Citrus Sinensis ID: 023002

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MAESGSGEAQQAEQVCNFFRKPTKNKNIRKRTIREDEDEDSIESSVLQNLKKPTKPDSKLYFSTGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKV
ccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccEEccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEcccccccccHHHHcc
ccccccccccccccEEEEEEccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHccccccccccEcccHccHHHHccccccccccccccccccccccccccEEEEEEEcccccHHHcHHHccccccccccHHHccccHHHccccHHHHHHHHHHccccccccccccccccccccccccHHHccccEEEEEcccccccEEEEcccEccHHHEEcc
maesgsgeaQQAEQVCNFfrkptknknirkrtiredededsiESSVLQnlkkptkpdsklyfstgpskrdtsadsnadsekpifqfesskeiqvqHDSKATATLETETDFLRDSRALREKVLKRSEEALkgkasgdeklykgihgyvdhkagfrrehtvssekaggshgplrasAHIRVTarfdyqpdickdyketgycgygdsckfmhdrgdyksgwQMEKEWEEAEKARKRNlalgggdsdeegvgqsddddedslpfacficrkpfvdpvvtkckhyfcehcalkv
maesgsgeaqqaeqvcnffrkptknknirkrtiredededsiessvlqnlkkptkpdsklyfstgpskrdtsadsnadSEKPIFqfesskeiqvqhdskatatletetdflrdsrALREKVLKrseealkgkasgdeklykGIHGYVDHKAGFRREHTVssekaggshgplraSAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNlalgggdsdeegvgQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKV
MAESGSGEAQQAEQVCNFFRKPTKNKNIRKRTIRedededsiessVLQNLKKPTKPDSKLYFSTGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMekeweeaekarkrNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKV
******************************************************************************************************************************************LYKGIHGYVDHKAG*********************SAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGW***************************************LPFACFICRKPFVDPVVTKCKHYFCEHCAL**
*******************************************************************************************************************************************************************************HIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKS*W**************************************SLPFACFICRKPFVDPVVTKCKHYFCEHCALKV
************EQVCNFFRKPTKNKNIRKR***************LQNLKKPTKPDSKLYFSTG*************SEKPIFQFESSK**********TATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFR****************LRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALG****************EDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKV
************EQVCNFFRKP*****************************************************************SSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAG***************HGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEK***********************DDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESGSGEAQQAEQVCNFFRKPTKNKNIRKRTIREDEDEDSIESSVLQNLKKPTKPDSKLYFSTGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q9FNG6378 Zinc finger CCCH domain-c yes no 0.975 0.746 0.721 1e-116
Q8GX84343 Zinc finger CCCH domain-c no no 0.968 0.816 0.728 1e-116
Q6K4V3326 Zinc finger CCCH domain-c yes no 0.913 0.809 0.644 1e-85
O15541343 RING finger protein 113A yes no 0.605 0.510 0.481 5e-43
Q67ER4343 RING finger protein 113A no no 0.605 0.510 0.476 7e-43
Q8IZP6322 RING finger protein 113B no no 0.910 0.816 0.366 7e-43
O17917 384 RING finger protein 113 h yes no 0.865 0.651 0.385 2e-39
Q4P400355 Pre-mRNA-splicing factor N/A no 0.743 0.605 0.380 5e-39
Q55G16355 RING finger protein 113 h yes no 0.543 0.442 0.450 5e-37
Q9P6R8 533 Pre-mRNA-splicing factor yes no 0.643 0.348 0.358 2e-33
>sp|Q9FNG6|C3H51_ARATH Zinc finger CCCH domain-containing protein 51 OS=Arabidopsis thaliana GN=At5g06420 PE=2 SV=1 Back     alignment and function desciption
 Score =  419 bits (1077), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 212/294 (72%), Positives = 249/294 (84%), Gaps = 12/294 (4%)

Query: 1   MAESGSGEA--QQAEQVCNFFRKPTKNKNIRKRTIREDE-DEDS-IESSVLQNLKKPTKP 56
           MAE G+  +  Q+++QVC FF+KPTK+KNIRKRTI  DE D DS  ESS+LQNLKK  KP
Sbjct: 51  MAEFGNDNSNNQESQQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQNLKKVAKP 110

Query: 57  DSKLYFSTGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRA 116
           DS LYFS+GPS R + A      E+P+F ++SSKEIQVQ+DS ATATLETETDF +D+RA
Sbjct: 111 DSNLYFSSGPSTRTSGA-----PERPVFHYDSSKEIQVQNDSGATATLETETDFNQDARA 165

Query: 117 LREKVLKRSEEALKG--KASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRAS 174
           +RE+VLK+++ ALKG  K + DEKLYKGIHGY DHKAGFRRE T+SSEKAGGSHGPLRAS
Sbjct: 166 IRERVLKKADHALKGNKKKASDEKLYKGIHGYTDHKAGFRREQTISSEKAGGSHGPLRAS 225

Query: 175 AHIRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRN 234
           AHIRV+ARFDYQPDICKDYKETGYCGYGDSCKF+HDRGDYK GWQ+EKEWEEAEK RKRN
Sbjct: 226 AHIRVSARFDYQPDICKDYKETGYCGYGDSCKFLHDRGDYKPGWQIEKEWEEAEKVRKRN 285

Query: 235 LALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALK 288
            A+ G + D++   +  D+DE++LPFACFICR+PF+DPVVTKCKHYFCEHCALK
Sbjct: 286 KAM-GVEDDDDEADKDSDEDENALPFACFICREPFLDPVVTKCKHYFCEHCALK 338

Arabidopsis thaliana (taxid: 3702)
>sp|Q8GX84|C3H1_ARATH Zinc finger CCCH domain-containing protein 1 OS=Arabidopsis thaliana GN=At1g01350 PE=2 SV=2 Back     alignment and function description
>sp|Q6K4V3|C3H15_ORYSJ Zinc finger CCCH domain-containing protein 15 OS=Oryza sativa subsp. japonica GN=Os02g0301000 PE=2 SV=1 Back     alignment and function description
>sp|O15541|R113A_HUMAN RING finger protein 113A OS=Homo sapiens GN=RNF113A PE=1 SV=1 Back     alignment and function description
>sp|Q67ER4|R113A_BOVIN RING finger protein 113A OS=Bos taurus GN=RNF113A PE=2 SV=1 Back     alignment and function description
>sp|Q8IZP6|R113B_HUMAN RING finger protein 113B OS=Homo sapiens GN=RNF113B PE=1 SV=3 Back     alignment and function description
>sp|O17917|RN113_CAEEL RING finger protein 113 homolog OS=Caenorhabditis elegans GN=rnf-113 PE=2 SV=2 Back     alignment and function description
>sp|Q4P400|CWC24_USTMA Pre-mRNA-splicing factor CWC24 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC24 PE=3 SV=1 Back     alignment and function description
>sp|Q55G16|RN113_DICDI RING finger protein 113 homolog OS=Dictyostelium discoideum GN=rnf113 PE=4 SV=1 Back     alignment and function description
>sp|Q9P6R8|CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf24 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
255562324325 RING finger protein 113A, putative [Rici 0.979 0.870 0.763 1e-122
449463408322 PREDICTED: zinc finger CCCH domain-conta 0.979 0.878 0.769 1e-122
359489721331 PREDICTED: zinc finger CCCH domain-conta 0.993 0.867 0.771 1e-120
224130524323 predicted protein [Populus trichocarpa] 0.986 0.882 0.773 1e-120
147833692 846 hypothetical protein VITISV_014667 [Viti 0.993 0.339 0.768 1e-119
449499095300 PREDICTED: zinc finger CCCH domain-conta 0.989 0.953 0.754 1e-118
297848380342 zinc finger family protein [Arabidopsis 0.965 0.815 0.728 1e-116
26451788343 unknown protein [Arabidopsis thaliana] 0.968 0.816 0.731 1e-115
9665151304 Putative zinc finger protein [Arabidopsi 0.972 0.924 0.729 1e-115
15240037378 zinc finger CCCH domain-containing prote 0.975 0.746 0.721 1e-115
>gi|255562324|ref|XP_002522169.1| RING finger protein 113A, putative [Ricinus communis] gi|223538607|gb|EEF40210.1| RING finger protein 113A, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 220/288 (76%), Positives = 250/288 (86%), Gaps = 5/288 (1%)

Query: 6   SGEAQQAEQVCNFFRKPTKNKNIRKRTIREDEDEDS--IESSVLQNLKKPTKPDSKLYFS 63
           SG+++Q E VCNFFRKP KNKNIRKRTI +DE++D+   ESS+L N KK  KPD+KLYFS
Sbjct: 4   SGQSEQPEPVCNFFRKPLKNKNIRKRTIEKDEEDDNSKTESSLLHNQKKAPKPDNKLYFS 63

Query: 64  TGPSKRDTSA-DSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVL 122
           TGPSK   SA +S  +S++P+FQFESSKEIQVQHDS+ATATLETET+F +D+RA+RE+ L
Sbjct: 64  TGPSKNSLSAAESVVESDRPVFQFESSKEIQVQHDSRATATLETETEFSKDARAIRERAL 123

Query: 123 KRSEEALKGK--ASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVT 180
           K++EEALKGK  +SGD KLYKGIHGY DHKAGFRRE T+SSEKAGGSHGPLRASAHIRV+
Sbjct: 124 KQAEEALKGKTLSSGDAKLYKGIHGYTDHKAGFRREQTISSEKAGGSHGPLRASAHIRVS 183

Query: 181 ARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGG 240
           ARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQ+EKEW+EAEK RKRNLALG  
Sbjct: 184 ARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQLEKEWDEAEKIRKRNLALGEL 243

Query: 241 DSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALK 288
           +       + DDDDE  LPFACFICR+PFVDPV TKCKHYFCEHCALK
Sbjct: 244 EGGTGENEEEDDDDEHELPFACFICRQPFVDPVTTKCKHYFCEHCALK 291

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449463408|ref|XP_004149426.1| PREDICTED: zinc finger CCCH domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359489721|ref|XP_002277034.2| PREDICTED: zinc finger CCCH domain-containing protein 1-like [Vitis vinifera] gi|297745423|emb|CBI40503.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130524|ref|XP_002320858.1| predicted protein [Populus trichocarpa] gi|222861631|gb|EEE99173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147833692|emb|CAN64331.1| hypothetical protein VITISV_014667 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449499095|ref|XP_004160720.1| PREDICTED: zinc finger CCCH domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297848380|ref|XP_002892071.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297337913|gb|EFH68330.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|26451788|dbj|BAC42988.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9665151|gb|AAF97335.1|AC023628_16 Putative zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15240037|ref|NP_196260.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|30681442|ref|NP_850780.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|75334125|sp|Q9FNG6.1|C3H51_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 51; Short=AtC3H51 gi|9758422|dbj|BAB08964.1| unnamed protein product [Arabidopsis thaliana] gi|21618279|gb|AAM67329.1| unknown [Arabidopsis thaliana] gi|332003629|gb|AED91012.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] gi|332003630|gb|AED91013.1| zinc finger CCCH domain-containing protein 51 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2035377343 AT1G01350 [Arabidopsis thalian 0.968 0.816 0.675 1.4e-103
TAIR|locus:2164320378 AT5G06420 [Arabidopsis thalian 0.975 0.746 0.659 4.7e-103
FB|FBgn0038772357 CG4973 [Drosophila melanogaste 0.782 0.633 0.432 1.5e-49
ZFIN|ZDB-GENE-040825-1321 rnf113a "ring finger protein 1 0.906 0.816 0.375 1.2e-44
UNIPROTKB|F1RUA4344 LOC100514886 "Uncharacterized 0.934 0.784 0.368 3.5e-43
UNIPROTKB|Q5PPN1341 Rnf113a1 "Ring finger protein 0.934 0.791 0.368 1.5e-42
UNIPROTKB|Q67ER3328 RNF113A "Zinc finger protein 1 0.712 0.628 0.429 1.9e-42
UNIPROTKB|Q67ER4343 RNF113A "RING finger protein 1 0.934 0.787 0.372 3.2e-42
UNIPROTKB|E1BF77351 LOC518027 "Uncharacterized pro 0.633 0.521 0.460 5.2e-42
UNIPROTKB|O15541343 RNF113A "RING finger protein 1 0.930 0.784 0.374 5.2e-42
TAIR|locus:2035377 AT1G01350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1026 (366.2 bits), Expect = 1.4e-103, P = 1.4e-103
 Identities = 194/287 (67%), Positives = 227/287 (79%)

Query:     6 SGEAQQAEQVCNFFRKPTKNKNIRKRTIRXXXXX--XXXXXXVLQNLKKPTKPDSKLYFS 63
             + +  Q++QVC FF+KPTK+KNIRKRTI              +LQNLKK  KPDSKLYFS
Sbjct:    20 AAQETQSQQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQNLKKVAKPDSKLYFS 79

Query:    64 TGPSKRDTSADSNADSEKPIFQFESSKEIQVQHDSKATATLETETDFLRDSRALREKVLK 123
             +GPSK  T+  S A  E+ +F ++SSKEIQVQ+DS ATATLETETDF +D+RA+RE+VLK
Sbjct:    80 SGPSKSSTTT-SGAP-ERSVFHYDSSKEIQVQNDSGATATLETETDFNQDARAIRERVLK 137

Query:   124 RSEEALKG--KASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTA 181
             +++EALKG  K + DEKLYKGIHGY DHKAGFRRE T+SSEKAGGSHGPLRASAHIRV+A
Sbjct:   138 KADEALKGNKKKASDEKLYKGIHGYTDHKAGFRREQTISSEKAGGSHGPLRASAHIRVSA 197

Query:   182 RFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMXXXXXXXXXXXXXNLALGGGD 241
             RFDYQPDICKDYKETGYCGYGDSCKF+HDRGDYK GWQ+             N A+G  D
Sbjct:   198 RFDYQPDICKDYKETGYCGYGDSCKFLHDRGDYKPGWQIEKEWEEAEKVRKRNKAMGVED 257

Query:   242 SDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALK 288
              D+E   +  D+DE++LPFACFICR+PFVDPVVTKCKHYFCEHCALK
Sbjct:   258 EDDEA-DKDSDEDENALPFACFICREPFVDPVVTKCKHYFCEHCALK 303
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2164320 AT5G06420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0038772 CG4973 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040825-1 rnf113a "ring finger protein 113A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUA4 LOC100514886 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5PPN1 Rnf113a1 "Ring finger protein 113A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q67ER3 RNF113A "Zinc finger protein 183" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q67ER4 RNF113A "RING finger protein 113A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF77 LOC518027 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O15541 RNF113A "RING finger protein 113A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6K4V3C3H15_ORYSJNo assigned EC number0.64430.91340.8098yesno
Q9FNG6C3H51_ARATHNo assigned EC number0.72100.97570.7460yesno
Q8GX84C3H1_ARATHNo assigned EC number0.72820.96880.8163nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XIV1660
hypothetical protein (323 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 1e-28
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 6e-07
smart0035627 smart00356, ZnF_C3H1, zinc finger 2e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 4e-05
smart0018440 smart00184, RING, Ring finger 6e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-04
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information 
 Score =  110 bits (275), Expect = 1e-28
 Identities = 53/112 (47%), Positives = 68/112 (60%), Gaps = 17/112 (15%)

Query: 177 IRVTARFDYQPDICKDYKETGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLA 236
            R     D QPD+CKDYKETGYCGYGDSCKF+HDR D+K+GW++ +EW  AE        
Sbjct: 131 FRDGEVIDTQPDVCKDYKETGYCGYGDSCKFLHDRSDFKTGWKLNQEW-NAEY------- 182

Query: 237 LGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALK 288
                  EE    S   ++  +PF C IC+K +  PVVT+C H FC  CA++
Sbjct: 183 -------EEAPVISGPGEK--IPFLCGICKKDYESPVVTECGHSFCSLCAIR 225

Length = 259
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
COG5152259 Uncharacterized conserved protein, contains RING a 100.0
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.86
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.67
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.58
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.43
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.38
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.37
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.27
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.22
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
PF1463444 zf-RING_5: zinc-RING finger domain 98.08
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.01
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.96
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.96
smart0035627 ZnF_C3H1 zinc finger. 97.96
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.84
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.84
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.73
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.64
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.56
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.45
PHA02929238 N1R/p28-like protein; Provisional 97.42
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.33
COG5222 427 Uncharacterized conserved protein, contains RING Z 97.19
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.08
PHA02926242 zinc finger-like protein; Provisional 96.71
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.01
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.73
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 95.23
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 95.04
KOG3039 303 consensus Uncharacterized conserved protein [Funct 95.01
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 94.67
KOG1002 791 consensus Nucleotide excision repair protein RAD16 94.41
KOG0825 1134 consensus PHD Zn-finger protein [General function 92.22
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 91.85
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 90.27
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.59
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 89.57
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 89.03
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 88.65
PF04641 260 Rtf2: Rtf2 RING-finger 88.39
KOG3039303 consensus Uncharacterized conserved protein [Funct 88.26
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 86.86
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 85.53
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 83.24
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 82.56
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 81.54
PF03194 254 LUC7: LUC7 N_terminus; InterPro: IPR004882 This fa 81.27
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=9.8e-64  Score=466.18  Aligned_cols=220  Identities=47%  Similarity=0.811  Sum_probs=179.7

Q ss_pred             eeecccCCCCCCCCceeecCCCccCC--------CCCCCCCCCCCceeeeccchhccc--cccccccccccccchhhhHH
Q 023002           46 VLQNLKKPTKPDSKLYFSTGPSKRDT--------SADSNADSEKPIFQFESSKEIQVQ--HDSKATATLETETDFLRDSR  115 (289)
Q Consensus        46 v~~~~kkr~k~~~~~~~st~~~~~~~--------~~~~~~~~~~~~~~~~ssr~~~~~--~d~~AT~~~e~dt~~d~Da~  115 (289)
                      +++..+.+++ ++|++|.+..+....        .+..+...+.+.|.|.|.+.+.+.  .++|||+++|.+|+..+|||
T Consensus        41 s~r~ek~~k~-~~p~~q~~k~~~k~~~~~~~~s~~s~~~~~~ed~vv~y~s~~~~~~~g~~dsgat~t~e~~te~~~Daq  119 (313)
T KOG1813|consen   41 SSRLEKLEKK-IKPETQRKKETDKVLTGEEDDSALSICQNPFEDPVVTYCSCDKCALKGHTDSGATATLEEPTEGLRDAQ  119 (313)
T ss_pred             hhhhhhhhhh-cchHhhhhhhhcccccccccccccccccCcccccceeeccccccccCCccccCceeEeecCcccchhHH
Confidence            3555555555 578877654322111        111223345799999998888765  59999999999999999999


Q ss_pred             HHHHHHHHhhHHHhcCCCCCCccccccccccccccccccccccccccCCCCCCCCCcCCceeeeeeeeeecCCCcCCCcc
Q 023002          116 ALREKVLKRSEEALKGKASGDEKLYKGIHGYVDHKAGFRREHTVSSEKAGGSHGPLRASAHIRVTARFDYQPDICKDYKE  195 (289)
Q Consensus       116 ai~er~~~~~~~~l~g~~~~~d~~YrG~~~y~~~~~~~~~~~~~~~~~~~~~~GPirap~niR~t~~~DyqPDiCKDyke  195 (289)
                      +|+|++++..++.+.|+  .++.+|+|+|+|.+|.+   ..++..++...|.+=|||||++||++++|||||||||||+|
T Consensus       120 a~~er~~k~~~e~~~~k--~~~~lykg~~~ya~~~k---~~~~~~~n~s~g~~rpira~~~~r~~~~~d~qpDicKdyke  194 (313)
T KOG1813|consen  120 AIIERRIKEEREKLRGK--KDTKLYKGINTYADDAK---AQKVVKMNESIGTVRPIRAAMHTRAGERIDYQPDICKDYKE  194 (313)
T ss_pred             HHhhhhHHHHHHhhcch--hHHHHHHHHHHHHhhhh---hhhhHhhhcccccccccchhhhhcccceeecCchhhhhhHh
Confidence            99999999778888886  48899999999999975   44445556666644499999999999999999999999999


Q ss_pred             cccccCCCceeeeeecccccccchhhHHHHHHHHHHhhhhcCCCCCCCCCCCCCCCCCCCCCCceeccccccccCCceec
Q 023002          196 TGYCGYGDSCKFMHDRGDYKSGWQMEKEWEEAEKARKRNLALGGGDSDEEGVGQSDDDDEDSLPFACFICRKPFVDPVVT  275 (289)
Q Consensus       196 TG~CGfGDsCKFlHdR~dyk~GWqld~ewe~~~k~kk~~l~~g~~~~~~~~~~~~~~~~e~~~p~~C~IC~~~f~dPVvT  275 (289)
                      ||||||||||||||+|+|||+||||++||++.+-.                 ......|++.+||.|.||++.|.+||||
T Consensus       195 Tgycg~gdSckFlh~r~DyK~GWqi~~e~d~~ke~-----------------~~~~~~D~~~~Pf~c~icr~~f~~pVvt  257 (313)
T KOG1813|consen  195 TGYCGYGDSCKFLHDRSDYKAGWQIEFEWDSAKEK-----------------KRVKIEDIELLPFKCFICRKYFYRPVVT  257 (313)
T ss_pred             hCcccccchhhhhhhhhhccccceeehhhhccccc-----------------cceecCCcccCCccccccccccccchhh
Confidence            99999999999999999999999999999977511                 1224456788999999999999999999


Q ss_pred             CCCChhhHHhHhc
Q 023002          276 KCKHYFCEHCALK  288 (289)
Q Consensus       276 ~CGH~FC~~Ci~~  288 (289)
                      .||||||+.|+++
T Consensus       258 ~c~h~fc~~ca~~  270 (313)
T KOG1813|consen  258 KCGHYFCEVCALK  270 (313)
T ss_pred             cCCceeehhhhcc
Confidence            9999999999975

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF03194 LUC7: LUC7 N_terminus; InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2csy_A81 Solution Structure Of The Ring Domain Of The Zinc F 4e-08
>pdb|2CSY|A Chain A, Solution Structure Of The Ring Domain Of The Zinc Finger Protein 183-Like 1 Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/31 (70%), Positives = 27/31 (87%)
Query: 258 LPFACFICRKPFVDPVVTKCKHYFCEHCALK 288
           +PF CFICR+ F +PVVTKC+HYFCE CAL+
Sbjct: 14  IPFRCFICRQAFQNPVVTKCRHYFCESCALE 44

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 6e-18
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 4e-07
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 9e-07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 3e-06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 4e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 5e-06
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 6e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 7e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 7e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 8e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-05
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-05
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 2e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 3e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 6e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 6e-05
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 1e-04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 3e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 7e-04
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
 Score = 75.6 bits (186), Expect = 6e-18
 Identities = 25/41 (60%), Positives = 32/41 (78%)

Query: 248 GQSDDDDEDSLPFACFICRKPFVDPVVTKCKHYFCEHCALK 288
           G S   +E+ +PF CFICR+ F +PVVTKC+HYFCE CAL+
Sbjct: 4   GSSGGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALE 44
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.94
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.87
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.8
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.8
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.79
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.76
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.76
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.74
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.73
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.72
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.7
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.7
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.7
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.69
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.66
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.64
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.63
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.61
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.6
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.59
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.58
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.57
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.54
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.53
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.51
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.51
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.49
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.48
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.47
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.45
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.42
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.41
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.39
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.39
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.37
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.34
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.34
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.33
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.31
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.31
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.28
2ect_A78 Ring finger protein 126; metal binding protein, st 98.26
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.26
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.25
2ea5_A68 Cell growth regulator with ring finger domain prot 98.16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.14
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.11
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.06
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.06
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.04
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.02
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.98
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.93
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.92
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 97.85
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.81
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.72
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.59
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 97.5
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.41
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 96.99
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 96.63
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.23
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 95.77
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 95.65
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 95.46
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 95.38
2rhk_C72 Cleavage and polyadenylation specificity factor su 94.68
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 94.6
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 93.34
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 90.68
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 89.64
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 89.64
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 89.52
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 88.54
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 88.35
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 86.9
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 85.77
2rhk_C72 Cleavage and polyadenylation specificity factor su 81.81
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 81.32
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=98.94  E-value=4.4e-10  Score=83.74  Aligned_cols=34  Identities=68%  Similarity=1.572  Sum_probs=30.4

Q ss_pred             CCCCceeccccccccCCceecCCCChhhHHhHhc
Q 023002          255 EDSLPFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       255 e~~~p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      +....+.|+||++.|.+||++.|||.||..||.+
T Consensus        11 ~~~~~~~C~IC~~~~~~p~~~~CgH~fC~~Ci~~   44 (81)
T 2csy_A           11 EEEIPFRCFICRQAFQNPVVTKCRHYFCESCALE   44 (81)
T ss_dssp             CCCCCSBCSSSCSBCCSEEECTTSCEEEHHHHHH
T ss_pred             cCCCCCCCcCCCchhcCeeEccCCCHhHHHHHHH
Confidence            3445789999999999999999999999999964
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 7e-05
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 3e-04
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 3e-04
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 3e-04
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 6e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.002
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Acute promyelocytic leukaemia proto-oncoprotein PML
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.6 bits (95), Expect = 7e-06
 Identities = 7/27 (25%), Positives = 9/27 (33%)

Query: 262 CFICRKPFVDPVVTKCKHYFCEHCALK 288
           C  C+     P +  C H  C  C   
Sbjct: 9   CQQCQAEAKCPKLLPCLHTLCSGCLEA 35
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.79
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.78
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.78
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.71
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.7
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.49
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.46
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.45
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.15
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.81
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.77
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.53
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.46
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.46
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 96.93
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 96.75
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 96.75
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 96.66
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.6
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 96.58
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 88.22
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 86.5
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.79  E-value=5.2e-10  Score=85.48  Aligned_cols=30  Identities=47%  Similarity=1.094  Sum_probs=28.2

Q ss_pred             ceeccccccccCCceecCCCChhhHHhHhc
Q 023002          259 PFACFICRKPFVDPVVTKCKHYFCEHCALK  288 (289)
Q Consensus       259 p~~C~IC~~~f~dPVvT~CGH~FC~~Ci~~  288 (289)
                      .+.|+||++.|.+||+|+|||.||+.||.+
T Consensus        23 ~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~   52 (86)
T d1rmda2          23 SISCQICEHILADPVETSCKHLFCRICILR   52 (86)
T ss_dssp             HTBCTTTCSBCSSEEECTTSCEEEHHHHHH
T ss_pred             CcCCccCCcchhcceecCCCChhhHHHHHH
Confidence            578999999999999999999999999974
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure