Citrus Sinensis ID: 022917


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPLLEY
cccccEEEccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccccccccEEccccccEEEEEcccccccccccEEEEEEEEEEcccccccEEEEEEEEEcccccEEEEccccccccEEEEEEEEcccc
ccccEEEEccccccEcccccHHHHHcccEEEccccccHccccccHHHHHHccEEEccccccccccccccHHHcEEEEccccccHccccHHHHHHcccEEEcccccHHcccccccccccEEEccccccHcEccccccccHHHHHHHccccccccEcccccHHHccHHHHHHHHHHHHHHHHHHcHHHHHcccccccccEEEEcccccccHHHccccccccEEEEEcccccccccccEEEEEEEEEccccccccEEEEEEEEEcccccccccccccccccEEEEEEcccccc
MELLQEIDLFLSGIkelpssiehieglkclrlnsctklgflpesLCNLKKLQKLCLSQCRClilsglsslsslkclelsghnfeslptgisQLQRLKCLHLINcnmirslpelpfclnylntsdckrlqslpkisscletpsnqtrgnsylpVMFKFVNCvklhkgternfFANFQRRVHNalpgilhrketdrrRGISIclrgsgiphcwfrtqslgssitiqlprrccnkNFIGFALCAVIEFvadessffhfnvsckygsdhsfLLVDSMSVYsnhvilgfdplley
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPkisscletpsnqtrgnsYLPVMFKFVNCVKLHKGTERNFFANFQRRVHnalpgilhrketdrRRGISICLrgsgiphcWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPLLEY
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPEslcnlkklqklclsqcrclilsglsslsslkclelsGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPLLEY
*****EIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCL********GNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPL***
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPLLEY
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPLLEY
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPLLEY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHFNVSCKYGSDHSFLLVDSMSVYSNHVILGFDPLLEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query290 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.624 0.158 0.317 7e-11
Q6DHL5238 Leucine-rich repeat-conta yes no 0.365 0.445 0.385 2e-08
P0CB16 1201 Putative disease resistan no no 0.482 0.116 0.354 1e-07
Q9FKZ0815 Probable disease resistan no no 0.403 0.143 0.356 3e-07
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.462 0.130 0.325 8e-07
Q8BGR2859 Leucine-rich repeat-conta yes no 0.493 0.166 0.324 2e-06
Q5FVI3239 Leucine-rich repeat-conta yes no 0.368 0.447 0.414 3e-06
Q5U308858 Leucine-rich repeat-conta no no 0.493 0.166 0.324 4e-06
Q8N9N7239 Leucine-rich repeat-conta yes no 0.368 0.447 0.405 4e-06
Q7SXW3 601 Leucine-rich repeat-conta no no 0.393 0.189 0.328 5e-06
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 90/208 (43%), Gaps = 27/208 (12%)

Query: 41   LPESLCNLKKLQKLCLSQCRCLILSGL----SSLSSLKCLELSGHNFESLPTGISQLQRL 96
             P     L  L+ L LS C  LI  GL     SLSSLK L+LS +NFE LP+ I+QL  L
Sbjct: 825  FPPVAEGLHSLEYLNLSYCN-LIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGAL 883

Query: 97   KCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFK 156
            + L L +C  +  LPELP  LN L+  DC    +L  I               YL    K
Sbjct: 884  QSLDLKDCQRLTQLPELPPELNELHV-DCH--MALKFI--------------HYLVTKRK 926

Query: 157  FVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPH---CWFR 213
             ++ VKL        +  F   +   +  + H         +++   G   P     WF 
Sbjct: 927  KLHRVKLDDAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTV-FTGQPYPEKIPSWFH 985

Query: 214  TQSLGSSITIQLPRRC-CNKNFIGFALC 240
             Q   SS+++ LP        F+GFA+C
Sbjct: 986  HQGWDSSVSVNLPENWYIPDKFLGFAVC 1013




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q8BGR2|LRC8D_MOUSE Leucine-rich repeat-containing protein 8D OS=Mus musculus GN=Lrrc8d PE=2 SV=1 Back     alignment and function description
>sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q5U308|LRC8D_RAT Leucine-rich repeat-containing protein 8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 Back     alignment and function description
>sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 Back     alignment and function description
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
255563202 1158 leucine-rich repeat containing protein, 0.806 0.202 0.358 6e-29
255537139 1137 leucine-rich repeat-containing protein, 0.937 0.239 0.327 6e-28
224145016 1254 tir-nbs-lrr resistance protein [Populus 0.858 0.198 0.348 2e-26
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.858 0.169 0.334 1e-25
147862986 1617 hypothetical protein VITISV_027418 [Viti 0.803 0.144 0.325 2e-25
224103133 397 predicted protein [Populus trichocarpa] 0.872 0.637 0.335 3e-25
255544956 1403 leucine-rich repeat containing protein, 0.8 0.165 0.341 1e-23
224145030 1435 tir-nbs-lrr resistance protein [Populus 0.872 0.176 0.326 3e-23
224145021 1561 tir-nbs-lrr resistance protein [Populus 0.882 0.163 0.330 4e-23
359495285 1557 PREDICTED: TMV resistance protein N-like 0.931 0.173 0.317 1e-21
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  134 bits (336), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 89/248 (35%), Positives = 134/248 (54%), Gaps = 14/248 (5%)

Query: 4    LQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLI 63
            LQ + L  + +  LP +  +++ L  L  + C+KLG LP+++ NLK L +L    C    
Sbjct: 794  LQHLSLDETAMVNLPDTFCNLKALNMLNFSDCSKLGKLPKNMKNLKSLAELRAGGCNLST 853

Query: 64   L-SGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNT 122
            L + L  LSS+  L LSG NF+++P GI+QL +L+ +++  C  ++SLPELP  + YLN 
Sbjct: 854  LPADLKYLSSIVELNLSGSNFDTMPAGINQLSKLRWINVTGCKRLQSLPELPPRIRYLNA 913

Query: 123  SDCKRLQSLPKISSCLETPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNA 182
             DC+ L S+  +    E   +    NS     F F NC KL +    +  A+ Q ++ + 
Sbjct: 914  RDCRSLVSISGLKQLFELGCS----NSLDDETFVFTNCFKLDQDNWADILASAQLKIQHF 969

Query: 183  LPGILHRKETDRR--RGISICLR--GSGIPHCWFRTQSLGSSITIQ-LPRRCCNKNFIGF 237
              G   RK  DR       IC    G+ IP  WF  +S+GSS+TIQ LP    N  F+GF
Sbjct: 970  AMG---RKHYDRELYDETFICFTYPGTEIPE-WFADKSIGSSVTIQHLPPDWLNHRFLGF 1025

Query: 238  ALCAVIEF 245
            ++C V+ F
Sbjct: 1026 SVCLVVAF 1033




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147862986|emb|CAN78790.1| hypothetical protein VITISV_027418 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224103133|ref|XP_002334087.1| predicted protein [Populus trichocarpa] gi|222869543|gb|EEF06674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224145030|ref|XP_002325501.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862376|gb|EEE99882.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145021|ref|XP_002325498.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862373|gb|EEE99879.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495285|ref|XP_002276740.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.586 0.139 0.353 6.9e-21
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.593 0.142 0.311 1.1e-16
TAIR|locus:2153328 1231 AT5G45230 [Arabidopsis thalian 0.682 0.160 0.268 4.8e-16
TAIR|locus:2122925 417 AT4G19470 [Arabidopsis thalian 0.589 0.410 0.306 4.4e-15
TAIR|locus:28276391195 AT2G17060 [Arabidopsis thalian 0.606 0.147 0.312 1e-14
TAIR|locus:2122209 1179 AT4G36150 [Arabidopsis thalian 0.655 0.161 0.276 2.1e-13
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.541 0.124 0.305 2.5e-13
TAIR|locus:2153207 1165 AT5G45060 [Arabidopsis thalian 0.572 0.142 0.288 3.5e-13
TAIR|locus:21553221170 LAZ5 "LAZARUS 5" [Arabidopsis 0.586 0.145 0.286 4.1e-13
TAIR|locus:2158475 1217 RPS4 "RESISTANT TO P. SYRINGAE 0.568 0.135 0.272 1.2e-09
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 223 (83.6 bits), Expect = 6.9e-21, Sum P(2) = 6.9e-21
 Identities = 65/184 (35%), Positives = 92/184 (50%)

Query:    80 GHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQSLPKISSCLE 139
             G+N E+LP   +QL  LK   L  C M++SLP LP  L YL+  +C+ L++L   ++ L 
Sbjct:   887 GNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHECESLETL---ANPL- 942

Query:   140 TPSNQTRGNSYLPVMFKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDR----R 195
             TP   T G   +  MF F NC KL++  + +   +   R+ + L      K   R     
Sbjct:   943 TPL--TVGER-IHSMFIFSNCYKLNQDAQASLVGH--ARIKSQLMANASAKRYYRGFVPE 997

Query:   196 RGISICLRGSGIPHCWFRTQSLGSSITIQLPRRCCNKNFIGFALCAVIEFVADESSFFHF 255
               + IC   + IP  WF  Q LG S+ I LP   C+ NF+G AL  V+ F   E S   F
Sbjct:   998 PLVGICYPATEIPS-WFCHQRLGRSLEIPLPPHWCDINFVGLALSVVVSFKDYEDSAKRF 1056

Query:   256 NVSC 259
             +V C
Sbjct:  1057 SVKC 1060


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153328 AT5G45230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122925 AT4G19470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827639 AT2G17060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122209 AT4G36150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153207 AT5G45060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-12
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 66.8 bits (163), Expect = 2e-12
 Identities = 73/269 (27%), Positives = 112/269 (41%), Gaps = 46/269 (17%)

Query: 9    LFLSGIK---ELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCL--- 62
            LFLS I    ELPSSI+++  L+ L + +C  L  LP  + NL+ L+ L LS C  L   
Sbjct: 783  LFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTF 841

Query: 63   --ILSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYL 120
              I + +S L+      LS    E +P  I +   L  L +  CN ++ +      L +L
Sbjct: 842  PDISTNISDLN------LSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHL 895

Query: 121  NT---SDCKRLQSLPKISSCLETPSNQTRGNSYLP--VMFKFVNCVKLHKGTERNFFANF 175
             T   SDC  L       S  E        +S LP  V   F+NC  L            
Sbjct: 896  ETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLD----------- 944

Query: 176  QRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSIT-IQLPRRCCNKNF 234
                       L ++++  +    + L G  +P  +F  ++ G+S+T I L      + F
Sbjct: 945  --------QEALLQQQSIFK---QLILSGEEVP-SYFTHRTTGASLTNIPLLHISPCQPF 992

Query: 235  IGFALCAVIEFVA--DESSFFHFNVSCKY 261
              F  CAV++  +    S  F   V C++
Sbjct: 993  FRFRACAVVDSESFFIISVSFDIQVCCRF 1021


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 290
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.46
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.44
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.38
KOG0617264 consensus Ras suppressor protein (contains leucine 99.28
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.11
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.09
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.08
PLN03150623 hypothetical protein; Provisional 99.02
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.99
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.92
PRK15386426 type III secretion protein GogB; Provisional 98.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.83
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.79
PLN03150623 hypothetical protein; Provisional 98.79
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.62
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.62
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.53
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.43
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.4
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.38
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.36
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.35
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.28
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.06
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.01
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.91
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.84
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.73
PRK15386 426 type III secretion protein GogB; Provisional 97.7
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.58
KOG4237498 consensus Extracellular matrix protein slit, conta 97.52
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.51
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.49
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.97
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.85
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.66
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.6
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.46
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.39
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.26
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.55
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.33
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.74
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.67
KOG2982418 consensus Uncharacterized conserved protein [Funct 94.67
KOG2982418 consensus Uncharacterized conserved protein [Funct 94.27
smart0037026 LRR Leucine-rich repeats, outliers. 93.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.19
smart0037026 LRR Leucine-rich repeats, outliers. 93.19
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.35
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.17
KOG4341483 consensus F-box protein containing LRR [General fu 89.93
KOG1947482 consensus Leucine rich repeat proteins, some prote 89.8
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.19
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 84.6
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.63
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.95  E-value=1.3e-26  Score=240.47  Aligned_cols=256  Identities=25%  Similarity=0.353  Sum_probs=191.8

Q ss_pred             CceeEEEcccC-CCcccCccccCCCCCcEEeccCCCCCCcCccccCCCCCCcEEeccCCCCCC-cCCCCCCCCCCEEEee
Q 022917            2 ELLQEIDLFLS-GIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLI-LSGLSSLSSLKCLELS   79 (290)
Q Consensus         2 ~~L~~L~L~~~-~l~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~Ls~~~~l~-~~~l~~l~~L~~L~Ls   79 (290)
                      ++|+.|+|++| .+.++|.+++++++|+.|++++|..++.+|..+ ++++|+.|++++|..+. .+.  ...+|+.|+|+
T Consensus       778 ~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~--~~~nL~~L~Ls  854 (1153)
T PLN03210        778 PSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPD--ISTNISDLNLS  854 (1153)
T ss_pred             ccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCccccccc--cccccCEeECC
Confidence            47889999987 556699999999999999999999999999877 89999999999998664 122  24689999999


Q ss_pred             CccCCccChhhcCCccccEEecccCcCCccCCCC---CcccceeccccccccCCCCCCCCCCCCCcc--cCCCCCCCCcE
Q 022917           80 GHNFESLPTGISQLQRLKCLHLINCNMIRSLPEL---PFCLNYLNTSDCKRLQSLPKISSCLETPSN--QTRGNSYLPVM  154 (290)
Q Consensus        80 ~n~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~---~~~L~~L~l~~c~~l~~l~~~~~~~~~~~~--~~~~~~~~~~~  154 (290)
                      +|.++.+|.++..+++|+.|++++|+.++.+|..   +++|+.+++++|.+|..++...........  .....-.....
T Consensus       855 ~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~  934 (1153)
T PLN03210        855 RTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVC  934 (1153)
T ss_pred             CCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhc
Confidence            9999999999999999999999999999999875   467888899999999876542211100000  00000001234


Q ss_pred             EEEeCCcCchhhhhhhhhHHHHHHHhhhcccchhccccCCCceeEEEecCCCCCCcceeeccCCceEE-EecCCCCCCCc
Q 022917          155 FKFVNCVKLHKGTERNFFANFQRRVHNALPGILHRKETDRRRGISICLRGSGIPHCWFRTQSLGSSIT-IQLPRRCCNKN  233 (290)
Q Consensus       155 l~~~~C~~L~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~pg~~iP~~Wf~~~~~g~sit-i~lp~~~~~~~  233 (290)
                      +.|.+|.+|++.+.  +               +.     ......+++||.++|+ ||.||+.|++++ |++|+.|....
T Consensus       935 l~f~nC~~L~~~a~--l---------------~~-----~~~~~~~~l~g~evp~-~f~hr~~g~sl~~i~l~~~~~~~~  991 (1153)
T PLN03210        935 INFINCFNLDQEAL--L---------------QQ-----QSIFKQLILSGEEVPS-YFTHRTTGASLTNIPLLHISPCQP  991 (1153)
T ss_pred             cccccccCCCchhh--h---------------cc-----cccceEEECCCccCch-hccCCcccceeeeeccCCcccCCC
Confidence            57899999987542  1               00     1123467899999999 999999999999 99999999889


Q ss_pred             eeeEEEEEEEeeccCcCCcceeEEE--EEEe-cCCceeEEeccccccceEEEEEEcc
Q 022917          234 FIGFALCAVIEFVADESSFFHFNVS--CKYG-SDHSFLLVDSMSVYSNHVILGFDPL  287 (290)
Q Consensus       234 ~~gf~~c~v~~~~~~~~~~~~~~~~--c~~~-~~~~~~~~~~~~~~sdh~~~~y~~~  287 (290)
                      +.||++|+|+++.+.......+.+.  |.+. .+|..+.    ...++|+|+.|..+
T Consensus       992 ~~~f~~c~v~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~----~~~~~~~~~~~~~~ 1044 (1153)
T PLN03210        992 FFRFRACAVVDSESFFIISVSFDIQVCCRFIDRLGNHFD----SPYQPHVFSVTKKG 1044 (1153)
T ss_pred             ccceEEEEEEecCccccCCCceeEEEEEEEECCCCCccc----cCCCceeEeeeccc
Confidence            9999999999887653332344454  4444 4455443    34667777766654



syringae 6; Provisional

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 87.3 bits (217), Expect = 4e-20
 Identities = 40/144 (27%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 4   LQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCN---------LKKLQKL 54
           L+ + L  + ++ LP+SI  +  L+ L + +C +L  LPE L +         L  LQ L
Sbjct: 129 LETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSL 188

Query: 55  CLSQCRCLIL-SGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPE- 112
            L       L + +++L +LK L++      +L   I  L +L+ L L  C  +R+ P  
Sbjct: 189 RLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPI 248

Query: 113 ---LPFCLNYLNTSDCKRLQSLPK 133
                  L  L   DC  L +LP 
Sbjct: 249 FGGRA-PLKRLILKDCSNLLTLPL 271


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.74
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.59
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.56
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.56
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.54
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.54
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.54
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.54
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.54
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.53
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.52
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.52
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.52
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.52
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.52
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.52
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.52
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.52
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.51
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.51
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.51
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.51
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.5
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.5
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.49
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.49
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.48
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.48
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.48
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.48
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.47
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.47
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.47
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.47
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.47
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.46
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.46
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.46
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.46
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.45
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.45
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.44
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.44
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.44
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.44
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.44
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.43
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.43
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.43
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.42
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.42
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.42
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.41
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.41
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.41
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.4
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.39
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.39
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.39
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.39
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.38
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.38
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.37
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.37
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.35
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.35
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.32
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.27
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.24
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.19
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.16
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.11
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.01
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.74
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.63
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.57
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.55
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.49
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.39
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.37
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.28
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.74
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.74
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.33
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.89
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.59
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.92
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.88
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.5
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.74  E-value=7.2e-18  Score=151.72  Aligned_cols=131  Identities=30%  Similarity=0.478  Sum_probs=76.7

Q ss_pred             CCceeEEEcccCCCcccCccccCCCCCcEEeccCCCCCCcCccccCCCCCCcEEeccCCCCCC--cCCCC---------C
Q 022917            1 MELLQEIDLFLSGIKELPSSIEHIEGLKCLRLNSCTKLGFLPESLCNLKKLQKLCLSQCRCLI--LSGLS---------S   69 (290)
Q Consensus         1 l~~L~~L~L~~~~l~~lp~~i~~L~~L~~L~L~~~~~l~~lp~~i~~l~~L~~L~Ls~~~~l~--~~~l~---------~   69 (290)
                      +++|++|+|++|.++.+|..++.+++|++|++++|.+. .+|..++++++|++|++++|..+.  +..++         .
T Consensus       103 l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~-~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~  181 (328)
T 4fcg_A          103 LSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLR-ALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG  181 (328)
T ss_dssp             GTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCCC-CCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEE
T ss_pred             CCCCCEEECCCCCccchhHHHhccCCCCEEECCCCccc-cCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhcc
Confidence            35677777777777777776777777777777776554 667667777777777777765433  22222         2


Q ss_pred             CCCCCEEEeeCccCCccChhhcCCccccEEecccCcCCccCCCC---CcccceeccccccccCCCCC
Q 022917           70 LSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPEL---PFCLNYLNTSDCKRLQSLPK  133 (290)
Q Consensus        70 l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~---~~~L~~L~l~~c~~l~~l~~  133 (290)
                      +++|+.|++++|.++.+|..++++++|+.|++++|.. ..+|..   +++|+.|++++|...+.+|.
T Consensus       182 l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l-~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~  247 (328)
T 4fcg_A          182 LVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPL-SALGPAIHHLPKLEELDLRGCTALRNYPP  247 (328)
T ss_dssp             STTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCC-CCCCGGGGGCTTCCEEECTTCTTCCBCCC
T ss_pred             CCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCC-CcCchhhccCCCCCEEECcCCcchhhhHH
Confidence            5555555555555555555555555555555555442 233332   24455555555555555444



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 290
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 44.4 bits (103), Expect = 7e-06
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 5/70 (7%)

Query: 70  LSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPELPFCLNYLNTSDCKRLQ 129
             SL+ L +S +    LP    +L+RL      + N +  +PELP  L  L+      L+
Sbjct: 283 PPSLEELNVSNNKLIELPALPPRLERLI----ASFNHLAEVPELPQNLKQLHVEYNP-LR 337

Query: 130 SLPKISSCLE 139
             P I   +E
Sbjct: 338 EFPDIPESVE 347


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.56
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.45
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.43
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.38
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.37
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.25
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.24
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.16
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.13
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.11
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.04
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.03
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.99
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.98
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.93
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.87
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.61
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.94
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.88
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.71
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.55
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.42
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.71
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.59
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.57  E-value=1.8e-15  Score=132.58  Aligned_cols=132  Identities=19%  Similarity=0.206  Sum_probs=87.1

Q ss_pred             ceeEEEcccCCCcc---cCccccCCCCCcEEeccC-CCCCCcCccccCCCCCCcEEeccCCCCCC---------------
Q 022917            3 LLQEIDLFLSGIKE---LPSSIEHIEGLKCLRLNS-CTKLGFLPESLCNLKKLQKLCLSQCRCLI---------------   63 (290)
Q Consensus         3 ~L~~L~L~~~~l~~---lp~~i~~L~~L~~L~L~~-~~~l~~lp~~i~~l~~L~~L~Ls~~~~l~---------------   63 (290)
                      +++.|+|+++.+++   +|+.+++|++|++|+|++ |.+.+.+|..|+++++|++|+|++|....               
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l  130 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL  130 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence            46777777776663   677777777777777775 45566777777777777777777665221               


Q ss_pred             --------------------------------------------------------------------------------
Q 022917           64 --------------------------------------------------------------------------------   63 (290)
Q Consensus        64 --------------------------------------------------------------------------------   63 (290)
                                                                                                      
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~  210 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE  210 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                                                                                            


Q ss_pred             ---cCCCCCCCCCCEEEeeCccCCccChhhcCCccccEEecccCcCCccCCCC---CcccceeccccccccCCCCCC
Q 022917           64 ---LSGLSSLSSLKCLELSGHNFESLPTGISQLQRLKCLHLINCNMIRSLPEL---PFCLNYLNTSDCKRLQSLPKI  134 (290)
Q Consensus        64 ---~~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~l~~c~~l~~lp~~---~~~L~~L~l~~c~~l~~l~~~  134 (290)
                         +..++.+++|+.+++++|.+...+..+..+++|+.|++++|+..+.+|+.   +++|+.|++++|.--+.+|..
T Consensus       211 ~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~  287 (313)
T d1ogqa_         211 GDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG  287 (313)
T ss_dssp             ECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS
T ss_pred             ccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc
Confidence               11234556666777776666644446666777777778777766677764   366777777776544466653



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure