tudor domain Back     alignment and domain information
>gnl|CDD|215998 pfam00567, TUDOR, Tudor domain Back     alignment and domain information
>gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) Back     alignment and domain information
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
KOG3026262 consensus Splicing factor SPF30 [RNA processing an 100.0
PF06003264 SMN: Survival motor neuron protein (SMN); InterPro 99.59
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 99.54
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 99.51
smart0074361 Agenet Tudor-like domain present in plant sequence 99.12
KOG4327218 consensus mRNA splicing protein SMN (survival moto 98.98
PF00567121 TUDOR: Tudor domain; InterPro: IPR008191 There are 98.76
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 98.66
KOG2185 486 consensus Predicted RNA-processing protein, contai 98.65
KOG2039875 consensus Transcriptional coactivator p100 [Transc 98.64
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 98.29
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 97.87
PF15057124 DUF4537: Domain of unknown function (DUF4537) 97.56
KOG2185 486 consensus Predicted RNA-processing protein, contai 97.42
PF09038122 53-BP1_Tudor: Tumour suppressor p53-binding protei 97.4
PLN00104 450 MYST -like histone acetyltransferase; Provisional 97.19
PF15057124 DUF4537: Domain of unknown function (DUF4537) 97.18
PF07039130 DUF1325: SGF29 tudor-like domain; InterPro: IPR010 95.85
cd0583483 HDGF_related The PWWP domain is an essential part 95.64
PF0085586 PWWP: PWWP domain; InterPro: IPR000313 Upon charac 95.31
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 95.28
PF1214885 DUF3590: Protein of unknown function (DUF3590); In 95.13
cd0608080 MUM1_like Mutated melanoma-associated antigen 1 (M 95.05
smart0029363 PWWP domain with conserved PWWP motif. conservatio 94.97
cd0584183 BS69_related The PWWP domain is part of BS69 prote 94.65
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 93.27
cd0583686 N_Pac_NP60 The PWWP domain is an essential part of 92.5
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 92.23
cd0584093 SPBC215_ISWI_like The PWWP domain is a component o 91.79
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.75
PF08605131 Rad9_Rad53_bind: Fungal Rad9-like Rad53-binding; I 91.5
cd0583587 Dnmt3b_related The PWWP domain is an essential com 91.24
KOG3038264 consensus Histone acetyltransferase SAGA associate 90.73
cd0583895 WHSC1_related The PWWP domain was first identified 89.1
cd05837110 MSH6_like The PWWP domain is present in MSH6, a mi 88.65
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 86.36
>KOG3026 consensus Splicing factor SPF30 [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=5.6e-61  Score=425.99  Aligned_cols=257  Identities=37%  Similarity=0.479  Sum_probs=210.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhccCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccccccCCCCCCCC---Ccccccccccc
Q 022567           12 LFSNLSTYKEQLQQVRELLVHDPGNSEYADMEKELSEVIALTEELLATAKQNAISVSETGTSASAS---PNLLQSKENKT   88 (295)
Q Consensus        12 Le~~L~~Yk~QL~qVe~aL~~DP~N~ELl~Lk~dL~EvI~Lt~ell~~~~~~~~~~~~~~~~~~~~---P~~~~~~~~~~   88 (295)
                      |+.+|.+|++||+||++||+.||+|+||++|++||.|||+||+|||.+...++.+.+.+...+.+.   |.+...+... 
T Consensus         1 ma~eL~sYK~QLqqVeaaL~~dP~NeEllkLe~DLkEvIsLTedLlqT~~ee~~sss~a~~ssq~~h~s~~~~~~~~~~-   79 (262)
T KOG3026|consen    1 MAKELASYKLQLQQVEAALQGDPENEELLKLEKDLKEVISLTEDLLQTQKEEDKSSSDAFVSSQPTHSSFTPRWVSGDY-   79 (262)
T ss_pred             ChhHHHHHHHHHHHHHHHHccCCccHHHHHHHHHHHHHHHHHHHHHHhhhhhhcccccccccCccccCCCchhhhhhhh-
Confidence            567899999999999999999999999999999999999999999999987755433221111111   1111111111 


Q ss_pred             cCCCCCCCCCCCCCCCeEEEEEcCCCcEEEEEEeeEeC-Cc-eEEEEecCCCEEEEcCCCcccCCchhHHHHHHhhhhhh
Q 022567           89 ESGSISDNQEKLAVGTKVQAVYSEDGEWYDATIEAITP-NG-YYVTYDSWGNKEEVDPANVRPVNLLVEAEKVAEATKLA  166 (295)
Q Consensus        89 ~~~~~~~~~~~~kvGd~C~A~~s~Dg~wY~A~I~~i~~-~~-~~V~F~~Ygn~e~V~~~~lrp~~~~~~~~~~~~~~~~~  166 (295)
                      ..-+.+.+...|.||++|+|.|++||.||.|+|+.|+. .+ +.|.|.+|++...+...++|++.....+          
T Consensus        80 l~~~~~i~a~~w~vg~K~~A~~~ddg~~y~AtIe~ita~~~~~ai~f~s~~~a~~t~~a~lr~~e~~~s~----------  149 (262)
T KOG3026|consen   80 LFYPSRITAVGWKVGDKVQAVFSDDGQIYDATIEHITAMEGTVAIIFASYGTAPSTYAARLRSPEEKSSA----------  149 (262)
T ss_pred             ccccccchhcccccCCEEEEeecCCCceEEeehhhccCCCCceeEEEeeccccccccHhhccCcchhhhh----------
Confidence            11223344558999999999999999999999999997 45 9999999999999999999987432111          


Q ss_pred             hhhhhhhhhhccccccCcCcccCCCCCCcHHHHHHHHHHHHHhhhhhhHHHHHHHHhHHhhhhHhHhhhcCccccccccc
Q 022567          167 IKRKIEQAAASDFQSKSLPAKLHINPDDPEDVKAAKRKKIHAFKSKMRFEQLEVTQNKRQNAWQQFQTTKGKTKKVGFFS  246 (295)
Q Consensus       167 ~k~~i~~aa~~~~~~~~~P~~l~i~p~d~e~~k~~k~KK~ka~Kk~~R~~ele~e~~~kkn~Wq~F~~Kk~kkkk~g~~~  246 (295)
                                 .+.....|-.+.+-|+++|..+.++|||+|++||+||+++||.+++..||+||+|++++.+++++|   
T Consensus       150 -----------~~~~~n~P~~~k~~~~~pe~~~~~e~~k~~a~KKqQr~kele~~~e~~kn~WqqFntr~~kk~kvG---  215 (262)
T KOG3026|consen  150 -----------AYTANNKPIQNKHVSTLPEISPIKERKKKKALKKQQRQKELEAEREASKNSWQQFNTRAVKKGKVG---  215 (262)
T ss_pred             -----------hcccCCCcchhccCCCCcccccccccccchhHHHHHHHHhHHHHHhhhhhHHHHHHHHhhhccccc---
Confidence                       111223466667888999999999999999999999999999999999999999999988888887   


Q ss_pred             CCcccccccCCCCCCcceeeccCCCCCCccccccceeeccCCCccCCC
Q 022567          247 GRKRESIFKSPDDPYGKVGVTGSGKGLTDFQKREKHLHLKGGGIADTD  294 (295)
Q Consensus       247 g~kk~SiF~tPd~~~grVGv~GsGk~MT~~~~r~kh~~~~~~~~~~~~  294 (295)
                      |+++.|||+|||++.|||||+|||+ ++.++.|.+|+|.+.|+.++++
T Consensus       216 g~k~~SIFkSped~~Grvgvg~~G~-ia~~~~~e~~~~~k~g~~d~l~  262 (262)
T KOG3026|consen  216 GIKKSSIFKSPEDVPGRVGVGGCGN-IADSGMREKHIYNKRGDRDSLF  262 (262)
T ss_pred             ceeeeccccCCCCCCcccCCCCccc-ccccccceehhhhhccccccCC
Confidence            8999999999999999999999999 9999999999999999887664

>PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>KOG4327 consensus mRNA splicing protein SMN (survival motor neuron) [RNA processing and modification] Back     alignment and domain information
>PF00567 TUDOR: Tudor domain; InterPro: IPR008191 There are multiple copies of this domain in the Drosophila melanogaster tudor protein and it has been identified in several RNA-binding proteins [] Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG2039 consensus Transcriptional coactivator p100 [Transcription] Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PF09038 53-BP1_Tudor: Tumour suppressor p53-binding protein-1 Tudor; InterPro: IPR015125 This domain consist of ten beta-strands and a carboxy-terminal alpha-helix Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>PF07039 DUF1325: SGF29 tudor-like domain; InterPro: IPR010750 SAGA-associated factor 29 is involved in transcriptional regulation, probably through association with histone acetyltransferase (HAT) complexes like the TFTC-HAT or STAGA complexes Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>PF12148 DUF3590: Protein of unknown function (DUF3590); InterPro: IPR021991 This domain is found in eukaryotes, and is typically between 83 and 97 amino acids in length Back     alignment and domain information
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information
>cd05841 BS69_related The PWWP domain is part of BS69 protein, a nuclear protein that specifically binds adenoviral E1A and Epstein-Barr viral EBNA2 proteins, suppressing their transactivation functions Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF08605 Rad9_Rad53_bind: Fungal Rad9-like Rad53-binding; InterPro: IPR013914 In Saccharomyces cerevisiae (Baker s yeast), the Rad9 is a key adaptor protein in DNA damage checkpoint pathways Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>KOG3038 consensus Histone acetyltransferase SAGA associated factor SGF29 [General function prediction only] Back     alignment and domain information
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS) Back     alignment and domain information
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
3s6w_A54 Tudor domain-containing protein 3; methylated argi 1e-16
2d9t_A78 Tudor domain-containing protein 3; structural geno 3e-16
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 7e-15
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 2e-14
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 4e-13
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 7e-12
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 3e-10
2diq_A110 Tudor and KH domain-containing protein; tudor doma 2e-09
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 1e-07
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Length = 54 Back     alignment and structure
 Score = 71.2 bits (175), Expect = 1e-16
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 102 VGTKVQAVYSEDGEWYDATIEAITPNGYY--VTYDSWGNKEEVDPANVRPV 150
            G +  A+Y ED ++Y A +EA+  +G    V +  +GN EEV  +N++P+
Sbjct: 4   PGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI 54
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Length = 78 Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Length = 59 Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Length = 64 Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Length = 77 Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Length = 88 Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} Length = 94 Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Length = 110 Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Length = 169 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Length = 218 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 99.79
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 99.79
3s6w_A54 Tudor domain-containing protein 3; methylated argi 99.79
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 99.78
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 99.73
2d9t_A78 Tudor domain-containing protein 3; structural geno 99.72
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 99.71
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 99.45
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 99.64
3qii_A85 PHD finger protein 20; tudor domain, structural ge 99.63
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 99.6
2diq_A110 Tudor and KH domain-containing protein; tudor doma 99.52
2eqk_A85 Tudor domain-containing protein 4; structural geno 99.51
2l8d_A66 Lamin-B receptor; DNA binding protein; NMR {Gallus 99.47
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 99.43
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 99.34
4b9w_A201 TDRD1, tudor domain-containing protein 1; replicat 99.34
4b9x_A226 TDRD1, tudor domain-containing protein 1; replicat 99.31
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 99.26
2hqx_A246 P100 CO-activator tudor domain; human P100 tudor d 99.22
3bdl_A570 Staphylococcal nuclease domain-containing protein 99.0
2eqj_A66 Metal-response element-binding transcription facto 98.91
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 98.71
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 98.56
2e5p_A68 Protein PHF1, PHD finger protein 1; tudor domain, 98.55
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 98.51
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 98.41
1ssf_A156 Transformation related protein 53 binding protein 98.27
2g3r_A123 Tumor suppressor P53-binding protein 1; tandem tud 98.26
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 97.99
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 97.94
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 97.93
2lcc_A76 AT-rich interactive domain-containing protein 4A; 97.92
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 97.92
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 97.91
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 97.87
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 97.76
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 96.73
3sd4_A69 PHD finger protein 20; tudor domain, transcription 97.51
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 97.47
2bud_A92 Males-absent on the first protein; transferase, MO 97.36
2qqr_A118 JMJC domain-containing histone demethylation prote 97.23
2k3y_A136 Chromatin modification-related protein EAF3; dimet 97.19
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 97.16
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 96.91
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 96.83
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.68
2xdp_A123 Lysine-specific demethylase 4C; oxidoreductase, hi 96.65
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 96.5
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 96.37
3e9g_A130 Chromatin modification-related protein EAF3; chrom 96.19
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 95.18
3qby_A94 Hepatoma-derived growth factor-related protein 2; 95.08
3mea_A180 SAGA-associated factor 29 homolog; structural geno 94.61
2xdp_A123 Lysine-specific demethylase 4C; oxidoreductase, hi 94.58
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 94.57
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 94.54
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 94.34
2fhd_A153 RAD9 homolog, DNA repair protein RHP9/CRB2; tamdem 94.32
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 94.09
4fu6_A153 PC4 and SFRS1-interacting protein; structural geno 93.67
2lcd_A118 AT-rich interactive domain-containing protein 4A; 92.74
2qqr_A118 JMJC domain-containing histone demethylation prote 93.41
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 93.09
3mp6_A522 MBP, SGF29, maltose-binding periplasmic protein, l 92.82
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 92.78
2gfu_A134 DNA mismatch repair protein MSH6; PWWP domain, tud 92.7
2l89_A108 PWWP domain-containing protein 1; histone binding, 92.64
1h3z_A109 Hypothetical 62.8 kDa protein C215.07C; nuclear pr 92.22
3pfs_A158 Bromodomain and PHD finger-containing protein 3; s 87.04
2lcd_A118 AT-rich interactive domain-containing protein 4A; 85.62
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 85.29
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 83.97
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 82.63
3db3_A161 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 82.02
3l42_A130 Peregrin; transcription regulation, histone H3 ace 81.13
1fxk_C133 Protein (prefoldin); archaeal protein, chaperone; 80.58
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 80.46
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
Probab=99.79  E-value=1.2e-19  Score=132.86  Aligned_cols=57  Identities=40%  Similarity=0.654  Sum_probs=52.6

Q ss_pred             CCCCCCCCCCeEEEEEcCCCcEEEEEEeeEeC-Cc-eEEEEecCCCEEEEcCCCcccCC
Q 022567           95 DNQEKLAVGTKVQAVYSEDGEWYDATIEAITP-NG-YYVTYDSWGNKEEVDPANVRPVN  151 (295)
Q Consensus        95 ~~~~~~kvGd~C~A~~s~Dg~wY~A~I~~i~~-~~-~~V~F~~Ygn~e~V~~~~lrp~~  151 (295)
                      ++...|++||.|+|+||.||+||||+|++|+. ++ |.|.|++|||+|+|++++|||++
T Consensus         4 ~~~~~~~vGd~c~A~~s~Dg~wYrA~I~~v~~~~~~~~V~fvdYGn~e~V~~~~Lrpl~   62 (64)
T 4a4f_A            4 QPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVE   62 (64)
T ss_dssp             CCSSCCCTTCEEEEECTTTSSEEEEEEEEEETTTTEEEEEETTTTEEEEEEGGGEECCS
T ss_pred             CcCCCCCCCCEEEEEECCCCCEEEEEEEEEcCCCCEEEEEEEecCCEEEEeHHHcEeCC
Confidence            45567999999999999999999999999996 45 99999999999999999999985
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>4b9w_A TDRD1, tudor domain-containing protein 1; replication; HET: 2MR; 2.10A {Mus musculus} Back     alignment and structure
>4b9x_A TDRD1, tudor domain-containing protein 1; replication; 2.80A {Mus musculus} Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2hqx_A P100 CO-activator tudor domain; human P100 tudor domain, proteolytic fragment, PSI, structural genomics; 1.42A {Homo sapiens} SCOP: b.34.9.1 PDB: 2hqe_A 3omc_A* 3omg_A* 2o4x_A 2e6n_A 2o4x_B Back     alignment and structure
>3bdl_A Staphylococcal nuclease domain-containing protein 1; staphylococcal nuclease OB fold, tudor domain, cytoplasm, HOST-virus interaction, nucleus; HET: CIT; 1.90A {Homo sapiens} Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 Back     alignment and structure
>2g3r_A Tumor suppressor P53-binding protein 1; tandem tudor domains, cell cycle-transcription complex; 1.25A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2ig0_A* 3lgf_A* 3lgl_A* 3lh0_A* 1xni_A Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>2qqr_A JMJC domain-containing histone demethylation protein 3A; histone lysine demethylase, tandem hybrid tudor domains, metal binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2qqs_A* 2gfa_A* 2gf7_A* Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>2xdp_A Lysine-specific demethylase 4C; oxidoreductase, histone modification; 1.56A {Homo sapiens} Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} SCOP: b.34.9.2 PDB: 3qj6_A* 3eae_A 1n27_A Back     alignment and structure
>3mea_A SAGA-associated factor 29 homolog; structural genomics consortium, SGC, nucleus, transcription, transcription regulation, chromosomal protein, DNA-binding; HET: M3L; 1.26A {Homo sapiens} PDB: 3meu_A* 3met_A* 3me9_A* 3mev_A* 3lx7_A 3mew_A Back     alignment and structure
>2xdp_A Lysine-specific demethylase 4C; oxidoreductase, histone modification; 1.56A {Homo sapiens} Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>2fhd_A RAD9 homolog, DNA repair protein RHP9/CRB2; tamdem tudor domains, cell cycle; HET: DNA MSE PO4; 2.40A {Schizosaccharomyces pombe} Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Back     alignment and structure
>4fu6_A PC4 and SFRS1-interacting protein; structural genomics consortium, SGC, transcription; 2.10A {Homo sapiens} PDB: 2b8a_A 2nlu_A Back     alignment and structure
>2lcd_A AT-rich interactive domain-containing protein 4A; tudor domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2qqr_A JMJC domain-containing histone demethylation protein 3A; histone lysine demethylase, tandem hybrid tudor domains, metal binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2qqs_A* 2gfa_A* 2gf7_A* Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} SCOP: b.34.9.0 Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3pfs_A Bromodomain and PHD finger-containing protein 3; structural genomics, structural genomics consortium, SGC, PW domain, protein binding; 1.90A {Homo sapiens} PDB: 3lyi_A* Back     alignment and structure
>2lcd_A AT-rich interactive domain-containing protein 4A; tudor domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3db3_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, tandem tudor domains, LI metal binding, DNA replication; HET: M3L; 2.40A {Homo sapiens} PDB: 3db4_A 2l3r_A* Back     alignment and structure
>3l42_A Peregrin; transcription regulation, histone H3 acetylation, chromatin modification, structural genomics, structural genomics CONS SGC, activator; 1.30A {Homo sapiens} PDB: 3mo8_A* 2x4w_A* 2x35_A* 2x4x_A* 2x4y_A* Back     alignment and structure
>1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d2d9ta160 b.34.9.1 (A:8-67) Tudor domain-containing protein 5e-12
d1mhna_59 b.34.9.1 (A:) Survival motor neuron protein 1, smn 2e-11
d2diqa197 b.34.9.1 (A:8-104) Tudor and KH domain-containing 1e-10
d2hqxa190 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human ( 8e-07
d1wgsa_133 b.34.13.3 (A:) Probable histone acetyltransferase 6e-04
d2buda188 b.34.13.3 (A:367-454) Putative histone acetyltrans 0.002
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 60 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Tudor/PWWP/MBT
family: Tudor domain
domain: Tudor domain-containing protein 3, TDRD3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 57.9 bits (140), Expect = 5e-12
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 102 VGTKVQAVYSEDGEWYDATIEAITPNG--YYVTYDSWGNKEEVDPANVRPV 150
            G +  A+Y ED ++Y A +EA+  +G    V +  +GN EEV  +N++PV
Sbjct: 5   PGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFTDYGNYEEVLLSNIKPV 55
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 133 Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 99.78
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 99.74
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 99.51
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 99.46
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 98.3
d2diga155 Lamin-b receptor {Human (Homo sapiens) [TaxId: 960 97.78
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 97.72
d2qqra159 Jumonji domain-containing protein 2A {Human (Homo 97.7
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 97.55
d2qqra256 Jumonji domain-containing protein 2A {Human (Homo 96.78
d2g3ra153 p53-binding protein 1, 53BP1 {Human (Homo sapiens) 96.22
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 94.48
d1oz2a3106 Lethal(3)malignant brain tumor-like protein {Human 94.12
d1h3za_108 Hypothetical protein SPBC215.07c {Fission yeast (S 94.08
d1oi1a2104 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 93.52
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 93.06
d1khca_137 DNA methyltransferase DNMT3B {Mouse (Mus musculus) 92.99
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 92.14
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 91.21
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 91.13
d2daqa197 Histone-lysine N-methyltransferase NSD3 {Human (Ho 90.89
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 90.86
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 88.44
d1vhka172 Hypothetical protein YqeU {Bacillus subtilis [TaxI 87.85
d1nxza172 Hypothetical protein HI0303 {Haemophilus influenza 84.51
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Tudor/PWWP/MBT
family: Tudor domain
domain: Survival motor neuron protein 1, smn
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.78  E-value=1e-19  Score=129.44  Aligned_cols=54  Identities=35%  Similarity=0.533  Sum_probs=49.9

Q ss_pred             CCCCCCCeEEEEEcCCCcEEEEEEeeEeCC-c-eEEEEecCCCEEEEcCCCcccCC
Q 022567           98 EKLAVGTKVQAVYSEDGEWYDATIEAITPN-G-YYVTYDSWGNKEEVDPANVRPVN  151 (295)
Q Consensus        98 ~~~kvGd~C~A~~s~Dg~wY~A~I~~i~~~-~-~~V~F~~Ygn~e~V~~~~lrp~~  151 (295)
                      ..|+||+.|+|+|++||.||||+|.+|..+ + |.|.|+||||+++|++++|+|+.
T Consensus         2 ~~wkvG~~C~A~~s~Dg~wYRA~I~~v~~~~~~~~V~fvDYGn~e~V~~~~l~~~~   57 (59)
T d1mhna_           2 QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPI   57 (59)
T ss_dssp             CCCCTTCEEEEECTTTSCEEEEEEEEEETTTTEEEEEETTTTEEEEEEGGGCBCTT
T ss_pred             CcCCcCCEEEEEECCCCCEEEEEEEEEcCCCCEEEEEEEeCCCEEEEEHHHCcCCC
Confidence            469999999999999999999999999754 4 99999999999999999999974
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qqra1 b.34.9.1 (A:897-955) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qqra2 b.34.9.1 (A:956-1011) Jumonji domain-containing protein 2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ra1 b.34.9.1 (A:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vhka1 b.122.1.2 (A:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nxza1 b.122.1.2 (A:2-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure