Citrus Sinensis ID: 022803


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MDSPLNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQGSSRRPSVEASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT
ccccccHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEcccccccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccEEEEEEccccHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc
cccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHccHHHccccccccccHHHHHHHHHHHHHHHHHHccccccHEEEEHHHHccccccHHHccccEEEcccccEEEEccccHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHHHccccEEEEEHHHccccEEEEEEccccEEEEccccccccHHHHHHHHHHHHHHHHHHHcccc
mdsplnseiesffdsapplndrAAISQKLKEFIALNSSESGTRRVACVtsggttvpleqRCVRYidnfssghrgaasTEHLIKMGYAVIFLYRrgtcepycsslpddafLECFEVTeesavqgssrrpsVEASLYNYIRMLQMIAVSsrslgpcsMFYLAAAVSdfyvpwksmaehkiqsgsgpldmqlLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNngkipvyrdktssdsdvekPLTKLLVDRhsvyikdsnt
MDSPLNSEIEsffdsapplNDRAAISQKLKEFIalnssesgtrrvacvtsggttvpleqrCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEesavqgssrrpsVEASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVanellsrkeqvvvvtnngkipvyrdktssdsdvekpltkllvdrhsvyikdsnt
MDSPLNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQGSSRRPSVEASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT
*******************************FIAL******TRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVT**************EASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVY****************LLVDR**V*******
*****NS*IESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQGSSRRPSVEASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFY*******************MQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIP**********DVEKPLTKLLVDRHSVYI*****
*********ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVT*************VEASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYR*********EKPLTKLLVDRHSVYIKDSNT
******S*IESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQGSSRRPSVEASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKD***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSPLNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQGSSRRPSVEASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query292 2.2.26 [Sep-21-2011]
Q9LZM3309 Phosphopantothenate--cyst yes no 0.986 0.932 0.605 1e-102
Q8GXR5317 Phosphopantothenate--cyst yes no 0.976 0.899 0.612 1e-101
Q9HAB8311 Phosphopantothenate--cyst yes no 0.852 0.800 0.429 3e-53
Q8VDG5311 Phosphopantothenate--cyst yes no 0.924 0.868 0.4 1e-46
Q9USK7316 Uncharacterized protein C yes no 0.815 0.753 0.399 2e-45
P40506365 Phosphopantothenate--cyst yes no 0.948 0.758 0.325 2e-35
>sp|Q9LZM3|PPCS2_ARATH Phosphopantothenate--cysteine ligase 2 OS=Arabidopsis thaliana GN=PPCS2 PE=2 SV=2 Back     alignment and function desciption
 Score =  371 bits (953), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/309 (60%), Positives = 235/309 (76%), Gaps = 21/309 (6%)

Query: 5   LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRY 64
           +  EI SFF+S+PP  +   I + L EFI LNSS  G RR+ CVTSGGTTVPLEQRCVRY
Sbjct: 1   MEDEISSFFESSPPQKNMEEILENLNEFIKLNSSSQGGRRIVCVTSGGTTVPLEQRCVRY 60

Query: 65  IDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQ-G 123
           IDNFSSG+RGAASTE+ +K GYAVIFLYRRGTC+PYC SLPDD FLECFE ++++ +Q  
Sbjct: 61  IDNFSSGNRGAASTENFVKAGYAVIFLYRRGTCQPYCRSLPDDPFLECFEFSDKTNIQVH 120

Query: 124 SSRRPSVE--------------------ASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAV 163
           +S   +V+                    +++Y Y++ML++IA + + +GPCSMFYLAAAV
Sbjct: 121 TSHLEAVKMAVMDQQTAVAEGSLLKLPFSTIYEYLQMLRLIAEALKDVGPCSMFYLAAAV 180

Query: 164 SDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLE 223
           SDFYVPWKSM EHKI+SGSGPLD++L QVPKMLSVLR  WAP AFCISFKLETD++IL+E
Sbjct: 181 SDFYVPWKSMTEHKIESGSGPLDIRLAQVPKMLSVLRSNWAPKAFCISFKLETDSKILME 240

Query: 224 KADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRH 283
           KA  A +KY +HAVVANEL +RKE+VVVV+++G + V R+    +S VE  L +L+VDRH
Sbjct: 241 KATKALRKYKVHAVVANELSTRKEEVVVVSSSGNVVVRRECDKPESFVEDNLIRLIVDRH 300

Query: 284 SVYIKDSNT 292
           S YIK+S+ 
Sbjct: 301 STYIKESHN 309




Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 5
>sp|Q8GXR5|PPCS1_ARATH Phosphopantothenate--cysteine ligase 1 OS=Arabidopsis thaliana GN=PPCS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HAB8|PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens GN=PPCS PE=1 SV=2 Back     alignment and function description
>sp|Q8VDG5|PPCS_MOUSE Phosphopantothenate--cysteine ligase OS=Mus musculus GN=Ppcs PE=2 SV=1 Back     alignment and function description
>sp|Q9USK7|YJ2I_SCHPO Uncharacterized protein C4B3.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.18 PE=3 SV=1 Back     alignment and function description
>sp|P40506|PPCS_YEAST Phosphopantothenate--cysteine ligase CAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAB2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
224063167327 predicted protein [Populus trichocarpa] 0.976 0.871 0.651 1e-114
302141894363 unnamed protein product [Vitis vinifera] 0.982 0.790 0.633 1e-107
147766524329 hypothetical protein VITISV_039485 [Viti 0.982 0.872 0.633 1e-107
359492425329 PREDICTED: phosphopantothenate--cysteine 0.982 0.872 0.633 1e-107
449458083332 PREDICTED: phosphopantothenate--cysteine 0.969 0.852 0.601 1e-105
255545580277 cornichon, putative [Ricinus communis] g 0.852 0.898 0.671 1e-104
224084776325 predicted protein [Populus trichocarpa] 0.986 0.886 0.599 1e-103
357477589331 Phosphopantothenate-cysteine ligase [Med 0.982 0.867 0.576 1e-101
357477655321 Phosphopantothenate-cysteine ligase [Med 0.982 0.894 0.588 1e-101
358248488320 uncharacterized protein LOC100777777 [Gl 0.969 0.884 0.600 1e-101
>gi|224063167|ref|XP_002301023.1| predicted protein [Populus trichocarpa] gi|222842749|gb|EEE80296.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/316 (65%), Positives = 243/316 (76%), Gaps = 31/316 (9%)

Query: 5   LNSEIESFFDSAPPLNDRAAISQKLKEFIALNSS------ESGTRRVACVTSGGTTVPLE 58
           L++EIESFFDSAPPL DRA I +KLKEFI  NS+      +   RRV CVTSGGTTVPLE
Sbjct: 13  LDAEIESFFDSAPPLKDRAGIIKKLKEFIEYNSTPPVNAGKGSPRRVVCVTSGGTTVPLE 72

Query: 59  QRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEE 118
           QRCVRYIDNFSSGHRGA STE+ IK GYAVIFLYRRGT +PYC SLP+D  LECFE +++
Sbjct: 73  QRCVRYIDNFSSGHRGATSTEYFIKAGYAVIFLYRRGTFQPYCQSLPEDPLLECFECSDD 132

Query: 119 SAVQGSSRRPSVEA-----------------------SLYNYIRMLQMIAVSSRSLGPCS 155
           S +Q   R+P  EA                       +++ Y+++LQ IA+S + LG  +
Sbjct: 133 STIQ--VRQPHTEAVKRAVSDHHAAIAGGHLLKLSFTTIFEYLQILQSIAMSMKDLGSLA 190

Query: 156 MFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLE 215
           +FYLAAAVSDFYVPWKSMAEHKIQS SGPLDM+L+QVPKMLS L+KEWAPMAFCISFKLE
Sbjct: 191 VFYLAAAVSDFYVPWKSMAEHKIQSASGPLDMRLVQVPKMLSALKKEWAPMAFCISFKLE 250

Query: 216 TDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTSSDSDVEKPL 275
           TD++ILLEKA+MA KKY MH VVANEL +RKE+V VVT N KI V RDKT +DSDVE+PL
Sbjct: 251 TDSKILLEKAEMALKKYRMHMVVANELSTRKEEVTVVTGNEKILVCRDKTQADSDVEEPL 310

Query: 276 TKLLVDRHSVYIKDSN 291
            +L+V RHS Y+KDS+
Sbjct: 311 IELIVGRHSAYVKDSD 326




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302141894|emb|CBI19097.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147766524|emb|CAN76608.1| hypothetical protein VITISV_039485 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359492425|ref|XP_002284301.2| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458083|ref|XP_004146777.1| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Cucumis sativus] gi|449511568|ref|XP_004163992.1| PREDICTED: phosphopantothenate--cysteine ligase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255545580|ref|XP_002513850.1| cornichon, putative [Ricinus communis] gi|223546936|gb|EEF48433.1| cornichon, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224084776|ref|XP_002307404.1| predicted protein [Populus trichocarpa] gi|222856853|gb|EEE94400.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357477589|ref|XP_003609080.1| Phosphopantothenate-cysteine ligase [Medicago truncatula] gi|355510135|gb|AES91277.1| Phosphopantothenate-cysteine ligase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357477655|ref|XP_003609113.1| Phosphopantothenate-cysteine ligase [Medicago truncatula] gi|355510168|gb|AES91310.1| Phosphopantothenate-cysteine ligase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358248488|ref|NP_001239890.1| uncharacterized protein LOC100777777 [Glycine max] gi|255642574|gb|ACU21550.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
TAIR|locus:2034690317 COAB "AT1G12350" [Arabidopsis 0.551 0.507 0.664 1.4e-97
UNIPROTKB|Q9HAB8311 PPCS "Phosphopantothenate--cys 0.636 0.598 0.430 1.1e-50
ZFIN|ZDB-GENE-060512-104320 ppcs "phosphopantothenoylcyste 0.530 0.484 0.471 4.2e-49
POMBASE|SPCC4B3.18316 SPCC4B3.18 "phosphopantothenat 0.417 0.386 0.475 1.4e-44
FB|FBgn0261285313 Ppcs "Phosphopantothenoylcyste 0.541 0.504 0.381 1.6e-43
UNIPROTKB|G5EH02 439 MGCH7_ch7g472 "Phosphopantothe 0.373 0.248 0.454 6.8e-41
SGD|S000001345365 CAB2 "Probable phosphopantothe 0.318 0.254 0.446 7.1e-33
DICTYBASE|DDB_G0282611389 DDB_G0282611 "phosphopantothen 0.523 0.393 0.354 6.8e-31
MGI|MGI:1915237311 Ppcs "phosphopantothenoylcyste 0.636 0.598 0.404 2.3e-30
GENEDB_PFALCIPARUM|PF11_0036 660 PF11_0036 "hypothetical protei 0.291 0.128 0.404 1.4e-16
TAIR|locus:2034690 COAB "AT1G12350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 559 (201.8 bits), Expect = 1.4e-97, Sum P(2) = 1.4e-97
 Identities = 107/161 (66%), Positives = 133/161 (82%)

Query:   132 ASLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQ 191
             +++Y Y++ML++IA   + +GPCSMFYLAAAVSDFYVPW SM EHKI+SGSGPLD++L Q
Sbjct:   157 STIYEYLQMLRLIATILKDVGPCSMFYLAAAVSDFYVPWLSMTEHKIESGSGPLDIRLAQ 216

Query:   192 VPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVV 251
             VPKMLS+LR  WAP AFCISFKLETD++ILLEKA  A +KY +HAVVANELL+RKE+VVV
Sbjct:   217 VPKMLSILRSNWAPKAFCISFKLETDSKILLEKATKALQKYKVHAVVANELLTRKEEVVV 276

Query:   252 VTNNGKIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSNT 292
             V+++G + V RD    +S VE  L +LLVDRHS YIK+S T
Sbjct:   277 VSSSGNVVVRRDSNKPESIVEDNLIRLLVDRHSTYIKESLT 317


GO:0003824 "catalytic activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016020 "membrane" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0004632 "phosphopantothenate--cysteine ligase activity" evidence=IDA
GO:0015937 "coenzyme A biosynthetic process" evidence=IDA
UNIPROTKB|Q9HAB8 PPCS "Phosphopantothenate--cysteine ligase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060512-104 ppcs "phosphopantothenoylcysteine synthetase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPCC4B3.18 SPCC4B3.18 "phosphopantothenate-cysteine ligase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
FB|FBgn0261285 Ppcs "Phosphopantothenoylcysteine synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G5EH02 MGCH7_ch7g472 "Phosphopantothenate-cysteine ligase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
SGD|S000001345 CAB2 "Probable phosphopantothenoylcysteine synthetase (PPCS)" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0282611 DDB_G0282611 "phosphopantothenatecysteine ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1915237 Ppcs "phosphopantothenoylcysteine synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF11_0036 PF11_0036 "hypothetical protein, conserved" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LZM3PPCS2_ARATH6, ., 3, ., 2, ., 50.60510.98630.9320yesno
Q8GXR5PPCS1_ARATH6, ., 3, ., 2, ., 50.61230.97600.8990yesno
Q8VDG5PPCS_MOUSE6, ., 3, ., 2, ., 50.40.92460.8681yesno
Q9HAB8PPCS_HUMAN6, ., 3, ., 2, ., 50.42960.85270.8006yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.963
3rd Layer6.3.2.50.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_II1144
hypothetical protein (328 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XV.1934.1
SubName- Full=Putative uncharacterized protein; (185 aa)
      0.935
estExt_fgenesh4_pg.C_LG_XV0519
pantothenate kinase (EC-2.7.1.33) (872 aa)
      0.904
eugene3.00120751
pantothenate kinase (EC-2.7.1.33) (939 aa)
      0.903
gw1.XIV.3012.1
aspartate transaminase (EC-2.6.1.1) (403 aa)
       0.800
gw1.XIV.1323.1
cysteine synthase/L-3-cyanoalanine synthase (EC-4.4.1.9) (342 aa)
       0.800
gw1.VI.2755.1
aspartate transaminase (EC-2.6.1.1) (397 aa)
       0.800
gw1.142.135.1
hypothetical protein (336 aa)
       0.800
gw1.10449.1.1
annotation not avaliable (181 aa)
       0.800
grail3.1757000202
O-acetylserine (thiol) lyase (EC-2.5.1.47) (326 aa)
       0.800
grail3.0039007102
RecName- Full=Cysteine synthase; EC=2.5.1.47; (375 aa)
       0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
pfam04127184 pfam04127, DFP, DNA / pantothenate metabolism flav 7e-20
PRK05579399 PRK05579, PRK05579, bifunctional phosphopantotheno 5e-19
COG0452392 COG0452, Dfp, Phosphopantothenoylcysteine syntheta 1e-12
TIGR00521390 TIGR00521, coaBC_dfp, phosphopantothenoylcysteine 3e-11
TIGR02114227 TIGR02114, coaB_strep, phosphopantothenate--cystei 6e-06
PRK13982475 PRK13982, PRK13982, bifunctional SbtC-like/phospho 2e-05
PRK06732229 PRK06732, PRK06732, phosphopantothenate--cysteine 8e-05
PRK09620229 PRK09620, PRK09620, hypothetical protein; Provisio 0.003
>gnl|CDD|217913 pfam04127, DFP, DNA / pantothenate metabolism flavoprotein Back     alignment and domain information
 Score = 84.7 bits (211), Expect = 7e-20
 Identities = 63/207 (30%), Positives = 93/207 (44%), Gaps = 50/207 (24%)

Query: 43  RRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAV-IFLYRRGTCE--- 98
           ++V  +T+G T  P++   VRYI N SSG           KMGYA+     RRG  E   
Sbjct: 4   KKV-LITAGPTREPIDP--VRYITNRSSG-----------KMGYALAEAAARRG-AEVTL 48

Query: 99  ---PYCSSLPDDAFLECFEVTEESAVQGSSRRPSVEASLYNYIRMLQMIAVSSRSLGPCS 155
              P   SLP    +E   V  ESA +                 ML+  AV         
Sbjct: 49  VSGP--VSLPPPPGVEVIRV--ESAEE-----------------MLE--AVLEA-FPDAD 84

Query: 156 MFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLE 215
           +  +AAAV+D+      +AE KI+     L ++L++ P +L+ L K   P  F + F  E
Sbjct: 85  IIIMAAAVADYRP--AEVAEGKIKKEDDELTLELVKNPDILAELGKLKKPGQFLVGFAAE 142

Query: 216 TDAEILLEKADMARKKYGMHAVVANEL 242
           T+   LLE A    ++ G+  +VAN++
Sbjct: 143 TEN--LLENARAKLERKGLDLIVANDV 167


The DNA/pantothenate metabolism flavoprotein (EC:4.1.1.36) affects synthesis of DNA, and pantothenate metabolism. Length = 184

>gnl|CDD|235513 PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>gnl|CDD|223529 COG0452, Dfp, Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233006 TIGR00521, coaBC_dfp, phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase Back     alignment and domain information
>gnl|CDD|131169 TIGR02114, coaB_strep, phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>gnl|CDD|172484 PRK13982, PRK13982, bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>gnl|CDD|235856 PRK06732, PRK06732, phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>gnl|CDD|181997 PRK09620, PRK09620, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 292
KOG2728302 consensus Uncharacterized conserved protein with s 100.0
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 100.0
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 100.0
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 100.0
PRK09620229 hypothetical protein; Provisional 100.0
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 100.0
PRK06732229 phosphopantothenate--cysteine ligase; Validated 100.0
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 100.0
COG0452392 Dfp Phosphopantothenoylcysteine synthetase/decarbo 100.0
PRK06398258 aldose dehydrogenase; Validated 98.03
PRK06179270 short chain dehydrogenase; Provisional 97.95
PRK05717255 oxidoreductase; Validated 97.93
PRK06138252 short chain dehydrogenase; Provisional 97.9
PRK06841255 short chain dehydrogenase; Provisional 97.88
PRK07856252 short chain dehydrogenase; Provisional 97.87
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.87
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 97.87
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.86
PRK06194287 hypothetical protein; Provisional 97.86
PRK06523260 short chain dehydrogenase; Provisional 97.86
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 97.85
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 97.84
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 97.84
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.83
PRK08628258 short chain dehydrogenase; Provisional 97.79
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 97.79
PRK05867253 short chain dehydrogenase; Provisional 97.78
PRK08265261 short chain dehydrogenase; Provisional 97.77
PRK07063260 short chain dehydrogenase; Provisional 97.77
PRK07523255 gluconate 5-dehydrogenase; Provisional 97.76
PRK08226263 short chain dehydrogenase; Provisional 97.76
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 97.76
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 97.75
PLN02253280 xanthoxin dehydrogenase 97.75
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.72
PRK12937245 short chain dehydrogenase; Provisional 97.71
PRK07062265 short chain dehydrogenase; Provisional 97.71
PRK08589272 short chain dehydrogenase; Validated 97.71
PRK06114254 short chain dehydrogenase; Provisional 97.71
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.7
PRK07097265 gluconate 5-dehydrogenase; Provisional 97.7
PRK05854313 short chain dehydrogenase; Provisional 97.69
PRK06196315 oxidoreductase; Provisional 97.68
PRK07814263 short chain dehydrogenase; Provisional 97.68
PRK05876275 short chain dehydrogenase; Provisional 97.68
PRK06128300 oxidoreductase; Provisional 97.67
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 97.67
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 97.66
PRK06180277 short chain dehydrogenase; Provisional 97.65
PRK07774250 short chain dehydrogenase; Provisional 97.64
PRK06482276 short chain dehydrogenase; Provisional 97.64
PRK12743256 oxidoreductase; Provisional 97.63
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.63
PRK07478254 short chain dehydrogenase; Provisional 97.63
PRK08085254 gluconate 5-dehydrogenase; Provisional 97.63
PRK07791286 short chain dehydrogenase; Provisional 97.62
PRK06197306 short chain dehydrogenase; Provisional 97.62
PRK05872296 short chain dehydrogenase; Provisional 97.62
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 97.62
PRK07067257 sorbitol dehydrogenase; Provisional 97.61
PRK06182273 short chain dehydrogenase; Validated 97.6
PRK07577234 short chain dehydrogenase; Provisional 97.6
PRK08643256 acetoin reductase; Validated 97.6
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.6
PRK12827249 short chain dehydrogenase; Provisional 97.6
PRK07035252 short chain dehydrogenase; Provisional 97.59
PRK07985294 oxidoreductase; Provisional 97.59
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.58
PRK12828239 short chain dehydrogenase; Provisional 97.58
PRK08251248 short chain dehydrogenase; Provisional 97.58
PRK08303305 short chain dehydrogenase; Provisional 97.57
PRK07825273 short chain dehydrogenase; Provisional 97.57
PRK08267260 short chain dehydrogenase; Provisional 97.57
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 97.56
PRK06500249 short chain dehydrogenase; Provisional 97.56
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 97.56
PRK12829264 short chain dehydrogenase; Provisional 97.56
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 97.56
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.55
PRK08263275 short chain dehydrogenase; Provisional 97.55
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 97.55
PRK09186256 flagellin modification protein A; Provisional 97.55
PRK12939250 short chain dehydrogenase; Provisional 97.54
PRK08213259 gluconate 5-dehydrogenase; Provisional 97.54
PRK08340259 glucose-1-dehydrogenase; Provisional 97.53
PRK07109 334 short chain dehydrogenase; Provisional 97.53
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 97.53
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.52
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 97.52
PRK07890258 short chain dehydrogenase; Provisional 97.52
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.51
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.51
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 97.51
PRK12935247 acetoacetyl-CoA reductase; Provisional 97.51
PRK09134258 short chain dehydrogenase; Provisional 97.5
PRK07074257 short chain dehydrogenase; Provisional 97.5
PRK09135249 pteridine reductase; Provisional 97.49
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.49
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 97.49
PRK07024257 short chain dehydrogenase; Provisional 97.48
PRK08278273 short chain dehydrogenase; Provisional 97.48
PRK06914280 short chain dehydrogenase; Provisional 97.48
PRK08936261 glucose-1-dehydrogenase; Provisional 97.48
PRK08339263 short chain dehydrogenase; Provisional 97.48
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 97.48
PRK06124256 gluconate 5-dehydrogenase; Provisional 97.47
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.47
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 97.46
PRK12744257 short chain dehydrogenase; Provisional 97.46
PRK08277278 D-mannonate oxidoreductase; Provisional 97.46
PRK06483236 dihydromonapterin reductase; Provisional 97.45
PRK10538248 malonic semialdehyde reductase; Provisional 97.45
PRK05693274 short chain dehydrogenase; Provisional 97.45
PRK07806248 short chain dehydrogenase; Provisional 97.45
PRK06139 330 short chain dehydrogenase; Provisional 97.45
COG0300265 DltE Short-chain dehydrogenases of various substra 97.45
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.45
PRK09242257 tropinone reductase; Provisional 97.44
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 97.44
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.44
PRK05866293 short chain dehydrogenase; Provisional 97.43
PRK05875276 short chain dehydrogenase; Provisional 97.43
PRK06484520 short chain dehydrogenase; Validated 97.43
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 97.43
PRK07904253 short chain dehydrogenase; Provisional 97.42
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.42
PRK06172253 short chain dehydrogenase; Provisional 97.41
PRK06701290 short chain dehydrogenase; Provisional 97.41
PRK09072263 short chain dehydrogenase; Provisional 97.41
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 97.4
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.4
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 97.39
PRK06720169 hypothetical protein; Provisional 97.38
PRK07453322 protochlorophyllide oxidoreductase; Validated 97.38
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 97.38
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 97.37
PRK07576264 short chain dehydrogenase; Provisional 97.37
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.36
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.36
PRK05993277 short chain dehydrogenase; Provisional 97.36
PRK06198260 short chain dehydrogenase; Provisional 97.35
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 97.35
PRK06057255 short chain dehydrogenase; Provisional 97.35
PRK08862227 short chain dehydrogenase; Provisional 97.34
PRK07326237 short chain dehydrogenase; Provisional 97.33
PRK07677252 short chain dehydrogenase; Provisional 97.31
PRK07832272 short chain dehydrogenase; Provisional 97.31
PRK06947248 glucose-1-dehydrogenase; Provisional 97.31
PRK06949258 short chain dehydrogenase; Provisional 97.29
PRK06123248 short chain dehydrogenase; Provisional 97.29
PRK08264238 short chain dehydrogenase; Validated 97.28
PRK07454241 short chain dehydrogenase; Provisional 97.28
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 97.28
PRK12746254 short chain dehydrogenase; Provisional 97.28
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.28
PRK06484 520 short chain dehydrogenase; Validated 97.27
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 97.27
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.26
PRK08703239 short chain dehydrogenase; Provisional 97.26
TIGR02415254 23BDH acetoin reductases. One member of this famil 97.25
PRK05855582 short chain dehydrogenase; Validated 97.25
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 97.23
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 97.21
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 97.21
PRK07201657 short chain dehydrogenase; Provisional 97.21
PRK05650270 short chain dehydrogenase; Provisional 97.2
PRK06181263 short chain dehydrogenase; Provisional 97.2
PLN00198338 anthocyanidin reductase; Provisional 97.2
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 97.19
PRK07831262 short chain dehydrogenase; Provisional 97.16
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 97.16
PRK07775274 short chain dehydrogenase; Provisional 97.15
PRK07069251 short chain dehydrogenase; Validated 97.13
PRK12824245 acetoacetyl-CoA reductase; Provisional 97.11
PLN02653 340 GDP-mannose 4,6-dehydratase 97.11
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 97.09
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 97.09
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 97.08
PRK08177225 short chain dehydrogenase; Provisional 97.07
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.05
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.04
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 97.04
smart00822180 PKS_KR This enzymatic domain is part of bacterial 97.03
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 97.01
PLN02778298 3,5-epimerase/4-reductase 97.0
PRK07102243 short chain dehydrogenase; Provisional 97.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 96.99
PRK05599246 hypothetical protein; Provisional 96.98
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.96
PRK12747252 short chain dehydrogenase; Provisional 96.93
PRK06924251 short chain dehydrogenase; Provisional 96.92
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 96.92
COG1028251 FabG Dehydrogenases with different specificities ( 96.92
PLN02896 353 cinnamyl-alcohol dehydrogenase 96.91
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 96.91
PLN02650 351 dihydroflavonol-4-reductase 96.9
PRK12742237 oxidoreductase; Provisional 96.88
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 96.87
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 96.85
PRK06125259 short chain dehydrogenase; Provisional 96.83
PLN02572 442 UDP-sulfoquinovose synthase 96.81
PLN02695 370 GDP-D-mannose-3',5'-epimerase 96.81
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 96.79
PLN02427 386 UDP-apiose/xylose synthase 96.76
PRK07060245 short chain dehydrogenase; Provisional 96.75
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 96.74
PRK08324681 short chain dehydrogenase; Validated 96.73
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.72
PRK07023243 short chain dehydrogenase; Provisional 96.71
PRK08017256 oxidoreductase; Provisional 96.71
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 96.7
KOG0725270 consensus Reductases with broad range of substrate 96.64
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 96.64
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 96.63
PRK07578199 short chain dehydrogenase; Provisional 96.6
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 96.6
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 96.6
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 96.59
PLN02206442 UDP-glucuronate decarboxylase 96.58
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 96.58
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 96.57
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 96.54
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.48
PLN02166436 dTDP-glucose 4,6-dehydratase 96.47
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 96.47
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 96.45
PRK09009235 C factor cell-cell signaling protein; Provisional 96.39
KOG1208314 consensus Dehydrogenases with different specificit 96.35
CHL00194317 ycf39 Ycf39; Provisional 96.32
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 96.3
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 96.3
PRK08219227 short chain dehydrogenase; Provisional 96.26
PRK10675 338 UDP-galactose-4-epimerase; Provisional 96.23
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.2
PRK06940275 short chain dehydrogenase; Provisional 96.15
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 96.12
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 96.09
PRK12367245 short chain dehydrogenase; Provisional 96.03
PLN00015308 protochlorophyllide reductase 96.01
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 95.98
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 95.94
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 95.92
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 95.85
PLN02780320 ketoreductase/ oxidoreductase 95.85
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 95.83
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 95.77
PLN02583297 cinnamoyl-CoA reductase 95.72
PLN00016378 RNA-binding protein; Provisional 95.57
PRK06101240 short chain dehydrogenase; Provisional 95.41
PLN02260668 probable rhamnose biosynthetic enzyme 95.3
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 95.27
PRK07041230 short chain dehydrogenase; Provisional 95.22
PRK09291257 short chain dehydrogenase; Provisional 95.21
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 95.04
PRK12320 699 hypothetical protein; Provisional 94.99
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 94.97
PRK07201 657 short chain dehydrogenase; Provisional 94.88
PRK08309177 short chain dehydrogenase; Provisional 94.85
PLN02686367 cinnamoyl-CoA reductase 94.84
PLN02240 352 UDP-glucose 4-epimerase 94.83
PRK07424406 bifunctional sterol desaturase/short chain dehydro 94.76
PRK05865 854 hypothetical protein; Provisional 94.76
PLN02260 668 probable rhamnose biosynthetic enzyme 94.71
PRK05884223 short chain dehydrogenase; Provisional 94.68
PRK14982340 acyl-ACP reductase; Provisional 94.61
PLN02214 342 cinnamoyl-CoA reductase 94.51
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 94.45
PLN03209 576 translocon at the inner envelope of chloroplast su 94.31
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.24
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 93.99
PRK06953222 short chain dehydrogenase; Provisional 93.82
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 93.8
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 93.59
COG0623259 FabI Enoyl-[acyl-carrier-protein] 93.35
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 93.35
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 93.14
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 93.09
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 93.06
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.78
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 92.41
PLN02996 491 fatty acyl-CoA reductase 91.83
COG2910211 Putative NADH-flavin reductase [General function p 91.66
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 91.58
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 91.03
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.95
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 90.73
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 90.24
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 89.64
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.55
TIGR01746 367 Thioester-redct thioester reductase domain. It has 89.44
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 89.37
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 89.32
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 89.16
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 89.12
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 88.78
PRK06719157 precorrin-2 dehydrogenase; Validated 88.47
PRK06718202 precorrin-2 dehydrogenase; Reviewed 87.85
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.84
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 87.71
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 87.61
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.44
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 87.4
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 87.37
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 87.37
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 87.33
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 87.31
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 87.12
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.12
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.54
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.45
PRK06849 389 hypothetical protein; Provisional 86.42
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.28
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 86.24
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 86.13
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.79
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.63
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 85.02
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.94
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 84.8
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 84.56
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 84.09
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 83.41
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.25
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.2
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 82.87
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.85
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.25
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.07
COG3320 382 Putative dehydrogenase domain of multifunctional n 81.83
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 81.8
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.8
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 81.64
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 81.15
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 80.72
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 80.51
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 80.39
>KOG2728 consensus Uncharacterized conserved protein with similarity to phosphopantothenoylcysteine synthetase/decarboxylase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.7e-61  Score=433.47  Aligned_cols=275  Identities=47%  Similarity=0.723  Sum_probs=242.1

Q ss_pred             hhccCCCCCCHHHHHHHHHHHHhcCCCCCCCCceEEEecCCcccccCCCceeeeecCCccHHHHHHHHHHHHCCCeEEEE
Q 022803           12 FFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFL   91 (292)
Q Consensus        12 ~~~~~~~~~~~~~i~~~~~~~l~~~~~l~~~~k~VLITaG~T~E~ID~~~VR~ItN~SSG~~G~~iAe~~~~~Ga~V~~i   91 (292)
                      ||..++.++.+++....+++|+..+.++.| +|.||||||||.+||+.|+||||+|||+|.+|++.||+|++.||.|+|+
T Consensus         1 ~~~~~p~p~~~~d~~s~~~eFi~~q~s~~~-rrIVlVTSGGTtVPLE~ntVRFiDNFSaGtRGAaSAE~Fl~agYaVIFl   79 (302)
T KOG2728|consen    1 FFEMNPVPESLDDPGSLIEEFIKLQASLQG-RRIVLVTSGGTTVPLEQNTVRFIDNFSAGTRGAASAEYFLAAGYAVIFL   79 (302)
T ss_pred             CCCcCCCcccccchhHHHHHHHHHHhhccC-ceEEEEecCCeEeecccCceEeeeccCcCCccchhHHHHHhCCceEEEE
Confidence            688899999999888788999988766665 6799999999999999999999999999999999999999999999999


Q ss_pred             eeCCCCCCccCCCCCccchhhhhcccccc---eEEeec------------------cc--ccc-cchhHHHHHHHHHHHH
Q 022803           92 YRRGTCEPYCSSLPDDAFLECFEVTEESA---VQGSSR------------------RP--SVE-ASLYNYIRMLQMIAVS  147 (292)
Q Consensus        92 ~g~~~~~P~~~~l~~~~~~~~~~~~~~~~---i~v~~~------------------~~--a~~-~tv~dy~~m~~~i~~~  147 (292)
                      |+..|+.||+|++|.+.+...+...+...   +.-...                  .+  ++. ||+.||.+++++++++
T Consensus        80 ~R~~Sl~Py~R~f~~~~~~~~l~~~g~~~~~~i~~~e~~~~vf~~~~~~~k~~~k~~~lL~vpFtT~~~Yl~~L~aiae~  159 (302)
T KOG2728|consen   80 YRERSLFPYTRHFPGQTWFLFLRPSGSALSGLIEKEENALPVFAEALEKYKYAEKAGTLLYVPFTTLADYLWLLRAIAEA  159 (302)
T ss_pred             eeccccccccccCCCchhhhhhccCCcccccceecCchhhHHHHHHHHHHHHHHhhCcEEEEecchHHHHHHHHHHHHHH
Confidence            99999999999999766666665533222   100000                  00  111 9999999999999999


Q ss_pred             HhhcCCCceEEEeecccCCcCCccccccccccCCCCCceEEEEeCcchhHHHhhccCCCeEEEEEeeccCcHHHHHHHHH
Q 022803          148 SRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADM  227 (292)
Q Consensus       148 l~~~~~~d~~i~aAAVsDf~v~~~~~~~~KI~s~~~~l~l~L~~~PkIl~~i~~~~~p~~~lVgFklEt~~e~l~~~A~~  227 (292)
                      ++.++...++++|||||||+||+..+++|||+|+++.|.|+|.++||+|+.+...|.|++++|+||||||+..||.+|+.
T Consensus       160 Ln~~~sramfYLAAAVSDFyVP~~~mpeHKIqSg~~~l~i~l~~VPK~L~~Lv~~WaP~AfiiSFKLETDesiLi~KAr~  239 (302)
T KOG2728|consen  160 LNPLGSRAMFYLAAAVSDFYVPESEMPEHKIQSGSGPLQITLKPVPKMLSPLVSDWAPKAFIISFKLETDESILINKARK  239 (302)
T ss_pred             hccccchHHHHHHHHhcccccChhhcchhhcccCCCCceEEeccchHHHHHHHHhhCcceEEEEEEecCChHHHHHHHHH
Confidence            99999999999999999999999999999999998899999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCEEEEeccCCCCcEEEEEeCCCee--eecCCCCCChHHHHHHHHHHHHHHHHHHHHhcC
Q 022803          228 ARKKYGMHAVVANELLSRKEQVVVVTNNGKI--PVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSN  291 (292)
Q Consensus       228 kL~~k~~D~VvaN~l~~~~n~v~li~~~~~~--~~~~~~k~~k~~ia~~Iv~~i~~~~~~~~~~~~  291 (292)
                      .|++|++.+||||.+++++.+|++++++-..  ++...+    ..|++-|++.+.++|.+||.++.
T Consensus       240 AL~kY~HqlVIAN~LsTRk~~V~fVt~~~~~~~~l~~~~----~~IE~~ii~~vv~rH~~~I~~a~  301 (302)
T KOG2728|consen  240 ALEKYKHQLVIANLLSTRKSRVVFVTKNIVQWLELDKAP----GAIEDSIIKLVVSRHKEFIDEAQ  301 (302)
T ss_pred             HHHHhCceeeeeehhhhcceeEEEEecCcceeeeccccc----chhHHHHHHHHHHHHHHHHHhhc
Confidence            9999999999999999999999999976544  333333    56999999999999999999864



>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
1p9o_A313 Crystal Structure Of Phosphopantothenoylcysteine Sy 5e-54
2gk4_A232 The Crystal Structure Of The Dna/pantothenate Metab 2e-06
>pdb|1P9O|A Chain A, Crystal Structure Of Phosphopantothenoylcysteine Synthetase Length = 313 Back     alignment and structure

Iteration: 1

Score = 207 bits (527), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 118/277 (42%), Positives = 157/277 (56%), Gaps = 28/277 (10%) Query: 43 RRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCS 102 RRV VTSGGT VPLE R VR++DNFSSG RGA S E + GY V+FLYR + PY Sbjct: 37 RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAH 96 Query: 103 SLPDDAFLECFEVT------------EESAVQG--SSRRPSVEA------------SLYN 136 P +L + EE+A+ G + R EA +L + Sbjct: 97 RFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLAD 156 Query: 137 YIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKML 196 Y+ +LQ A + LGP +MFYLAAAVSDFYVP M EHKI+S GPL + + VPK+L Sbjct: 157 YLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEHKIESSGGPLQITMKMVPKLL 216 Query: 197 SVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVVANELLSRKEQVVVVTNNG 256 S L K+WAP AF ISFKLETD I++ +A A + Y VVAN L SR+ V++VT + Sbjct: 217 SPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVVANILESRQSFVLIVTKDS 276 Query: 257 --KIPVYRDKTSSDSDVEKPLTKLLVDRHSVYIKDSN 291 K+ + ++ ++E+ + L RH+ +I D N Sbjct: 277 ETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFIGDRN 313
>pdb|2GK4|A Chain A, The Crystal Structure Of The Dna/pantothenate Metabolism Flavoprotein From Streptococcus Pneumoniae Length = 232 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 2e-82
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 5e-16
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Length = 313 Back     alignment and structure
 Score =  250 bits (638), Expect = 2e-82
 Identities = 117/310 (37%), Positives = 159/310 (51%), Gaps = 30/310 (9%)

Query: 10  ESFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFS 69
                  P     A  ++ +  F A   ++   RRV  VTSGGT VPLE R VR++DNFS
Sbjct: 6   MDPVAEFPQPPGAARWAEVMARFAARLGAQG--RRVVLVTSGGTKVPLEARPVRFLDNFS 63

Query: 70  SGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQGSSRRPS 129
           SG RGA S E  +  GY V+FLYR  +  PY    P   +L     +  +     S    
Sbjct: 64  SGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAE 123

Query: 130 VEA--------------------------SLYNYIRMLQMIAVSSRSLGPCSMFYLAAAV 163
             A                          +L +Y+ +LQ  A +   LGP +MFYLAAAV
Sbjct: 124 ENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAV 183

Query: 164 SDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLE 223
           SDFYVP   M EHKI+S  GPL + +  VPK+LS L K+WAP AF ISFKLETD  I++ 
Sbjct: 184 SDFYVPVSEMPEHKIESSGGPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVIN 243

Query: 224 KADMARKKYGMHAVVANELLSRKEQVVVVTNNG--KIPVYRDKTSSDSDVEKPLTKLLVD 281
           +A  A + Y    VVAN L SR+  V++VT +   K+ +  ++     ++E+ +   L  
Sbjct: 244 RARKALEIYQHQVVVANILESRQSFVLIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQS 303

Query: 282 RHSVYIKDSN 291
           RH+ +I D N
Sbjct: 304 RHTAFIGDRN 313


>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Length = 232 Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Length = 226 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 100.0
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 100.0
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 98.28
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.23
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 98.21
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 98.2
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 98.2
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.19
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.18
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 98.18
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.18
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 98.13
3rih_A293 Short chain dehydrogenase or reductase; structural 98.13
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.13
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.12
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.12
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 98.12
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 98.11
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 98.11
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.1
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 98.1
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.1
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 98.09
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 98.08
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.08
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.07
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.07
3imf_A257 Short chain dehydrogenase; structural genomics, in 98.07
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.07
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 98.07
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.07
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.06
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.06
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.06
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.06
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.05
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.05
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 98.05
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.05
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.05
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.04
3tsc_A277 Putative oxidoreductase; structural genomics, seat 98.04
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.04
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.04
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.04
4dqx_A277 Probable oxidoreductase protein; structural genomi 98.04
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 98.04
3e03_A274 Short chain dehydrogenase; structural genomics, PS 98.04
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.03
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 98.03
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.03
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.02
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.02
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.02
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.02
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 98.02
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.02
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.02
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 98.02
3gem_A260 Short chain dehydrogenase; structural genomics, AP 98.01
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.01
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.01
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.01
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.01
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.01
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 98.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.99
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.99
3edm_A259 Short chain dehydrogenase; structural genomics, ox 97.99
1nff_A260 Putative oxidoreductase RV2002; directed evolution 97.99
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.98
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.98
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.98
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.98
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 97.98
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 97.98
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 97.98
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.98
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.97
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.97
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.97
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.97
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.97
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.97
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.97
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.97
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 97.97
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 97.97
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 97.97
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.97
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.96
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.96
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 97.96
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 97.96
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 97.96
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.95
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.95
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 97.95
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.95
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.95
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 97.95
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.95
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.94
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.94
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.94
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 97.94
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.94
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 97.93
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 97.93
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.93
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.93
3qlj_A322 Short chain dehydrogenase; structural genomics, se 97.93
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.93
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.93
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 97.93
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.93
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 97.92
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.92
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 97.92
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.92
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 97.91
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 97.91
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.91
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.91
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 97.91
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.91
1xkq_A280 Short-chain reductase family member (5D234); parra 97.91
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.9
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 97.9
3tox_A280 Short chain dehydrogenase; structural genomics, PS 97.9
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 97.9
3cxt_A291 Dehydrogenase with different specificities; rossma 97.9
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.9
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.9
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 97.9
3tjr_A301 Short chain dehydrogenase; structural genomics, se 97.89
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.89
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 97.89
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.89
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.89
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.89
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.88
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.88
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.88
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 97.88
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.88
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 97.88
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.88
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.88
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.88
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 97.87
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 97.87
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 97.87
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 97.87
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 97.86
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.86
1spx_A278 Short-chain reductase family member (5L265); paral 97.85
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 97.84
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.84
1xhl_A297 Short-chain dehydrogenase/reductase family member 97.82
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.82
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.82
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.81
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.81
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 97.81
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 97.81
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.8
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.8
1xq1_A266 Putative tropinone reducatse; structural genomics, 97.79
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.75
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 97.75
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.74
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 97.73
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 97.73
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.71
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.7
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.69
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.69
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 97.69
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 97.69
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 97.69
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 97.68
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.68
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 97.68
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 97.68
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 97.66
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 97.65
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 97.64
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.63
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.62
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 97.62
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.62
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.62
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 97.61
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 97.6
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 97.58
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 97.56
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 97.56
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 97.56
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.55
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 97.54
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 97.51
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.51
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.51
4e4y_A244 Short chain dehydrogenase family protein; structur 97.51
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 97.5
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.48
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 97.45
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 97.45
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.44
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.44
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.41
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 97.38
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.38
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.37
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.37
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.36
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.36
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 97.34
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.33
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 97.32
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 97.32
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 97.31
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 97.3
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 97.29
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 97.28
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 97.28
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.26
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 97.25
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 97.25
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 97.24
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 97.23
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 97.22
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.22
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.22
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.2
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 97.2
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 97.19
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 97.19
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 97.18
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 97.17
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 97.14
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.14
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.12
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.12
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 97.11
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 97.09
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 97.09
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 97.08
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 97.07
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 97.06
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 97.03
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 97.03
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 97.03
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 97.03
1xq6_A253 Unknown protein; structural genomics, protein stru 97.03
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 97.01
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 97.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 96.98
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 96.98
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 96.97
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 96.97
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 96.96
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.95
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 96.95
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.95
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 96.94
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 96.94
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.91
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 96.91
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 96.91
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.89
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 96.88
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 96.84
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 96.83
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 96.83
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.82
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.75
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 96.72
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.66
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 96.66
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 96.64
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 96.63
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.58
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.57
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.56
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 96.56
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.56
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.55
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 96.53
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.48
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.47
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.47
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 96.46
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 96.43
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.42
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.41
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 96.38
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 96.27
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 96.26
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 96.22
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.22
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.19
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 96.11
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 96.06
3slk_A795 Polyketide synthase extender module 2; rossmann fo 96.05
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 96.05
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 96.04
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.79
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 95.69
4f6l_B 508 AUSA reductase domain protein; thioester reductase 95.36
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 95.06
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.73
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 94.35
4f6c_A 427 AUSA reductase domain protein; thioester reductase 94.16
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 94.04
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 93.76
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 92.1
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 91.76
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 91.12
1lss_A140 TRK system potassium uptake protein TRKA homolog; 90.92
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.73
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 90.63
3p2o_A285 Bifunctional protein fold; structural genomics, ce 90.26
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 89.64
3l07_A285 Bifunctional protein fold; structural genomics, ID 89.61
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.24
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.7
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.38
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 87.33
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 86.55
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 86.49
1id1_A153 Putative potassium channel protein; RCK domain, E. 86.38
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 86.21
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 86.02
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 85.88
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 85.51
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 85.5
4amg_A 400 Snogd; transferase, polyketide biosynthesis, GT1 f 85.35
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 85.09
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 84.61
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 84.54
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 84.3
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 83.97
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 83.89
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 83.56
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 83.02
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 82.91
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 82.63
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 82.44
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 82.08
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 81.77
4eye_A342 Probable oxidoreductase; structural genomics, niai 81.66
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 81.3
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 81.19
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 80.67
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 80.58
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
Probab=100.00  E-value=4e-69  Score=506.18  Aligned_cols=276  Identities=41%  Similarity=0.651  Sum_probs=201.1

Q ss_pred             hhhccCCCCCCHHHHHHHHHHHHhcCCCCCCCCce-EEEecCCcccccCCCceeeeecCCccHHHHHHHHHHHHCCCeEE
Q 022803           11 SFFDSAPPLNDRAAISQKLKEFIALNSSESGTRRV-ACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVI   89 (292)
Q Consensus        11 ~~~~~~~~~~~~~~i~~~~~~~l~~~~~l~~~~k~-VLITaG~T~E~ID~~~VR~ItN~SSG~~G~~iAe~~~~~Ga~V~   89 (292)
                      .||++.++|++.++|+..+.+|+.++ ++.|  |+ ||||||||+||||++|||||||+|||+||++||++|+++||+|+
T Consensus         7 ~ff~~~p~p~~~~~i~~~i~~~~~~~-~l~g--k~~VLITaGgT~EpID~DpVRfItN~SSGkmG~aiAe~~~~~Ga~V~   83 (313)
T 1p9o_A            7 DPVAEFPQPPGAARWAEVMARFAARL-GAQG--RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVL   83 (313)
T ss_dssp             -------------CHHHHHHHHHHHH-HHTT--CCEEEEEESBCEEESSSSCSEEEEECCCCHHHHHHHHHHHHTTCEEE
T ss_pred             HHHhcCCCcccHHHHHHHHHHHhhhh-hhcC--CeEEEEeCCCcccccCCCceeEecCCCCcHHHHHHHHHHHHCCCEEE
Confidence            89999999999999999999999754 5655  66 99999999999966699999999999999999999999999999


Q ss_pred             EEeeCCCCCCccCCCCCccchhhhhccc--ccc---eE--Eeecc---ccc----------------ccchhHHHHHHHH
Q 022803           90 FLYRRGTCEPYCSSLPDDAFLECFEVTE--ESA---VQ--GSSRR---PSV----------------EASLYNYIRMLQM  143 (292)
Q Consensus        90 ~i~g~~~~~P~~~~l~~~~~~~~~~~~~--~~~---i~--v~~~~---~a~----------------~~tv~dy~~m~~~  143 (292)
                      ||||++++.|+.+++|..++++++....  ..+   +.  +.+..   .|+                -+|+.||+.+++.
T Consensus        84 lv~g~~sl~p~~r~~~~~~~~~~~~~~~~~~~~~~~i~v~v~sa~~m~~av~~~~~~~~~~~l~~i~f~tv~eyl~~L~~  163 (313)
T 1p9o_A           84 FLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQA  163 (313)
T ss_dssp             EEEETTSCCTTGGGSCHHHHHHHCEECCC-CCSEEEEEEETTTSTTHHHHHHHHHHHHHHTCEEEEEECBHHHHHHHHHH
T ss_pred             EEecCCCcCcchhccCccchhhhhccccccccccceeeeccccHHHHHHHHHHHhhhhccccceeeccccHHHHHHHHHH
Confidence            9999999989888887433344333211  011   11  11110   011                1799999999999


Q ss_pred             HHHHHhhcCCCceEEEeecccCCcCCccccccccccCCCCCceEEEEeCcchhHHHhhccCCCeEEEEEeeccCcHHHHH
Q 022803          144 IAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLE  223 (292)
Q Consensus       144 i~~~l~~~~~~d~~i~aAAVsDf~v~~~~~~~~KI~s~~~~l~l~L~~~PkIl~~i~~~~~p~~~lVgFklEt~~e~l~~  223 (292)
                      +++.++.++.+|++|+|||||||++|...++++||||+++.++|+|++|||||+.|++.|.|++++|||||||++++|++
T Consensus       164 ~~~~l~~~~~~di~i~aAAVsDf~~p~~~~~~~KIkk~~~~l~L~L~~~PdIL~~l~~~~~p~~~lVGFkaET~~~~l~~  243 (313)
T 1p9o_A          164 AAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEHKIESSGGPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVIN  243 (313)
T ss_dssp             HHHHHGGGGGGEEEEECSBCCSEECC--------------CEEEECEECGGGGSCCGGGTCTTSEEEEEECCCCHHHHHH
T ss_pred             hhHHhhccCCCCEEEECCchhhccCCcccccccccccCCCCceEEeecCchHHHHHHhhcCCCcEEEEEEecCCChHHHH
Confidence            98888889999999999999999987677889999997567999999999999999988988889999999999888999


Q ss_pred             HHHHHHHHhCCCEEEEeccCCCCcEEEEEeCCCeeeecCCCCC---ChHHHHHHHHHHHHHHHHHHHHhc
Q 022803          224 KADMARKKYGMHAVVANELLSRKEQVVVVTNNGKIPVYRDKTS---SDSDVEKPLTKLLVDRHSVYIKDS  290 (292)
Q Consensus       224 ~A~~kL~~k~~D~VvaN~l~~~~n~v~li~~~~~~~~~~~~k~---~k~~ia~~Iv~~i~~~~~~~~~~~  290 (292)
                      +|++||++|||||||||++++++|+|+|++++|...++ ++|.   .+.+||+.|+++|.++|++||..+
T Consensus       244 ~A~~kL~~k~~DlIVaN~l~~~~n~v~li~~~~~~~~~-~sK~~~a~~~eIa~~Iv~~l~~~h~~~i~~~  312 (313)
T 1p9o_A          244 RARKALEIYQHQVVVANILESRQSFVLIVTKDSETKLL-LSEEEIEKGVEIEEKIVDNLQSRHTAFIGDR  312 (313)
T ss_dssp             HHHHHHHHHCCSEEEEEC------CEEEEETTEEEEEC-CCHHHHHTTCCHHHHHHHHHHHHHHHHC---
T ss_pred             HHHHHHHHcCCCEEEEecCcCCccEEEEEECCCcEEcc-CCHHHHccchHHHHHHHHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999876664 6641   123466999999999999999865



>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 292
d1p9oa_290 c.72.3.1 (A:) Phosphopantothenoylcysteine syntheta 1e-58
d1u7za_223 c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional 2e-13
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Length = 290 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: CoaB-like
family: CoaB-like
domain: Phosphopantothenoylcysteine synthetase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  187 bits (475), Expect = 1e-58
 Identities = 113/291 (38%), Positives = 155/291 (53%), Gaps = 30/291 (10%)

Query: 25  ISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKM 84
            ++ +  F A   ++   RRV  VTSGGT VPLE R VR++DNFSSG RGA S E  +  
Sbjct: 2   WAEVMARFAARLGAQG--RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAA 59

Query: 85  GYAVIFLYRRGTCEPYCSSLPDDAFLECFEVTEESAVQGSSRRPSVEA------------ 132
           GY V+FLYR  +  PY    P   +L     +  +     S      A            
Sbjct: 60  GYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQ 119

Query: 133 --------------SLYNYIRMLQMIAVSSRSLGPCSMFYLAAAVSDFYVPWKSMAEHKI 178
                         +L +Y+ +LQ  A +   LGP +MFYLAAAVSDFYVP   M EHKI
Sbjct: 120 EAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPVSEMPEHKI 179

Query: 179 QSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVV 238
           +S  GPL + +  VPK+LS L K+WAP AF ISFKLETD  I++ +A  A + Y    VV
Sbjct: 180 ESSGGPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVV 239

Query: 239 ANELLSRKEQVVVVTNNG--KIPVYRDKTSSDSDVEKPLTKLLVDRHSVYI 287
           AN L SR+  V++VT +   K+ +  ++     ++E+ +   L  RH+ +I
Sbjct: 240 ANILESRQSFVLIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFI 290


>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 100.0
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 98.42
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.36
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.31
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.27
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.26
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.25
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.23
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.23
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.22
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.22
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.22
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.21
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.21
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.2
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 98.2
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.2
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.2
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 98.19
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.19
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.18
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.16
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.16
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.15
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.13
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.13
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 98.12
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.12
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 98.11
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.1
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 98.09
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.08
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 98.07
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.07
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.05
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.03
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 98.02
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.01
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.01
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.99
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.94
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.93
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.87
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 97.86
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 97.84
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.81
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.7
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 97.68
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 97.67
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.67
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.66
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 97.64
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 97.62
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 97.62
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.61
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.61
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 97.59
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 97.59
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 97.57
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 97.56
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 97.53
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.52
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.5
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 97.48
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 97.45
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 97.44
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 97.36
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 97.34
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 97.34
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 97.33
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 97.29
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 97.28
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.28
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 97.25
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.18
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 97.16
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.14
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 97.04
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 97.04
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 97.03
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 96.98
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 96.91
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.9
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 96.8
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 96.8
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.79
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 96.77
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 96.74
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.72
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.52
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.43
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 96.41
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.23
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.22
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 96.09
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 96.06
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 95.8
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 95.69
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.34
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 93.95
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 93.57
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 93.52
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 93.34
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.75
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.5
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 92.07
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.84
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.73
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.48
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.45
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 91.06
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 90.97
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 90.5
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 90.39
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 89.75
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 89.47
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 89.43
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.3
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.22
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 88.66
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 88.65
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 88.14
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 88.01
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 87.77
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 86.82
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 86.25
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 85.55
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 84.7
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 84.26
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 83.84
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 83.2
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 83.17
d1irxa2317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 82.94
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 82.9
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 81.39
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 81.23
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 80.58
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 80.1
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 80.04
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: CoaB-like
family: CoaB-like
domain: Phosphopantothenoylcysteine synthetase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.9e-65  Score=475.09  Aligned_cols=261  Identities=43%  Similarity=0.705  Sum_probs=199.5

Q ss_pred             HHHHHHHHHhcCCCCCCCCceEEEecCCcccccCCCceeeeecCCccHHHHHHHHHHHHCCCeEEEEeeCCCCCCccCCC
Q 022803           25 ISQKLKEFIALNSSESGTRRVACVTSGGTTVPLEQRCVRYIDNFSSGHRGAASTEHLIKMGYAVIFLYRRGTCEPYCSSL  104 (292)
Q Consensus        25 i~~~~~~~l~~~~~l~~~~k~VLITaG~T~E~ID~~~VR~ItN~SSG~~G~~iAe~~~~~Ga~V~~i~g~~~~~P~~~~l  104 (292)
                      |.+.+.+|+.+. .+.| +|+||||||||+||||.||||||||+|||+||++||++|+.+||+|+||+|+++..||.+++
T Consensus         2 ~~e~~~~f~~~~-~~~g-~k~VLITaG~T~epID~~pVR~ItN~SSGk~G~alA~~~~~~Ga~V~li~g~~s~~P~~~~~   79 (290)
T d1p9oa_           2 WAEVMARFAARL-GAQG-RRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRF   79 (290)
T ss_dssp             HHHHHHHHHHHH-HHTT-CCEEEEEESBCEEESSSSCSEEEEECCCCHHHHHHHHHHHHTTCEEEEEEETTSCCTTGGGS
T ss_pred             HHHHHHHHHhhc-cccC-CcEEEEccCCcCcccCCCCceEeCCCCchHHHHHHHHHHHHcCCEEEEEecCCccCcccccc
Confidence            456666777654 2344 45699999999999999999999999999999999999999999999999999999998887


Q ss_pred             CCccchhhhhcc---cccceEEeeccc----------------------ccc-cchhHHHHHHHHHHHHHhhcCCCceEE
Q 022803          105 PDDAFLECFEVT---EESAVQGSSRRP----------------------SVE-ASLYNYIRMLQMIAVSSRSLGPCSMFY  158 (292)
Q Consensus       105 ~~~~~~~~~~~~---~~~~i~v~~~~~----------------------a~~-~tv~dy~~m~~~i~~~l~~~~~~d~~i  158 (292)
                      +...++..+...   ..+.+.+.....                      .++ +|+.||.++++.+++.++..+.+|++|
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~T~~e~~~~l~~~~~~~~~~~~~d~~i  159 (290)
T d1p9oa_          80 PPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFY  159 (290)
T ss_dssp             CHHHHHHHCEECCC-CCSEEEEEEETTTSTTHHHHHHHHHHHHHHTCEEEEEECBHHHHHHHHHHHHHHHGGGGGGEEEE
T ss_pred             cccchhhhccccccccccceeecchhhHHHHHHHHHHHhhhhcccCCceEEEEeeHHHHHHHHHHHHhhccccccchHHH
Confidence            743333322211   111122211100                      011 788999999999999999999999999


Q ss_pred             EeecccCCcCCccccccccccCCCCCceEEEEeCcchhHHHhhccCCCeEEEEEeeccCcHHHHHHHHHHHHHhCCCEEE
Q 022803          159 LAAAVSDFYVPWKSMAEHKIQSGSGPLDMQLLQVPKMLSVLRKEWAPMAFCISFKLETDAEILLEKADMARKKYGMHAVV  238 (292)
Q Consensus       159 ~aAAVsDf~v~~~~~~~~KI~s~~~~l~l~L~~~PkIl~~i~~~~~p~~~lVgFklEt~~e~l~~~A~~kL~~k~~D~Vv  238 (292)
                      ||||||||+++.....++||+|..+.++|+|++|||||+.|++.|+|++++||||||||+++|+++|++||++|+||+||
T Consensus       160 ~aAAVsDf~~~~~~~~k~Ki~s~~~~l~l~L~~~PdIL~~l~~~~~p~~~~VGFkaEtd~e~l~~~A~~kL~~k~~D~Iv  239 (290)
T d1p9oa_         160 LAAAVSDFYVPVSEMPEHKIESSGGPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVV  239 (290)
T ss_dssp             ECSBCCSEECC--------------CEEEECEECGGGGSCCGGGTCTTSEEEEEECCCCHHHHHHHHHHHHHHHCCSEEE
T ss_pred             HHhccchhhccchhhhhhcccccccchhhhhccChHHHHHHHHhhCCCceEEEEEEecChHHHHHHHHHHHHHcCCCEEE
Confidence            99999999987666778899887778999999999999999989999999999999999888999999999999999999


Q ss_pred             EeccCCCCcEEEEEeCCCeeeecCCCC--CChHHHHHHHHHHHHHHHHHHH
Q 022803          239 ANELLSRKEQVVVVTNNGKIPVYRDKT--SSDSDVEKPLTKLLVDRHSVYI  287 (292)
Q Consensus       239 aN~l~~~~n~v~li~~~~~~~~~~~~k--~~k~~ia~~Iv~~i~~~~~~~~  287 (292)
                      ||++++++|+++|++++|...+...+|  ..+.+||+.|++.|.++|++||
T Consensus       240 aN~l~~~~n~v~li~~d~~~~~~~~~~~~~~~~eIa~~Ii~~i~~~~~~~~  290 (290)
T d1p9oa_         240 ANILESRQSFVLIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFI  290 (290)
T ss_dssp             EEC------CEEEEETTEEEEECCCHHHHHTTCCHHHHHHHHHHHHHHHHC
T ss_pred             EecCCCCCcEEEEEeCCCcEEecccChhhhhHHHHHHHHHHHHHHHHHhhC
Confidence            999999999999999999887655543  1234799999999999999997



>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure