Citrus Sinensis ID: 022965
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 289 | ||||||
| 224097206 | 270 | predicted protein [Populus trichocarpa] | 0.927 | 0.992 | 0.705 | 1e-109 | |
| 79332463 | 300 | zinc ion binding protein [Arabidopsis th | 0.979 | 0.943 | 0.614 | 1e-101 | |
| 297797607 | 308 | hypothetical protein ARALYDRAFT_496810 [ | 0.986 | 0.925 | 0.627 | 1e-100 | |
| 255582393 | 309 | Ubiquitin ligase protein FANCL, putative | 0.868 | 0.812 | 0.661 | 1e-98 | |
| 212721800 | 322 | uncharacterized protein LOC100192745 [Ze | 0.944 | 0.847 | 0.555 | 2e-88 | |
| 195620462 | 322 | ubiquitin ligase protein FANCL [Zea mays | 0.941 | 0.844 | 0.557 | 2e-87 | |
| 357115395 | 311 | PREDICTED: E3 ubiquitin-protein ligase F | 0.937 | 0.871 | 0.572 | 5e-87 | |
| 115455075 | 308 | Os03g0726900 [Oryza sativa Japonica Grou | 0.958 | 0.899 | 0.542 | 2e-85 | |
| 242033117 | 361 | hypothetical protein SORBIDRAFT_01g00949 | 0.913 | 0.731 | 0.553 | 1e-84 | |
| 218193683 | 308 | hypothetical protein OsI_13372 [Oryza sa | 0.958 | 0.899 | 0.542 | 2e-84 |
| >gi|224097206|ref|XP_002310876.1| predicted protein [Populus trichocarpa] gi|222853779|gb|EEE91326.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 402 bits (1033), Expect = e-109, Method: Compositional matrix adjust.
Identities = 189/268 (70%), Positives = 223/268 (83%)
Query: 22 EIEEVGWEHLVRLSEDLKFLSFRVIDKKGRVHCMEIQLDKNYPRSPPSISADVPYIFNLK 81
+IEEVGWE LVR DL+FLSFR+ DKKGRVH MEIQLDK YP+ PPS+SA+VPYIFN+K
Sbjct: 1 QIEEVGWERLVRFGGDLEFLSFRITDKKGRVHIMEIQLDKTYPQKPPSVSAEVPYIFNVK 60
Query: 82 WSRKSRLKDLLQQFREHLEKLQEIWNILDEIDKSLWVIDLKNPSRANVCRQINLGYNCII 141
WS KSRLKDL+ QFREHLE+LQE W+ L++ID SL V + K SRA CRQI++G +C I
Sbjct: 61 WSVKSRLKDLVLQFREHLEELQEFWSTLEDIDHSLCVTNKKKLSRATTCRQIDIGNDCSI 120
Query: 142 MLSIHIDDPSSLPECRFMGSDPMVNSLRKTWQRNSKRWNKDKPFVENVANLLETQLPRPP 201
MLSI+ DP SLPECRFMGS P+VN +RK W RN+KRW KDK EN+A +LET+LPRP
Sbjct: 121 MLSINARDPRSLPECRFMGSGPVVNPVRKLWLRNNKRWMKDKTLPENLAFILETELPRPS 180
Query: 202 EHENNYQQVECGICYAQFLPIDEELGAKSGGGTDYTCDNSSCSKAFHSVCLGDWLRSITT 261
N QQVECGICYAQ+LPIDEELG++SG GTD+TCDN+SC +AFH+VCL DWLRSITT
Sbjct: 181 HVLENDQQVECGICYAQYLPIDEELGSRSGAGTDHTCDNTSCGRAFHTVCLVDWLRSITT 240
Query: 262 TRQSYDVLFGNCPYCSEPVAVKISIARK 289
TRQS+DVLFGNCPYCSEPVAVK++ +K
Sbjct: 241 TRQSFDVLFGNCPYCSEPVAVKLNDKKK 268
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|79332463|ref|NP_001032152.1| zinc ion binding protein [Arabidopsis thaliana] gi|222424329|dbj|BAH20121.1| AT5G65740 [Arabidopsis thaliana] gi|332010715|gb|AED98098.1| zinc ion binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297797607|ref|XP_002866688.1| hypothetical protein ARALYDRAFT_496810 [Arabidopsis lyrata subsp. lyrata] gi|297312523|gb|EFH42947.1| hypothetical protein ARALYDRAFT_496810 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255582393|ref|XP_002531985.1| Ubiquitin ligase protein FANCL, putative [Ricinus communis] gi|223528344|gb|EEF30384.1| Ubiquitin ligase protein FANCL, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|212721800|ref|NP_001131416.1| uncharacterized protein LOC100192745 [Zea mays] gi|194691460|gb|ACF79814.1| unknown [Zea mays] gi|413933185|gb|AFW67736.1| ubiquitin ligase protein FANCL [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|195620462|gb|ACG32061.1| ubiquitin ligase protein FANCL [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|357115395|ref|XP_003559474.1| PREDICTED: E3 ubiquitin-protein ligase FANCL-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|115455075|ref|NP_001051138.1| Os03g0726900 [Oryza sativa Japonica Group] gi|41469280|gb|AAS07162.1| expressed protein (with alternative splicing) [Oryza sativa Japonica Group] gi|108710855|gb|ABF98650.1| Ubiquitin ligase protein FANCL, putative, expressed [Oryza sativa Japonica Group] gi|113549609|dbj|BAF13052.1| Os03g0726900 [Oryza sativa Japonica Group] gi|215704189|dbj|BAG93029.1| unnamed protein product [Oryza sativa Japonica Group] gi|222625718|gb|EEE59850.1| hypothetical protein OsJ_12426 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242033117|ref|XP_002463953.1| hypothetical protein SORBIDRAFT_01g009490 [Sorghum bicolor] gi|241917807|gb|EER90951.1| hypothetical protein SORBIDRAFT_01g009490 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|218193683|gb|EEC76110.1| hypothetical protein OsI_13372 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 289 | ||||||
| TAIR|locus:2169995 | 300 | AT5G65740 [Arabidopsis thalian | 0.903 | 0.87 | 0.609 | 5.1e-90 | |
| ZFIN|ZDB-GENE-040426-1045 | 371 | fancl "Fanconi anemia, complem | 0.865 | 0.673 | 0.351 | 1.2e-47 | |
| UNIPROTKB|Q2TBN8 | 374 | FANCL "Fanconi anemia, complem | 0.875 | 0.676 | 0.352 | 1e-45 | |
| UNIPROTKB|Q9NW38 | 375 | FANCL "E3 ubiquitin-protein li | 0.878 | 0.677 | 0.348 | 5.6e-45 | |
| MGI|MGI:1914280 | 375 | Fancl "Fanconi anemia, complem | 0.878 | 0.677 | 0.337 | 9.1e-45 | |
| UNIPROTKB|Q3MUH5 | 373 | FANCL "Uncharacterized protein | 0.878 | 0.680 | 0.338 | 1.2e-44 | |
| RGD|1311427 | 375 | Fancl "Fanconi anemia, complem | 0.878 | 0.677 | 0.329 | 5e-44 | |
| UNIPROTKB|B5MCZ6 | 258 | FANCL "E3 ubiquitin-protein li | 0.826 | 0.926 | 0.353 | 4.5e-43 | |
| UNIPROTKB|E2R5Y4 | 378 | FANCL "Uncharacterized protein | 0.875 | 0.669 | 0.332 | 5.7e-43 | |
| UNIPROTKB|F1SQL5 | 330 | LOC100526164 "Uncharacterized | 0.868 | 0.760 | 0.337 | 2.5e-42 |
| TAIR|locus:2169995 AT5G65740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 898 (321.2 bits), Expect = 5.1e-90, P = 5.1e-90
Identities = 162/266 (60%), Positives = 210/266 (78%)
Query: 25 EVGWEHLVRLSEDLKFLSFRVIDKKGRVHCMEIQLDKNYPRSPPSISADVPYIFNLKWSR 84
E+GWE + RL DL F SF ++DKKGR H +EIQL+++YP SPPS+SADVPY+F L+WS
Sbjct: 33 EIGWEPIRRLGGDLTFFSFHILDKKGRAHNLEIQLNRDYPNSPPSVSADVPYMFTLEWST 92
Query: 85 KSRLKDLLQQFREHLEKLQEIWNILDEIDKSLWVIDLKNPSRANVCRQINLGYNCIIMLS 144
SRLKD++ QF++HL+ LQE W++LD IDKSL V+D+K P+RA+ R+I+ G +CII++
Sbjct: 93 SSRLKDVMHQFQKHLDYLQEFWSVLDNIDKSLCVVDVKQPARASAIRRIDAGNDCIIIVH 152
Query: 145 IHIDDPSSLPECRFMGSDPM---VNSLRKTWQRNSKRWNKDKPFVENVANLLETQLPRPP 201
I DP SLPE RF+G P +N+L W+RN KRW+ ++ F EN+ +L T+LP+P
Sbjct: 153 IDFKDPKSLPESRFIGPVPSATHMNNLHMLWRRNCKRWSNERSFPENLECILGTELPKPL 212
Query: 202 --EHENNYQQVECGICYAQFLPIDEELGAKSGGGTDYTCDNSSCSKAFHSVCLGDWLRSI 259
+ E++ QQVECGICYAQFLP DEELGA+SG TDYTC+N SC+K+FHS+CL DWLRSI
Sbjct: 213 GLQVEDDQQQVECGICYAQFLPTDEELGARSGTRTDYTCENISCNKSFHSLCLTDWLRSI 272
Query: 260 TTTRQSYDVLFGNCPYCSEPVAVKIS 285
TTTRQS+DVLFGNCPYCS+PVAVK S
Sbjct: 273 TTTRQSFDVLFGNCPYCSDPVAVKTS 298
|
|
| ZFIN|ZDB-GENE-040426-1045 fancl "Fanconi anemia, complementation group L" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2TBN8 FANCL "Fanconi anemia, complementation group L" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NW38 FANCL "E3 ubiquitin-protein ligase FANCL" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914280 Fancl "Fanconi anemia, complementation group L" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MUH5 FANCL "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1311427 Fancl "Fanconi anemia, complementation group L" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B5MCZ6 FANCL "E3 ubiquitin-protein ligase FANCL" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5Y4 FANCL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQL5 LOC100526164 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 289 | |||
| pfam11793 | 70 | pfam11793, FANCL_C, FANCL C-terminal domain | 1e-26 | |
| pfam09765 | 292 | pfam09765, WD-3, WD-repeat region | 3e-26 |
| >gnl|CDD|204746 pfam11793, FANCL_C, FANCL C-terminal domain | Back alignment and domain information |
|---|
Score = 99.0 bits (247), Expect = 1e-26
Identities = 34/78 (43%), Positives = 45/78 (57%), Gaps = 8/78 (10%)
Query: 208 QQVECGICYAQFLPIDEELGAKSGGGTDYTCDNSSCSKAFHSVCLGDWLRSITTTRQSYD 267
++ECGICYA L G D +CDN C FH CL +WLR++ +RQS++
Sbjct: 1 FEIECGICYAYRLD--------GGEIPDISCDNPKCGLPFHIACLYEWLRTLRDSRQSFN 52
Query: 268 VLFGNCPYCSEPVAVKIS 285
V FG CPYC ++VK S
Sbjct: 53 VSFGTCPYCKAKISVKFS 70
|
This domain is found at the C-terminus of the Fancl protein in humans which is the putative E3 ubiquitin ligase subunit of the FA complex (Fanconi anaemia). Eight subunits of the Fanconi anaemia gene products form a multisubunit nuclear complex which is required for mono-ubiquitination of a downstream FA protein, FANCD2. Length = 70 |
| >gnl|CDD|192370 pfam09765, WD-3, WD-repeat region | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 289 | |||
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 100.0 | |
| PF09765 | 291 | WD-3: WD-repeat region; InterPro: IPR019162 This e | 100.0 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 99.86 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.27 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.12 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.02 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 99.0 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 98.98 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.95 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.86 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.56 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.54 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.46 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.4 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.36 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.29 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.15 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.12 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 98.12 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.04 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.97 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.95 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.94 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.87 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.86 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.79 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.69 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.68 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.63 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.58 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 97.54 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.22 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 97.18 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 97.14 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.86 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 96.78 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.47 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 96.41 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.0 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 95.78 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 95.75 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 95.69 | |
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 95.62 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 95.62 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 95.37 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.35 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 95.26 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 95.26 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.2 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 95.15 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 94.94 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 94.84 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 94.51 | |
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 94.49 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 94.48 | |
| PHA02862 | 156 | 5L protein; Provisional | 94.36 | |
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 94.28 | |
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 94.14 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.99 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.96 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 93.82 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 93.72 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.5 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 93.48 | |
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 93.28 | |
| KOG3005 | 276 | consensus GIY-YIG type nuclease [General function | 92.45 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 92.25 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.89 | |
| KOG0417 | 148 | consensus Ubiquitin-protein ligase [Posttranslatio | 91.58 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 90.74 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 89.84 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.49 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.43 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.08 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 87.15 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 87.12 | |
| KOG0427 | 161 | consensus Ubiquitin conjugating enzyme [Posttransl | 86.87 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 85.83 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 85.66 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 85.35 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 84.9 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 84.75 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.31 | |
| PHA03096 | 284 | p28-like protein; Provisional | 83.75 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 83.38 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 81.77 | |
| KOG0418 | 200 | consensus Ubiquitin-protein ligase [Posttranslatio | 81.71 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.58 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.8 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.75 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 80.69 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 80.12 |
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.2e-67 Score=456.22 Aligned_cols=233 Identities=34% Similarity=0.579 Sum_probs=228.7
Q ss_pred EeCCCCEEEEEEEeCCCCCCCCCCccccCCCccccccCccccHHHHHHHHHHHHHHHHHHHHhHHhhhccceeecCCCCC
Q 022965 46 IDKKGRVHCMEIQLDKNYPRSPPSISADVPYIFNLKWSRKSRLKDLLQQFREHLEKLQEIWNILDEIDKSLWVIDLKNPS 125 (289)
Q Consensus 46 ~D~~~R~H~l~i~l~~~yp~~~P~~~~dlP~~f~l~w~~~s~L~~i~~qF~~~le~lq~fwd~ldeID~~~wVleP~~P~ 125 (289)
.|++||.|.+++++..+||++.|.-.+|.|++|-..|.|+|++..||+||.+++|+++.||+.||++|++|||+||++|.
T Consensus 2 edaSG~~h~i~l~~ea~~pae~pd~fvd~pi~FCad~~pqs~~IsiYsqflaa~esiea~~~~ide~deKT~l~e~ekP~ 81 (234)
T KOG3268|consen 2 EDASGECHGIELCEEAAKPAEFPDKFVDEPINFCADVGPQSCAISIYSQFLAAFESIEACNAPIDEGDEKTLLHELEKPA 81 (234)
T ss_pred CCcccchhHHHHHHHhcCccccchhhhcccccceeecCCcceehHHHHHHHHHHHhHHhhcCcCccccccchhccccCCc
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCceeEEEEeCCceEEEEEEeCCCCCCCCceEEecCchhhhHHHHHhhhcccccCCCCchHHHHHHHhcccCCCCCCCcC
Q 022965 126 RANVCRQINLGYNCIIMLSIHIDDPSSLPECRFMGSDPMVNSLRKTWQRNSKRWNKDKPFVENVANLLETQLPRPPEHEN 205 (289)
Q Consensus 126 ~~~~~RrI~l~~~~sl~i~vdp~~P~~lP~~~flG~~~~v~~lr~~l~~n~~~Wd~~~~i~~NL~~il~~~~P~~~~~~~ 205 (289)
|+.+.|||++||+|+|.|+|||+||.|||+|.|+|+++++.++.-+...|++.|+|..+.+||++..+++.||..+-.++
T Consensus 82 RaaaaRRIa~GNd~~I~ieiD~k~PkmLPEcf~lgadhv~~P~gie~~~~i~L~dPe~~~led~kd~lE~df~a~a~Lek 161 (234)
T KOG3268|consen 82 RAAAARRIAAGNDCIIIIEIDFKDPKMLPECFELGADHVSFPEGIECILGIELPDPEGLQLEDDKDQLECDFCAAAFLEK 161 (234)
T ss_pred hHHHHHHhhcCCceEEEEEecCCCCccchhhHhhccccccccccceEEeccccCCccccccccccceeeeCccHHHhcCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcccccccccccccchhhccccCCCCCcccccCCCCCCcchhhHHHHHHhhhccCccccccccCCCCCCCcccccccc
Q 022965 206 NYQQVECGICYAQFLPIDEELGAKSGGGTDYTCDNSSCSKAFHSVCLGDWLRSITTTRQSYDVLFGNCPYCSEPVAVKIS 285 (289)
Q Consensus 206 ~~~~~eC~ICy~~~l~~d~~~~~~~g~~Pd~~C~n~~C~h~FH~~CL~eWL~~l~~~r~sF~~i~g~CP~Cr~~i~~~~~ 285 (289)
+++...|||||.|.+ +|++||++|+|.+||+.||+-||++|||++.++||||+++||+||||++||++||+
T Consensus 162 dd~~~~cgicyayql---------dGTipDqtCdN~qCgkpFHqiCL~dWLRgilTsRQSFdiiFGeCPYCS~PialKmS 232 (234)
T KOG3268|consen 162 DDELGACGICYAYQL---------DGTIPDQTCDNIQCGKPFHQICLTDWLRGILTSRQSFDIIFGECPYCSDPIALKMS 232 (234)
T ss_pred chhhhcccceeeeec---------CCccccccccccccCCcHHHHHHHHHHHHHhhccceeeeeeccCCCCCCcceeecc
Confidence 999999999999988 79999999999999999999999999999999999999999999999999999998
Q ss_pred cc
Q 022965 286 IA 287 (289)
Q Consensus 286 ~~ 287 (289)
.+
T Consensus 233 gk 234 (234)
T KOG3268|consen 233 GK 234 (234)
T ss_pred CC
Confidence 64
|
|
| >PF09765 WD-3: WD-repeat region; InterPro: IPR019162 This entry represents a region of approximately 100 residues containing three WD repeats and six cysteine residues- possibly as three cysteine-bridges associated with FancL | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3005 consensus GIY-YIG type nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 289 | ||||
| 3zqs_A | 186 | Human Fancl Central Domain Length = 186 | 1e-25 | ||
| 3k1l_B | 381 | Crystal Structure Of Fancl Length = 381 | 2e-09 |
| >pdb|3ZQS|A Chain A, Human Fancl Central Domain Length = 186 | Back alignment and structure |
|
| >pdb|3K1L|B Chain B, Crystal Structure Of Fancl Length = 381 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 289 | |||
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 5e-72 | |
| 3zqs_A | 186 | E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A | 9e-67 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 |
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
Score = 225 bits (574), Expect = 5e-72
Identities = 52/294 (17%), Positives = 104/294 (35%), Gaps = 19/294 (6%)
Query: 1 MEQSRCRESANSSSFSRSVYSEIEEVGWEHLVRLSEDLKFLSFRVI-DKKGRVHCMEIQL 59
+ + ++Y +I + + L D R H +E+++
Sbjct: 93 LPAQKAPTVPKELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLELKI 152
Query: 60 DKNYPRSPPSISADVPYIFNLKWSRKSRLKDLLQQFREHLEKLQEIWNILDEIDKSLWVI 119
D + + L++ L FR+ LE L+ ++ +ID+ V+
Sbjct: 153 PSLLLLDHSL--PDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNFMDIDELCHVL 210
Query: 120 DLKNPSRANVCRQINLGYNCIIMLSI-HIDDPSSLPECRFMGSDPMVNSLRKTWQRNSKR 178
S + R L + L+I + + +G V LR
Sbjct: 211 QPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRHVLSDGLSN 270
Query: 179 WNKDKPFVENVANLLETQLPRPP-------EHENNYQQVECGICYAQFLPIDEELGAKSG 231
W+ + +N+ + + P E + +++ C IC+A L E
Sbjct: 271 WDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRLDGGEV------ 324
Query: 232 GGTDYTCDNSSCSKAFHSVCLGDWLRSITTTRQSYDVLFGNCPYCSEPVAVKIS 285
+CDN+ C H+VCL +W +++ + +V FG CP+C ++ +
Sbjct: 325 --PLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFA 376
|
| >3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Length = 186 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 289 | |||
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 100.0 | |
| 3zqs_A | 186 | E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A | 100.0 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.27 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.25 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.23 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.17 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.17 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.15 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.14 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.14 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.14 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.13 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.11 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.05 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.05 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.01 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.0 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.96 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.95 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.9 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.88 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.88 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.85 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.81 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.8 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.75 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.75 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.73 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.73 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.72 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.67 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.64 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.63 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.63 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.63 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.61 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.59 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.57 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.56 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.56 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.55 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.52 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.51 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.45 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 98.44 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.41 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.38 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.36 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.33 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.3 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.3 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.24 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.21 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.15 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.12 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.09 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.02 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.01 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.95 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.88 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 97.85 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 97.85 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 97.79 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.57 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.55 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.51 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 97.5 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 97.48 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.23 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 96.97 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 96.78 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 96.49 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 96.0 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 95.74 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 95.66 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 95.5 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 95.31 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 95.21 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 95.08 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 95.06 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 94.97 | |
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 94.96 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 94.93 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 94.88 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 94.86 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 94.79 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 94.69 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 94.63 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 94.61 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 94.61 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 94.5 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 94.38 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 94.32 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 94.3 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 94.25 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 94.21 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 94.15 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 94.15 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 94.0 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 93.9 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 93.75 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 93.69 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 93.54 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 93.46 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 93.46 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 93.38 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 93.24 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 93.19 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 93.16 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 92.98 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 92.88 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 92.82 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 92.72 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 92.19 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 92.17 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 92.11 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 91.99 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 91.93 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 91.26 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 90.81 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 90.49 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 90.27 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 90.17 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 90.09 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 89.6 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 88.92 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 85.3 | |
| 2ebk_A | 128 | RWD domain-containing protein 3; alpha+beta sandwi | 85.06 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 82.77 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 81.93 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 80.08 |
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-77 Score=567.63 Aligned_cols=256 Identities=21% Similarity=0.419 Sum_probs=236.1
Q ss_pred HHHHHHHHHhcccee--eeecCCcceEEEEEEeCCCCEEEEEEEeCCCCCCCCCCccccCCCcccc---ccCccccHHHH
Q 022965 17 RSVYSEIEEVGWEHL--VRLSEDLKFLSFRVIDKKGRVHCMEIQLDKNYPRSPPSISADVPYIFNL---KWSRKSRLKDL 91 (289)
Q Consensus 17 ~~l~~Ei~~igw~~l--~~id~~l~~i~l~~~D~~~R~H~l~i~l~~~yp~~~P~~~~dlP~~f~l---~w~~~s~L~~i 91 (289)
++|+.||++|..+.- +++|.+++.|+|..++ ..|+|+|+++++ ..-.++++||..+.+ --.++|+|.++
T Consensus 109 ~~i~~~~~~l~~~~~~~l~~~~~~s~i~~~~f~-~~~~h~Lel~~~-----~~~v~~h~LP~~~~~~e~l~k~~ssL~~v 182 (381)
T 3k1l_B 109 GNIYYDILALYKSNEYCLQVDEACSMIRFSEFT-DFEQHYLELKIP-----SLLLLDHSLPDCVSLGEMLTKSAGNLEEA 182 (381)
T ss_dssp CCHHHHHHHHHSCSSCEEEECGGGCEEEEEEET-TEEEEEEEEETT-----TCCEEEESSCTTSCHHHHHHHHCCSHHHH
T ss_pred hhHHHHHHHhcCccceEEEecCCccEEEecccc-CccceEEEEecC-----ceEEecccCCcchhHHHHhcCccccHHHH
Confidence 579999999998866 6677889999999995 779999999998 234778899966532 12447899999
Q ss_pred HHHHHHHHHHHHHHHHhHHhhhccceeecCCCCCCCceeEEEEeCCceEEEEEE-eCCCCCCCCceEEecCchhhhHHHH
Q 022965 92 LQQFREHLEKLQEIWNILDEIDKSLWVIDLKNPSRANVCRQINLGYNCIIMLSI-HIDDPSSLPECRFMGSDPMVNSLRK 170 (289)
Q Consensus 92 ~~qF~~~le~lq~fwd~ldeID~~~wVleP~~P~~~~~~RrI~l~~~~sl~i~v-dp~~P~~lP~~~flG~~~~v~~lr~ 170 (289)
++||+++||+||+|||+|||||++||||||++|+|++++||||||++|||+|+| ||++|+|+|+|+|+|++++|++||+
T Consensus 183 ~~qF~~~LE~Lq~FWd~LdeID~~~wVLEP~kPtrs~t~RRIaLgn~vSl~IeV~DP~~Pr~lPe~~FlGpd~~V~~Lr~ 262 (381)
T 3k1l_B 183 LNLFRKLLEDLRPFYDNFMDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRH 262 (381)
T ss_dssp HHHHHHHHHHTHHHHHHHHHHHHHSCCCBSSSCCTTCCEEEEEEETTEEEEEEESCTTSTTTTEEEEEESSHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHhhhhccccccCCCCCCCCceEEEEeCCCeEEEEEeCCCCCCCcCceeEEECChhHhHHHHH
Confidence 999999999999999999999999999999999999999999999999999999 9999999999999999999999999
Q ss_pred HhhhcccccCCCCchHHHHHHHhcc-cCCCCCCCc------CCCCcccccccccccccchhhccccCCCCCcccccCCCC
Q 022965 171 TWQRNSKRWNKDKPFVENVANLLET-QLPRPPEHE------NNYQQVECGICYAQFLPIDEELGAKSGGGTDYTCDNSSC 243 (289)
Q Consensus 171 ~l~~n~~~Wd~~~~i~~NL~~il~~-~~P~~~~~~------~~~~~~eC~ICy~~~l~~d~~~~~~~g~~Pd~~C~n~~C 243 (289)
+|++|+++||+++++++||+++||+ +||+|+..+ ++++..+|||||++++ ++|++|+++|+|++|
T Consensus 263 ~l~~Nl~~Wd~d~si~eNL~~IL~i~~fP~p~~~~~~~~~e~ee~~~ECaICys~~l--------~~g~lPdk~C~n~~C 334 (381)
T 3k1l_B 263 VLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRL--------DGGEVPLVSCDNAKC 334 (381)
T ss_dssp HHHHHHHTCCTTSCHHHHHHHHTTCSSCCCCCGGGCCSCTTCCCSCCSCSSSCCSSC--------TTCCCCCBCCSCTTC
T ss_pred HHhhhhhhcCccCCHHHHHHHHhCccccCCCcccccccccccccCCccCcccceeec--------CCCCCccccccCCcc
Confidence 9999999999999999999999999 899998764 5778999999999997 358999999999999
Q ss_pred CCcchhhHHHHHHhhhccCccccccccCCCCCCCccccccccc
Q 022965 244 SKAFHSVCLGDWLRSITTTRQSYDVLFGNCPYCSEPVAVKISI 286 (289)
Q Consensus 244 ~h~FH~~CL~eWL~~l~~~r~sF~~i~g~CP~Cr~~i~~~~~~ 286 (289)
||.||+.||++||++++++||||++++|+|||||++|++++.+
T Consensus 335 ~h~FH~~CL~kWLrs~~~sRqSFnvi~G~CPyCr~pIs~sf~~ 377 (381)
T 3k1l_B 335 VLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFAA 377 (381)
T ss_dssp CCCBCSGGGHHHHHHHHSSSCTTTCCEEECTTTCCEEEGGGGG
T ss_pred CCccchHHHHHHHHhCCCccccccccCCCCCCCCCcCCccHHH
Confidence 9999999999999999999999999999999999999998754
|
| >3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 289 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.39 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.27 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.15 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.13 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.13 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.09 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.05 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.88 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.87 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.65 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.61 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.58 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.44 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.16 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.15 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.0 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.36 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 96.5 | |
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 96.14 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 95.95 | |
| d1zuoa1 | 162 | Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom | 95.88 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 95.74 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 95.51 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 95.35 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 95.26 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 95.23 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 95.07 | |
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 94.7 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 94.55 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 94.42 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 94.27 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 93.86 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 93.81 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 93.6 | |
| d2f4za1 | 161 | Hypothetical protein Tgtwinscan_2721, E2 domain {T | 93.45 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 93.43 | |
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 93.4 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 93.34 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 93.34 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 93.11 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 92.98 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 92.76 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 92.46 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 92.12 | |
| d2z5da1 | 152 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 90.61 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 86.84 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 85.75 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 85.36 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 85.08 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 82.12 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 81.73 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.39 E-value=6e-14 Score=98.79 Aligned_cols=52 Identities=35% Similarity=0.774 Sum_probs=40.2
Q ss_pred CcccccccccccccchhhccccCCCCCcccccCCCCCCcchhhHHHHHHhhhccCccccccccCCCCCCCccccc
Q 022965 208 QQVECGICYAQFLPIDEELGAKSGGGTDYTCDNSSCSKAFHSVCLGDWLRSITTTRQSYDVLFGNCPYCSEPVAV 282 (289)
Q Consensus 208 ~~~eC~ICy~~~l~~d~~~~~~~g~~Pd~~C~n~~C~h~FH~~CL~eWL~~l~~~r~sF~~i~g~CP~Cr~~i~~ 282 (289)
++.+|+||++.+.. |. .+-..+.|||.||..||.+||++ +++||+||++|.+
T Consensus 4 d~~~C~ICl~~~~~---------~~---~~~~l~~C~H~Fh~~Ci~~Wl~~-----------~~~CP~CR~~i~v 55 (55)
T d1iyma_ 4 DGVECAVCLAELED---------GE---EARFLPRCGHGFHAECVDMWLGS-----------HSTCPLCRLTVVV 55 (55)
T ss_dssp CSCCCTTTCCCCCT---------TS---CCEECSSSCCEECTTHHHHTTTT-----------CCSCSSSCCCSCC
T ss_pred CCCCCeEECccccC---------CC---EEEEeCCCCCcccHHHHHHHHHh-----------CCcCCCCCCEeEC
Confidence 44579999999852 11 11122579999999999999998 7899999998754
|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|