Citrus Sinensis ID: 022989

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREELAGN
ccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHcHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccHccccccccccccccccccccccccccccccccHHHHHHHcccEEcccccHHHHHHHHHHHcccEHHccccccccccccHHHHHHccc
MKFGETFTEYLHGdqerfldkcSHVEYKRLKKVLKSCrtckglhdsackteqqwdegkdisesqlcqcqsscqlcdHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVhksvngknfkSKMRAEHIELlqspwlielggfylnfnglncgassefsghfsfdfnasrpvmtlalpssikleydlTCAVCLdlvfnpyalscghlfCKLCACSAASVMVFEglksaspdskcpicreelagn
MKFGETFteylhgdqerfldkCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLksaspdskcpicreelagn
MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDIsesqlcqcqsscqlcDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREELAGN
******FTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHD**********************CQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGL*******************
***GETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCR****************************QCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKY***************MRAEHIELLQSPWLIELGGFYLNF***********************************LEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVF********DSKCP**RE*****
MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREELAGN
*KFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRT*************************LCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGL*****S*FSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICRE*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREELAGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q7XZZ3339 Probable E3 ubiquitin-pro yes no 0.972 0.828 0.589 7e-98
A2XK56339 Probable E3 ubiquitin-pro N/A no 0.972 0.828 0.589 7e-98
Q8GW10335 Probable E3 ubiquitin-pro yes no 0.948 0.817 0.611 5e-93
Q9SRX9335 E3 ubiquitin-protein liga no no 0.937 0.808 0.395 1e-57
B8B5U8321 Probable E3 ubiquitin-pro N/A no 0.806 0.725 0.447 3e-55
Q7XI73321 Probable E3 ubiquitin-pro no no 0.806 0.725 0.447 5e-55
Q6PCN7 1003 Helicase-like transcripti no no 0.176 0.050 0.389 9e-06
Q95216 1005 Helicase-like transcripti no no 0.176 0.050 0.355 5e-05
O64425 249 E3 ubiquitin-protein liga no no 0.297 0.345 0.298 7e-05
Q8IYM9 498 E3 ubiquitin-protein liga no no 0.200 0.116 0.343 9e-05
>sp|Q7XZZ3|BAHL1_ORYSJ Probable E3 ubiquitin-protein ligase BAH1-like 1 OS=Oryza sativa subsp. japonica GN=Os03g0650900 PE=2 SV=1 Back     alignment and function desciption
 Score =  357 bits (915), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 171/290 (58%), Positives = 220/290 (75%), Gaps = 9/290 (3%)

Query: 1   MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDI 60
           MKFG  + EYL   Q+++L KCSHVEYKRLKKVLK CR  + L +     +QQ  EG + 
Sbjct: 1   MKFGAIYEEYLREQQDKYLTKCSHVEYKRLKKVLKKCRVGRSLQEDCPNGDQQ--EGNNE 58

Query: 61  SESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQC 120
           S   +C+C +SC LCD MFF+EL KEAS+IAGCFSSR + LL+LHV SG  RY+ R+RQC
Sbjct: 59  S-PDICKC-NSCTLCDQMFFTELTKEASEIAGCFSSRVQRLLNLHVPSGFLRYIWRVRQC 116

Query: 121 FKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQSP 180
           F +DQ  M++EGR+L+ Y+ MNAIAIRKILKKYDK+H SV+G++FKSKM+ +HIELLQSP
Sbjct: 117 FIDDQQIMVQEGRMLLNYVTMNAIAIRKILKKYDKIHGSVSGRDFKSKMQTDHIELLQSP 176

Query: 181 WLIELGGFYLNFNGLNCGAS-----SEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCA 235
           WLIELG F+LN N  +   +     +EF  +FS D   +RP+MT+A+  ++K EY LTC 
Sbjct: 177 WLIELGAFHLNCNSSDIDETVGFLKNEFFKNFSCDLTEARPLMTMAISETMKYEYSLTCP 236

Query: 236 VCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREE 285
           +CLD +FNPYALSCGHLFCK CAC AASV +F+G+KSA P++KCP+CR +
Sbjct: 237 ICLDTLFNPYALSCGHLFCKGCACGAASVYIFQGVKSAPPEAKCPVCRSD 286

Oryza sativa subsp. japonica (taxid: 39947)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|A2XK56|BAHL1_ORYSI Probable E3 ubiquitin-protein ligase BAH1-like 1 OS=Oryza sativa subsp. indica GN=OsI_12825 PE=3 SV=1 Back     alignment and function description
>sp|Q8GW10|BAH1L_ARATH Probable E3 ubiquitin-protein ligase BAH1-like OS=Arabidopsis thaliana GN=RF178 PE=2 SV=1 Back     alignment and function description
>sp|Q9SRX9|BAH1_ARATH E3 ubiquitin-protein ligase BAH1 OS=Arabidopsis thaliana GN=BAH1 PE=1 SV=1 Back     alignment and function description
>sp|B8B5U8|BAHL2_ORYSI Probable E3 ubiquitin-protein ligase BAH1-like 1 OS=Oryza sativa subsp. indica GN=OsI_27296 PE=3 SV=1 Back     alignment and function description
>sp|Q7XI73|BAHL2_ORYSJ Probable E3 ubiquitin-protein ligase BAH1-like 2 OS=Oryza sativa subsp. japonica GN=Os07g0673200 PE=2 SV=1 Back     alignment and function description
>sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 Back     alignment and function description
>sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 Back     alignment and function description
>sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 Back     alignment and function description
>sp|Q8IYM9|TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens GN=TRIM22 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
224138198338 predicted protein [Populus trichocarpa] 0.975 0.834 0.730 1e-117
224091495339 predicted protein [Populus trichocarpa] 0.975 0.831 0.710 1e-114
225439313330 PREDICTED: probable E3 ubiquitin-protein 0.961 0.842 0.711 1e-111
296089321332 unnamed protein product [Vitis vinifera] 0.961 0.837 0.711 1e-110
449516155321 PREDICTED: probable E3 ubiquitin-protein 0.920 0.828 0.687 1e-106
255566249272 ubiquitin-protein ligase, putative [Rici 0.871 0.926 0.665 1e-106
449437524321 PREDICTED: probable E3 ubiquitin-protein 0.920 0.828 0.680 1e-105
147772057317 hypothetical protein VITISV_041194 [Viti 0.965 0.880 0.614 1e-103
356572680324 PREDICTED: probable E3 ubiquitin-protein 0.927 0.827 0.652 1e-102
115454375339 Os03g0650900 [Oryza sativa Japonica Grou 0.972 0.828 0.589 4e-96
>gi|224138198|ref|XP_002322754.1| predicted protein [Populus trichocarpa] gi|222867384|gb|EEF04515.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/286 (73%), Positives = 239/286 (83%), Gaps = 4/286 (1%)

Query: 1   MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQ--QWDEGK 58
           MKFGETF EYLHG+QE  LDKC+HVEYKRLKKVLK CR+ +G   ++C  EQ  + D  +
Sbjct: 1   MKFGETFMEYLHGEQEGCLDKCAHVEYKRLKKVLKKCRS-QGPPSTSCNDEQLQERDSEQ 59

Query: 59  DISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIR 118
           + S SQ C CQS C LCD MFFSELM+EASDIAGCFSSR RHLLHLHVA GMQRY LR+R
Sbjct: 60  NHSLSQFCHCQS-CPLCDQMFFSELMREASDIAGCFSSRVRHLLHLHVARGMQRYKLRLR 118

Query: 119 QCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIELLQ 178
           QCF NDQ  M+EEGR+LIEY+ MNAIAIRKILKKYDKVH S+NGKNFKSKMR+EHIELLQ
Sbjct: 119 QCFINDQQIMVEEGRMLIEYVTMNAIAIRKILKKYDKVHCSINGKNFKSKMRSEHIELLQ 178

Query: 179 SPWLIELGGFYLNFNGLNCGASSEFSGHFSFDFNASRPVMTLALPSSIKLEYDLTCAVCL 238
           SPWLIELG FYLNF+G++ G  SEF   FS D +A+ PVMTL LP+  KLEY LTCA+CL
Sbjct: 179 SPWLIELGAFYLNFDGIDGGEFSEFCSRFSCDLSATEPVMTLMLPNYTKLEYGLTCAICL 238

Query: 239 DLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICRE 284
           ++VFNPYALSCGHLFCKLCAC AASV++ EGLKSAS ++KCP+CRE
Sbjct: 239 EMVFNPYALSCGHLFCKLCACLAASVLMVEGLKSASSNAKCPVCRE 284

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224091495|ref|XP_002309274.1| predicted protein [Populus trichocarpa] gi|222855250|gb|EEE92797.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225439313|ref|XP_002268495.1| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089321|emb|CBI39093.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449516155|ref|XP_004165113.1| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255566249|ref|XP_002524112.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223536680|gb|EEF38322.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449437524|ref|XP_004136542.1| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147772057|emb|CAN73420.1| hypothetical protein VITISV_041194 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356572680|ref|XP_003554494.1| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like [Glycine max] Back     alignment and taxonomy information
>gi|115454375|ref|NP_001050788.1| Os03g0650900 [Oryza sativa Japonica Group] gi|75296682|sp|Q7XZZ3.1|BAHL1_ORYSJ RecName: Full=Probable E3 ubiquitin-protein ligase BAH1-like 1 gi|308191416|sp|A2XK56.1|BAHL1_ORYSI RecName: Full=Probable E3 ubiquitin-protein ligase BAH1-like 1 gi|31712090|gb|AAP68394.1| putative SPX domain containing protein [Oryza sativa Japonica Group] gi|62733417|gb|AAX95534.1| Putative SPX protein [Oryza sativa Japonica Group] gi|108710124|gb|ABF97919.1| SPX domain containing protein, expressed [Oryza sativa Japonica Group] gi|113549259|dbj|BAF12702.1| Os03g0650900 [Oryza sativa Japonica Group] gi|125545077|gb|EAY91216.1| hypothetical protein OsI_12825 [Oryza sativa Indica Group] gi|125587300|gb|EAZ27964.1| hypothetical protein OsJ_11925 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2064935335 AT2G38920 [Arabidopsis thalian 0.948 0.817 0.608 3.1e-90
TAIR|locus:2024675335 NLA "nitrogen limitation adapt 0.726 0.626 0.443 2e-55
UNIPROTKB|C9JWN872 TRIM5 "Tripartite motif-contai 0.179 0.722 0.338 2.8e-06
UNIPROTKB|E1BSU9 274 LOC416147 "Uncharacterized pro 0.200 0.211 0.412 3.5e-06
UNIPROTKB|A2AE50122 TRIM26 "Tripartite motif-conta 0.193 0.459 0.338 6.1e-06
TAIR|locus:2128746 249 RMA1 "RING membrane-anchor 1" 0.297 0.345 0.298 7.9e-06
MGI|MGI:1196437 1003 Hltf "helicase-like transcript 0.512 0.147 0.276 8.2e-06
UNIPROTKB|C9J060 203 TRIM22 "E3 ubiquitin-protein l 0.207 0.295 0.353 1e-05
UNIPROTKB|C9JIU5 227 TRIM22 "E3 ubiquitin-protein l 0.207 0.264 0.353 1.7e-05
UNIPROTKB|E2R9I5 1007 HLTF "Uncharacterized protein" 0.512 0.146 0.257 1.8e-05
TAIR|locus:2064935 AT2G38920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 900 (321.9 bits), Expect = 3.1e-90, P = 3.1e-90
 Identities = 177/291 (60%), Positives = 217/291 (74%)

Query:     1 MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDI 60
             MKFGETFTEYLHG++E FL+KC  VEYK+LKKVLK C+TC     ++ K+    D+G+ I
Sbjct:     1 MKFGETFTEYLHGEEEWFLEKCRFVEYKKLKKVLKKCKTC-----NSTKS----DDGQII 51

Query:    61 XXXXXXXXXXXXXXX-----DHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVL 115
                                 D MFF ELMKEA+DIAG F SR RHLLHLHVA+GMQRY++
Sbjct:    52 PSATSSSLSDSCECKACPWCDQMFFEELMKEATDIAGFFRSRVRHLLHLHVATGMQRYMI 111

Query:   116 RIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKSVNGKNFKSKMRAEHIE 175
             R+R+CF +++ A+++EG++LI+YI MNAIAIRKILKKYDKVH S NGKNFK KMRAE IE
Sbjct:   112 RLRRCFTDEKQALVQEGQILIQYITMNAIAIRKILKKYDKVHSSENGKNFKLKMRAERIE 171

Query:   176 LLQSPWLIELGGFYLNFNGL-NCGASSEFSGHFSFD-FNASRPVMTLALPSSIKLEYDLT 233
             LL SPWLIELG FYLN +GL N G      G  + +  N  +PV+ L LP+SI+LEYDLT
Sbjct:   172 LLHSPWLIELGAFYLN-SGLDNVGNFKNSFGRVACENLNEDQPVLKLMLPNSIELEYDLT 230

Query:   234 CAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICRE 284
             CA+CL+ VFNPYAL CGH+FC  CACSAASV++F+G+K+A   SKCPICRE
Sbjct:   231 CAICLETVFNPYALKCGHIFCNSCACSAASVLIFQGIKAAPRHSKCPICRE 281
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006817 "phosphate ion transport" evidence=RCA
GO:0009062 "fatty acid catabolic process" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=RCA
TAIR|locus:2024675 NLA "nitrogen limitation adaptation" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9JWN8 TRIM5 "Tripartite motif-containing protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSU9 LOC416147 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A2AE50 TRIM26 "Tripartite motif-containing protein 26" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2128746 RMA1 "RING membrane-anchor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1196437 Hltf "helicase-like transcription factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|C9J060 TRIM22 "E3 ubiquitin-protein ligase TRIM22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JIU5 TRIM22 "E3 ubiquitin-protein ligase TRIM22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9I5 HLTF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2XK56BAHL1_ORYSI6, ., 3, ., 2, ., -0.58960.97230.8289N/Ano
Q7XZZ3BAHL1_ORYSJ6, ., 3, ., 2, ., -0.58960.97230.8289yesno
Q8GW10BAH1L_ARATH6, ., 3, ., 2, ., -0.61160.94800.8179yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00160576
hypothetical protein (338 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
pfam03105176 pfam03105, SPX, SPX domain 3e-22
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 8e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-04
PLN03208 193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 4e-04
cd0016245 cd00162, RING, RING-finger (Really Interesting New 5e-04
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 0.001
>gnl|CDD|217372 pfam03105, SPX, SPX domain Back     alignment and domain information 
 Score = 90.6 bits (225), Expect = 3e-22
 Identities = 43/191 (22%), Positives = 67/191 (35%), Gaps = 36/191 (18%)

Query: 1   MKFGETFTEYLHGD-QERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKD 59
           MKFG++    L  + +++++D      YK LKK++K     K                  
Sbjct: 1   MKFGKSLERNLVPEWRDKYID------YKALKKLIKELTRAK---------LSLTTNEDG 45

Query: 60  ISESQLCQCQSSCQLCDHMFFSELMKEASDIAGCFSSRARHLLHLHVASGMQRYVLRIRQ 119
             ES     +   +  +  FF  L KE   +   +  +   LL        Q   L  R+
Sbjct: 46  EDESSNLLNEEELEEDESEFFEALDKELEKVNSFYKEKEAELLERLEELEKQLEELEERR 105

Query: 120 --------------------CFKNDQTAMIEEGRVLIEYIIMNAIAIRKILKKYDKVHKS 159
                                 K     +  E ++L  YI +N    RKILKKYDK+  S
Sbjct: 106 DETSSAKSSPSDKNLLKAFEELKKALLELYRELQLLKSYIELNRTGFRKILKKYDKITGS 165

Query: 160 VNGKNFKSKMR 170
              K +  K+ 
Sbjct: 166 SLSKKYLEKVV 176

We have named this region the SPX domain after (SYG1, Pho81 and XPR1). This 180 residue length domain is found at the amino terminus of a variety of proteins. In the yeast protein SYG1, the N-terminus directly binds to the G- protein beta subunit and inhibits transduction of the mating pheromone signal. This finding suggests that all the members of this family are involved in G-protein associated signal transduction. The N-termini of several proteins involved in the regulation of phosphate transport, including the putative phosphate level sensors PHO81 from Saccharomyces cerevisiae and NUC-2 from Neurospora crassa, are also members of this family. The SPX domain of S. cerevisiae low-affinity phosphate transporters Pho87 and Pho90 auto-regulates uptake and prevents efflux. This SPX dependent inhibition is mediated by the physical interaction with Spl2 NUC-2 contains several ankyrin repeats pfam00023. Several members of this family are annotated as XPR1 proteins: the xenotropic and polytropic retrovirus receptor confers susceptibility to infection with murine leukaemia viruses (MLV). The similarity between SYG1, phosphate regulators and XPR1 sequences has been previously noted, as has the additional similarity to several predicted proteins, of unknown function, from Drosophila melanogaster, Arabidopsis thaliana, Caenorhabditis elegans, Schizosaccharomyces pombe, and Saccharomyces cerevisiae. In addition, given the similarities between XPR1 and SYG1 and phosphate regulatory proteins, it has been proposed that XPR1 might be involved in G-protein associated signal transduction and may itself function as a phosphate sensor. Length = 176
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
KOG1161310 consensus Protein involved in vacuolar polyphospha 99.95
PF03105275 SPX: SPX domain; InterPro: IPR004331 The SPX domai 99.92
KOG1162 617 consensus Predicted small molecule transporter [In 99.86
COG5036 509 SPX domain-containing protein involved in vacuolar 99.81
COG5408296 SPX domain-containing protein [Signal transduction 99.33
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.27
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.1
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.01
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.99
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.99
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.89
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.88
PHA02929238 N1R/p28-like protein; Provisional 98.85
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.84
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.76
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.75
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.74
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.74
PHA02926242 zinc finger-like protein; Provisional 98.72
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.66
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.62
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.6
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.6
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.56
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.55
PF1463444 zf-RING_5: zinc-RING finger domain 98.54
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.4
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.4
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.33
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.14
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.13
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.97
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.95
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.9
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.89
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.82
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.82
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
COG5152259 Uncharacterized conserved protein, contains RING a 97.61
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.6
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.5
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.49
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.43
KOG2660 331 consensus Locus-specific chromosome binding protei 97.4
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.34
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.31
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.31
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.18
COG5222 427 Uncharacterized conserved protein, contains RING Z 97.15
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.12
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.09
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.99
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.9
KOG4367 699 consensus Predicted Zn-finger protein [Function un 96.6
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.44
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.36
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.34
COG52191525 Uncharacterized conserved protein, contains RING Z 96.17
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.98
PF07800 162 DUF1644: Protein of unknown function (DUF1644); In 95.93
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.89
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 95.73
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.72
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.67
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 95.61
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.42
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 95.04
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.27
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.24
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.15
PF04641260 Rtf2: Rtf2 RING-finger 93.82
KOG3002 299 consensus Zn finger protein [General function pred 93.65
KOG149384 consensus Anaphase-promoting complex (APC), subuni 93.58
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.56
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 93.51
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 92.86
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 92.66
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 92.61
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.31
PHA03096284 p28-like protein; Provisional 91.86
COG5175 480 MOT2 Transcriptional repressor [Transcription] 91.78
KOG1941518 consensus Acetylcholine receptor-associated protei 91.6
PF10272358 Tmpp129: Putative transmembrane protein precursor; 90.95
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 90.73
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.21
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 89.9
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 89.76
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 89.69
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 89.56
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 89.31
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 87.73
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 87.56
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 85.99
COG5109396 Uncharacterized conserved protein, contains RING Z 85.69
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 83.78
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 82.54
PHA02825 162 LAP/PHD finger-like protein; Provisional 82.35
KOG3039 303 consensus Uncharacterized conserved protein [Funct 80.64
>KOG1161 consensus Protein involved in vacuolar polyphosphate accumulation, contains SPX domain [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.95  E-value=2.8e-27  Score=211.86  Aligned_cols=136  Identities=24%  Similarity=0.264  Sum_probs=103.8

Q ss_pred             CCcchhhhhhhhhhhhhccccCCccchHHHHHHHHhchhcCCCCCccCcccccccccccchhhhhhhcccchhhchhHHH
Q 022989            1 MKFGETFTEYLHGDQERFLDKCSHVEYKRLKKVLKSCRTCKGLHDSACKTEQQWDEGKDISESQLCQCQSSCQLCDHMFF   80 (289)
Q Consensus         1 MKFGk~l~~~~~~~~~~~~~~~~yi~Yk~LKk~ik~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ff   80 (289)
                      |||||.|++.+.|+|     +.+|||||.|||+||+.+..  .+...+       +.+                .+..|+
T Consensus         1 MkFGk~L~~~~l~ew-----~~~yinYk~LKK~lK~~~~~--~~~~~~-------~~~----------------~e~dFv   50 (310)
T KOG1161|consen    1 MKFGKYLKEELLPEW-----KDKYINYKELKKLLKQYSIQ--TADSSP-------DSR----------------DESDFV   50 (310)
T ss_pred             CchhHHHHHhhhhhH-----hhhhcCHHHHHHHHHHhccc--cccCCc-------ccc----------------hHHHHH
Confidence            999999999999977     88999999999999998751  111111       000                257899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh--hhhH---------HHHHHHHHhhhhhcHHHHHHHHHHHHHHHHhhHHHHHHH
Q 022989           81 SELMKEASDIAGCFSSRARHLLHLHV--ASGM---------QRYVLRIRQCFKNDQTAMIEEGRVLIEYIIMNAIAIRKI  149 (289)
Q Consensus        81 ~~L~~El~kv~~f~~~r~~~l~~~~~--~~~~---------~~~~~~~~~~~~~~~~~~~~e~~~L~~f~~lN~~~~~ki  149 (289)
                      +.||+||||||+||.++.+++..+..  ....         ...+..++    +...+++.|+++|.+|++||+|||+||
T Consensus        51 ~~Ld~ELEKv~~F~lek~~el~~Rl~~L~e~~~~~~~~~~~~~~~~~lr----~~l~~~~~em~~L~~fs~LN~tGf~KI  126 (310)
T KOG1161|consen   51 RLLDAELEKVNGFQLEKESELIIRLKELEEKIDALSLEPPSAEEMKELR----EELVDFHGEMVLLENFSRLNYTGFAKI  126 (310)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCCcchhHHHHHH----HHHHHHHHHHHHHHHHHHHhHHHHHHH
Confidence            99999999999999888776665421  1111         11223333    356889999999999999999999999


Q ss_pred             hhhhhhhhccccCccchhhhh
Q 022989          150 LKKYDKVHKSVNGKNFKSKMR  170 (289)
Q Consensus       150 lkK~dk~~~~~~~~~~~~~~~  170 (289)
                      ||||||+++......|..++.
T Consensus       127 LKK~DKrtg~~l~~~f~~~l~  147 (310)
T KOG1161|consen  127 LKKHDKRTGYRLRPYFQVRLL  147 (310)
T ss_pred             HHHHhcccccccccHHHHHHH
Confidence            999999999777777766654

>PF03105 SPX: SPX domain; InterPro: IPR004331 The SPX domain is named after SYG1/Pho81/XPR1 proteins Back     alignment and domain information
>KOG1162 consensus Predicted small molecule transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5036 SPX domain-containing protein involved in vacuolar polyphosphate accumulation [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5408 SPX domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2ecv_A85 Solution Structure Of The Zinc Finger, C3hc4 Type ( 6e-05
2egp_A79 Solution Structure Of The Ring-Finger Domain From H 7e-05
2ecw_A85 Solution Structure Of The Zinc Finger, C3hc4 Type ( 5e-04
1jm7_A112 Solution Structure Of The Brca1/bard1 Ring-domain H 8e-04
>pdb|2ECV|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Tripartite Motif-Containing Protein 5 Length = 85 Back     alignment and structure 
Iteration: 1

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 7/59 (11%)
Query: 226 IKLEYDLTCAVCLDLVFNPYALSCGHLFCKLC-ACSAASVMVFEGLKSASPDSKCPICR 283
           + ++ ++TC +CL+L+  P +L CGH FC+ C   +    M+ +G      +S CP+CR
Sbjct: 14  VNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKG------ESSCPVCR 66
>pdb|2EGP|A Chain A, Solution Structure Of The Ring-Finger Domain From Human Tripartite Motif Protein 34 Length = 79 Back     alignment and structure
>pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 Back     alignment and structure
>pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2ecw_A85 Tripartite motif-containing protein 30; metal bind 3e-10
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-09
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-09
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 5e-09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-08
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 4e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 5e-08
2ysl_A73 Tripartite motif-containing protein 31; ring-type 7e-08
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 8e-08
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 1e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 6e-07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 6e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 1e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 1e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-06
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 2e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 3e-06
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 5e-06
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 6e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 7e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 8e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 9e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 9e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-05
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 1e-04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-04
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
 Score = 54.7 bits (132), Expect = 3e-10
 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 213 ASRPVMTLALPSSIKLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKS 272
            S     +A      ++ ++TC +CL+L+  P +  C H FC+ C         +E  ++
Sbjct: 1   GSSGSSGMASSVLEMIKEEVTCPICLELLKEPVSADCNHSFCRACITL-----NYESNRN 55

Query: 273 ASPDSKCPICREE 285
                 CP+CR  
Sbjct: 56  TDGKGNCPVCRVP 68
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.32
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.3
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.3
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.29
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.28
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.28
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.28
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.27
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.25
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.24
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.24
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.22
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.22
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.21
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.19
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.18
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.18
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.18
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.17
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.17
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.16
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.16
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.16
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.15
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.14
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.13
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.12
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.1
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.1
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.09
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.08
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.08
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.07
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.06
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.06
2ect_A78 Ring finger protein 126; metal binding protein, st 99.04
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.03
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.03
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.02
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.02
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.0
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.99
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.98
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.98
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.98
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.96
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.94
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.9
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.87
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.81
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.79
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.79
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.75
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.74
2ea5_A68 Cell growth regulator with ring finger domain prot 98.73
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.72
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.67
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.63
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.58
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.57
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.42
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.2
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.14
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.71
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.62
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.41
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.31
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.03
3nw0_A238 Non-structural maintenance of chromosomes element 94.68
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 91.18
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 86.93
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 81.98
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 81.6
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 80.83
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.32  E-value=2.6e-12  Score=91.86  Aligned_cols=54  Identities=31%  Similarity=0.848  Sum_probs=45.5

Q ss_pred             ccccccccccccCCCCCcEeccCCCcccHHhHHHhhhhHhHhcccCCCCCCccccccccccC
Q 022989          227 KLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREELAG  288 (289)
Q Consensus       227 ~~~~~~~C~IC~~~~~~p~~l~CgH~FC~~Cl~~~~~~~~~~~~~~~~~~~~CP~CR~~~~~  288 (289)
                      .+.+.+.|+||++.+.+|+.++|||.||..|+..|+.        .......||+||..+..
T Consensus        16 ~~~~~~~C~IC~~~~~~~~~~~CgH~fC~~Ci~~~~~--------~~~~~~~CP~Cr~~~~~   69 (73)
T 2ysl_A           16 KLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGE--------TSCGFFKCPLCKTSVRK   69 (73)
T ss_dssp             CCCCCCBCTTTCSBCSSEEECTTCCEEEHHHHHHHCS--------SSCSCCCCSSSCCCCCC
T ss_pred             hCccCCEeccCCcccCCeEEcCCCChhhHHHHHHHHH--------cCCCCCCCCCCCCcCCc
Confidence            4567899999999999999999999999999998841        12356789999998865
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-07
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 4e-06
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-06
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-04
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.8 bits (108), Expect = 3e-07
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 227 KLEYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREEL 286
            ++  L C +CL+L+  P +  C H+FCK C            L      S+CP+C+ ++
Sbjct: 17  AMQKILECPICLELIKEPVSTKCDHIFCKFCMLKL--------LNQKKGPSQCPLCKNDI 68
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.35
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.32
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.27
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.25
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.21
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.18
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.15
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.13
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.1
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.09
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.02
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.93
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.76
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.52
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.46
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.2
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 92.49
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.35  E-value=1.1e-13  Score=100.98  Aligned_cols=50  Identities=30%  Similarity=0.738  Sum_probs=43.0

Q ss_pred             ccccccccccCCCCCcEeccCCCcccHHhHHHhhhhHhHhcccCCCCCCccccccccccC
Q 022989          229 EYDLTCAVCLDLVFNPYALSCGHLFCKLCACSAASVMVFEGLKSASPDSKCPICREELAG  288 (289)
Q Consensus       229 ~~~~~C~IC~~~~~~p~~l~CgH~FC~~Cl~~~~~~~~~~~~~~~~~~~~CP~CR~~~~~  288 (289)
                      .+.+.|+||++.+.+|++++|||+||..|+.+|+.          .+...||.||.++.+
T Consensus        21 ~~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~----------~~~~~CP~Cr~p~~~   70 (86)
T d1rmda2          21 VKSISCQICEHILADPVETSCKHLFCRICILRCLK----------VMGSYCPSCRYPCFP   70 (86)
T ss_dssp             HHHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHH----------HTCSBCTTTCCBCCG
T ss_pred             ccCcCCccCCcchhcceecCCCChhhHHHHHHHHh----------hCCCcCcccCCCCCh
Confidence            46689999999999999999999999999999853          244679999998753
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure