Citrus Sinensis ID: 023006
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 289 | ||||||
| 296089545 | 498 | unnamed protein product [Vitis vinifera] | 0.930 | 0.540 | 0.628 | 2e-93 | |
| 356577478 | 627 | PREDICTED: uncharacterized protein LOC10 | 0.927 | 0.427 | 0.645 | 2e-92 | |
| 356551269 | 456 | PREDICTED: UPF0586 protein C9orf41 homol | 0.813 | 0.515 | 0.608 | 8e-86 | |
| 449463611 | 492 | PREDICTED: UPF0586 protein C9orf41 homol | 0.899 | 0.528 | 0.631 | 2e-85 | |
| 297822971 | 508 | hypothetical protein ARALYDRAFT_902264 [ | 0.882 | 0.501 | 0.590 | 5e-80 | |
| 30685202 | 504 | N2227-like domain-containing protein [Ar | 0.892 | 0.511 | 0.578 | 7e-79 | |
| 224109542 | 356 | predicted protein [Populus trichocarpa] | 0.709 | 0.575 | 0.570 | 1e-74 | |
| 224137440 | 356 | predicted protein [Populus trichocarpa] | 0.709 | 0.575 | 0.566 | 3e-74 | |
| 218197084 | 494 | hypothetical protein OsI_20588 [Oryza sa | 0.899 | 0.526 | 0.539 | 4e-73 | |
| 115464829 | 494 | Os05g0511300 [Oryza sativa Japonica Grou | 0.899 | 0.526 | 0.539 | 4e-73 |
| >gi|296089545|emb|CBI39364.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 348 bits (893), Expect = 2e-93, Method: Compositional matrix adjust.
Identities = 178/283 (62%), Positives = 207/283 (73%), Gaps = 14/283 (4%)
Query: 1 MNSYFIFAMLQAFDPPLDMSQDMDICEDSHVSHTHYDNQSDG-RNVCSGHSTSSSGRMCC 59
+NS+FIF MLQAF+PPLDMSQD D+CE+ H+ + D+ G RN+C + S+SGR+
Sbjct: 81 VNSFFIFNMLQAFEPPLDMSQDTDMCENPHLENALDDHLDSGERNICPCEAASTSGRISF 140
Query: 60 SKGDHADCNEQSKVVETAKEMTTNEEEETEGPIEYKTASCPGKLENREETNQSCSND--- 116
+ D A +S + + E N+E TE E C N ET+Q+ S+D
Sbjct: 141 PQSDQASYG-KSDITCKSPEGVNNKELGTESCCESGPGICNAYPGNNRETDQAGSSDVKI 199
Query: 117 ---------FTDSNGNASSPACDWLDPSIQLNVPLADVDKVRCIIRNIVRDWAAEGKTER 167
F DSNGN SS +WLDPS QLNVPL DVDKVRCIIRNIVRDWAAEG+ ER
Sbjct: 200 NNDEATPYSFADSNGNVSSSTHEWLDPSFQLNVPLVDVDKVRCIIRNIVRDWAAEGQKER 259
Query: 168 DQCYKPILEELDALFPNRSKESPPACLVPGAGLGRLALEISHLGFISQGNEFSYYMMICS 227
DQCYKPILEELD LFPNRSK+ PP+CLVPGAGLGRLALEIS LGFISQGNEFSYYMMICS
Sbjct: 260 DQCYKPILEELDGLFPNRSKDRPPSCLVPGAGLGRLALEISCLGFISQGNEFSYYMMICS 319
Query: 228 SFILNHTETAGEWNIYPWIHSNCNSLSDSDQLRPVSIPDIHPA 270
SFILN+ +TA EW IYPWIHSNCNSLS++DQLRPVSIPD+HPA
Sbjct: 320 SFILNNAQTAEEWTIYPWIHSNCNSLSENDQLRPVSIPDMHPA 362
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356577478|ref|XP_003556852.1| PREDICTED: uncharacterized protein LOC100791662 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356551269|ref|XP_003543999.1| PREDICTED: UPF0586 protein C9orf41 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449463611|ref|XP_004149525.1| PREDICTED: UPF0586 protein C9orf41 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297822971|ref|XP_002879368.1| hypothetical protein ARALYDRAFT_902264 [Arabidopsis lyrata subsp. lyrata] gi|297325207|gb|EFH55627.1| hypothetical protein ARALYDRAFT_902264 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30685202|ref|NP_850185.1| N2227-like domain-containing protein [Arabidopsis thaliana] gi|20259498|gb|AAM13869.1| unknown protein [Arabidopsis thaliana] gi|22136766|gb|AAM91702.1| unknown protein [Arabidopsis thaliana] gi|330253550|gb|AEC08644.1| N2227-like domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224109542|ref|XP_002333240.1| predicted protein [Populus trichocarpa] gi|222835802|gb|EEE74237.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224137440|ref|XP_002322558.1| predicted protein [Populus trichocarpa] gi|224137448|ref|XP_002322560.1| predicted protein [Populus trichocarpa] gi|222867188|gb|EEF04319.1| predicted protein [Populus trichocarpa] gi|222867190|gb|EEF04321.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|218197084|gb|EEC79511.1| hypothetical protein OsI_20588 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|115464829|ref|NP_001056014.1| Os05g0511300 [Oryza sativa Japonica Group] gi|48475071|gb|AAT44140.1| unknown protein [Oryza sativa Japonica Group] gi|113579565|dbj|BAF17928.1| Os05g0511300 [Oryza sativa Japonica Group] gi|215697939|dbj|BAG92145.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 289 | ||||||
| TAIR|locus:2045542 | 571 | AT2G32170 [Arabidopsis thalian | 0.283 | 0.143 | 0.878 | 1.8e-73 | |
| TAIR|locus:2045547 | 463 | AT2G32160 "AT2G32160" [Arabido | 0.581 | 0.362 | 0.689 | 2.3e-68 | |
| ZFIN|ZDB-GENE-050306-48 | 373 | zgc:112985 "zgc:112985" [Danio | 0.435 | 0.337 | 0.511 | 3.2e-33 | |
| MGI|MGI:1914633 | 400 | 2410127L17Rik "RIKEN cDNA 2410 | 0.435 | 0.315 | 0.464 | 4.9e-30 | |
| ASPGD|ASPL0000056516 | 418 | AN0865 [Emericella nidulans (t | 0.442 | 0.306 | 0.496 | 7.9e-30 | |
| FB|FBgn0023522 | 439 | CG11596 [Drosophila melanogast | 0.460 | 0.302 | 0.432 | 6.4e-28 | |
| DICTYBASE|DDB_G0282239 | 463 | DDB_G0282239 "N2227-like domai | 0.539 | 0.336 | 0.413 | 1.8e-27 | |
| POMBASE|SPBC1778.07 | 373 | SPBC1778.07 "methyltransferase | 0.519 | 0.402 | 0.427 | 2.8e-27 | |
| UNIPROTKB|G4MPS8 | 418 | MGG_09217 "Uncharacterized pro | 0.439 | 0.303 | 0.407 | 7.7e-25 | |
| CGD|CAL0000364 | 395 | orf19.592 [Candida albicans (t | 0.397 | 0.291 | 0.382 | 4.4e-20 |
| TAIR|locus:2045542 AT2G32170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 403 (146.9 bits), Expect = 1.8e-73, Sum P(3) = 1.8e-73
Identities = 72/82 (87%), Positives = 78/82 (95%)
Query: 189 SPPACLVPGAGLGRLALEISHLGFISQGNEFSYYMMICSSFILNHTETAGEWNIYPWIHS 248
+PPACLVPGAGLGRLALEIS LGFISQGNEFSYYMMICSSFILN+T+ GEW IYPWIHS
Sbjct: 352 TPPACLVPGAGLGRLALEISCLGFISQGNEFSYYMMICSSFILNYTQVPGEWTIYPWIHS 411
Query: 249 NCNSLSDSDQLRPVSIPDIHPA 270
NCNSLSD+DQLRP++IPDIHPA
Sbjct: 412 NCNSLSDNDQLRPIAIPDIHPA 433
|
|
| TAIR|locus:2045547 AT2G32160 "AT2G32160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050306-48 zgc:112985 "zgc:112985" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914633 2410127L17Rik "RIKEN cDNA 2410127L17 gene" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000056516 AN0865 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0023522 CG11596 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0282239 DDB_G0282239 "N2227-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC1778.07 SPBC1778.07 "methyltransferase N2227 family" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MPS8 MGG_09217 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000364 orf19.592 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00001792001 | SubName- Full=Chromosome chr18 scaffold_122, whole genome shotgun sequence; (513 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00000534001 | • | • | 0.437 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 289 | |||
| pfam07942 | 268 | pfam07942, N2227, N2227-like protein | 1e-69 |
| >gnl|CDD|219653 pfam07942, N2227, N2227-like protein | Back alignment and domain information |
|---|
Score = 216 bits (551), Expect = 1e-69
Identities = 79/138 (57%), Positives = 101/138 (73%), Gaps = 1/138 (0%)
Query: 134 PSIQLNVPLADVDKVRCIIRNIVRDWAAEGKTERDQCYKPILEELDALFPNRSKE-SPPA 192
P +NV D+ KVR +R IVRDW+AEG+ ERD YKPI+EEL+ LFP+RS + S
Sbjct: 1 PHEPVNVSRGDMSKVRSTLRQIVRDWSAEGQVERDPLYKPIIEELNRLFPSRSHDRSKIR 60
Query: 193 CLVPGAGLGRLALEISHLGFISQGNEFSYYMMICSSFILNHTETAGEWNIYPWIHSNCNS 252
LVPGAGLGRLA E++ LG+ QGNEFSY+M++CS+FILN+ + + IYP+IHS N
Sbjct: 61 ILVPGAGLGRLAYELATLGYQVQGNEFSYFMLLCSNFILNYCKEENQITIYPFIHSFSNQ 120
Query: 253 LSDSDQLRPVSIPDIHPA 270
L+ DQLRPV IPD+HP
Sbjct: 121 LTRDDQLRPVQIPDVHPL 138
|
This family features sequences that are similar to a region of hypothetical yeast gene product N2227. This is thought to be expressed during meiosis and may be involved in the defence response to stressful conditions. Length = 268 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 289 | |||
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 100.0 | |
| KOG2798 | 369 | consensus Putative trehalase [Carbohydrate transpo | 100.0 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 97.8 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 97.78 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 97.71 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 97.66 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 97.09 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 97.09 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 96.8 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 96.51 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 96.38 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 96.09 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 95.92 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 95.87 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 95.71 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 95.65 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.56 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 95.44 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 94.72 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 94.26 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 94.06 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 94.05 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 93.98 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 93.9 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 93.78 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 93.64 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 93.54 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 93.45 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 93.42 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 93.41 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 93.01 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 92.99 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 92.98 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 92.9 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 92.88 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 92.86 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 92.29 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 92.21 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 92.02 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 91.92 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 91.9 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 91.7 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 91.45 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 91.41 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 91.38 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 91.28 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 91.26 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 91.19 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 90.98 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 90.82 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 90.47 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 90.42 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 89.85 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 89.52 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 89.0 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 88.93 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 88.83 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 88.7 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 87.72 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 87.55 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 86.93 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 86.46 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 86.37 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 86.24 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 86.05 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 85.57 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 85.29 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 85.12 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 84.96 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 84.78 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 84.72 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 84.5 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 84.39 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 83.68 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 83.64 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 83.43 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 82.76 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 81.61 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 81.08 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 80.67 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 80.05 |
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.9e-52 Score=382.26 Aligned_cols=136 Identities=54% Similarity=1.039 Sum_probs=128.8
Q ss_pred CCCCCcccCCCCCCchHHHHHHHhhhhhcCCcCChHHHhhhhHHHHHHHHhhCCC-CCCCCCCeEEecCCCchhhHHHHH
Q 023006 130 DWLDPSIQLNVPLADVDKVRCIIRNIVRDWAAEGKTERDQCYKPILEELDALFPN-RSKESPPACLVPGAGLGRLALEIS 208 (289)
Q Consensus 130 ~w~~ps~~~~v~~~D~dKV~stLkq~vRDWS~EG~~ERd~~y~PILe~L~~~fP~-~~~r~~~rVLVPGsGLGRLA~EIA 208 (289)
+|..++. .|++||+++|+||+||||+||+.||+++|+||+++|++++|. ...+++++||||||||||||||||
T Consensus 2 ~~~~~~~------~d~~kV~s~L~q~~RDWS~eg~~ER~~~~~~I~~~L~~~~p~~~~~~~~~~VLVPGsGLGRLa~Eia 75 (270)
T PF07942_consen 2 EWVHPSP------SDMDKVRSTLKQFVRDWSSEGEEERDPCYSPILDELESLFPPAGSDRSKIRVLVPGSGLGRLAWEIA 75 (270)
T ss_pred CcccCch------hhHHHHHHHHHHHHhhCchhhHHHHHHHHHHHHHHHHHhhcccccCCCccEEEEcCCCcchHHHHHh
Confidence 4555554 999999999999999999999999999999999999999995 455789999999999999999999
Q ss_pred hhCCeeeeechhHHHHHHHHHHhhccCCCCceEEeecccccCCcCCccCCccceecCCCCCCC
Q 023006 209 HLGFISQGNEFSYYMMICSSFILNHTETAGEWNIYPWIHSNCNSLSDSDQLRPVSIPDIHPAR 271 (289)
Q Consensus 209 ~~Gf~vqgNEfSy~MLLaS~FILN~~~~~~~~tIyPFihs~SN~~s~edQLR~V~IPDv~P~~ 271 (289)
++||.||||||||+||++|+||||++.+.++++||||+|++||+.++++|||+|+|||+.|..
T Consensus 76 ~~G~~~~gnE~S~~Mll~s~fiLn~~~~~~~~~I~Pf~~~~sn~~~~~dqlr~v~iPDv~p~~ 138 (270)
T PF07942_consen 76 KLGYAVQGNEFSYFMLLASNFILNHCSQPNQFTIYPFVHSFSNQKSREDQLRPVRIPDVDPSS 138 (270)
T ss_pred hccceEEEEEchHHHHHHHHHHHcccCCCCcEEEecceecccCCCCHHHhCCceEeCCcCccc
Confidence 999999999999999999999999999999999999999999999999999999999999976
|
This is thought to be expressed during meiosis and may be involved in the defence response to stressful conditions []. |
| >KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 289 | |||
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 97.79 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 97.72 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 97.34 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 97.06 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 96.97 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 96.85 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 96.74 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 96.74 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 96.68 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 96.53 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 96.48 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 96.47 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 96.46 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 96.37 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 96.34 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 96.19 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 96.15 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 96.14 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 96.13 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 96.13 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 96.08 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 96.06 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 96.02 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 96.01 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.01 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 95.97 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 95.89 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 95.88 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 95.84 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 95.82 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 95.77 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 95.77 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 95.75 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 95.72 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 95.7 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 95.7 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 95.69 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 95.68 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 95.65 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 95.65 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 95.63 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 95.59 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 95.55 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 95.54 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 95.51 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 95.5 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 95.49 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 95.49 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 95.48 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 95.47 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 95.44 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 95.41 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 95.41 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 95.4 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 95.4 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 95.39 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 95.39 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.37 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 95.37 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 95.36 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 95.35 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 95.34 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 95.34 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 95.34 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 95.29 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 95.24 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 95.21 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 95.21 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 95.19 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 95.05 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 94.96 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 94.91 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 94.9 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 94.9 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 94.87 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 94.84 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 94.8 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 94.76 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 94.73 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 94.7 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 94.67 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 94.66 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 94.62 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 94.56 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 94.5 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 94.42 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 94.41 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 94.38 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 94.35 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 94.34 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 94.23 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 94.23 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 94.22 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 94.19 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 94.15 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 94.03 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 94.01 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 93.94 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 93.8 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 93.76 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 93.71 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 93.71 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 93.65 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 93.62 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 93.52 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 93.44 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 93.42 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 93.36 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 93.35 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 93.28 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 93.12 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 92.99 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 92.97 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 92.9 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 92.89 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 92.86 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 92.7 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 92.68 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 92.64 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 92.63 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 92.63 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 92.61 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 92.56 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 92.54 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 92.36 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 92.34 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 92.26 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 92.26 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 92.19 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 92.17 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 92.1 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 91.94 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 91.93 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 91.87 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 91.67 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 91.57 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 91.51 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 91.5 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 91.47 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 91.44 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 91.41 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 91.35 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 91.34 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 91.19 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 91.16 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 91.15 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 91.13 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 91.09 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 91.02 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 90.96 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 90.86 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 90.83 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 90.73 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 90.73 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 90.68 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 90.67 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 90.34 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 90.28 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 90.27 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 90.2 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 89.64 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 89.63 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 89.51 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 89.46 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 89.42 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 89.31 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 89.17 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 89.15 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 89.12 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 88.65 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 88.59 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 88.46 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 87.8 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 87.63 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 87.63 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 87.62 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 87.56 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 87.28 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 86.85 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 86.8 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 86.7 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 86.69 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 86.51 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 86.33 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 86.32 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 86.02 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 85.93 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 85.69 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 85.65 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 85.22 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 85.08 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 85.04 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 85.0 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 84.94 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 84.91 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 84.64 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 84.63 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 84.42 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 84.42 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 84.21 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 84.07 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 84.05 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 83.74 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 83.49 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 83.16 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 83.13 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 83.08 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 82.88 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 82.86 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 82.44 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 81.84 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 81.52 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 80.95 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 80.88 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 80.62 |
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
Probab=97.79 E-value=1.1e-05 Score=67.79 Aligned_cols=40 Identities=23% Similarity=0.122 Sum_probs=36.3
Q ss_pred CCCeEEecCCCchhhHHHHHhhCCeeeeechhHHHHHHHH
Q 023006 189 SPPACLVPGAGLGRLALEISHLGFISQGNEFSYYMMICSS 228 (289)
Q Consensus 189 ~~~rVLVPGsGLGRLA~EIA~~Gf~vqgNEfSy~MLLaS~ 228 (289)
...+||.+|||.|+++..||++|+.|.|.|+|--|+-..+
T Consensus 22 ~~~~vLD~GCG~G~~~~~la~~g~~V~gvD~S~~~l~~a~ 61 (203)
T 1pjz_A 22 PGARVLVPLCGKSQDMSWLSGQGYHVVGAELSEAAVERYF 61 (203)
T ss_dssp TTCEEEETTTCCSHHHHHHHHHCCEEEEEEECHHHHHHHH
T ss_pred CCCEEEEeCCCCcHhHHHHHHCCCeEEEEeCCHHHHHHHH
Confidence 4568999999999999999999999999999999987554
|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 289 | |||
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 98.62 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 98.34 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 97.89 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 97.74 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 97.66 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 97.29 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 97.21 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 96.27 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 95.98 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 95.74 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 95.65 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 95.43 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 95.28 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 95.15 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 95.1 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 94.92 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 94.89 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 94.83 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 94.79 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 94.57 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 94.49 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 94.36 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 94.19 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 93.58 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 93.56 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 93.27 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 93.27 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 92.49 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 92.24 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 91.9 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 91.32 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 91.12 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 90.7 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 90.51 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 90.08 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 89.8 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 88.97 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 88.12 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 88.0 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 87.95 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 86.93 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 86.89 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 85.98 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 85.41 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 84.5 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 83.99 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 83.39 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 82.8 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 82.75 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 82.62 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 82.33 |
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Thiopurine S-methyltransferase domain: Thiopurine S-methyltransferase species: Pseudomonas syringae [TaxId: 317]
Probab=98.62 E-value=9.7e-09 Score=80.67 Aligned_cols=59 Identities=19% Similarity=0.045 Sum_probs=47.1
Q ss_pred hHHHHHHHHhhCCCCCCCCCCeEEecCCCchhhHHHHHhhCCeeeeechhHHHHHHHHHHhhc
Q 023006 171 YKPILEELDALFPNRSKESPPACLVPGAGLGRLALEISHLGFISQGNEFSYYMMICSSFILNH 233 (289)
Q Consensus 171 y~PILe~L~~~fP~~~~r~~~rVLVPGsGLGRLA~EIA~~Gf~vqgNEfSy~MLLaS~FILN~ 233 (289)
-+++.+.+..+-+ .+..+||.+|||.||++..||++||.|+|.|.|--|+-..+--.+.
T Consensus 6 ~~~~~~~~~~l~~----~~~~rvLd~GCG~G~~a~~la~~G~~V~gvD~S~~~i~~a~~~~~~ 64 (201)
T d1pjza_ 6 NKDLQQYWSSLNV----VPGARVLVPLCGKSQDMSWLSGQGYHVVGAELSEAAVERYFTERGE 64 (201)
T ss_dssp THHHHHHHHHHCC----CTTCEEEETTTCCSHHHHHHHHHCCEEEEEEECHHHHHHHHHHHCS
T ss_pred HHHHHHHHHHcCC----CCCCEEEEecCcCCHHHHHHHHcCCceEeecccHHHHHHHHHHhcc
Confidence 3445555555422 2566999999999999999999999999999999999888766553
|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|