Citrus Sinensis ID: 023079


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFLR
cccHHHcccccEEEccHHHHHHHcccccEEEEEEcccEEEEcHHHHHHHHHHHHHHcccEEEcccEEEEEEEEccEEEEEEcccccccccccccccccccEEEccEEEEcccccHHHHHHHHcccccccccccccccccEEEEcccccccccccEEccccccccEEEEEccccccEEEcccEEccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccEEccccccccccEEEcccccccccEEEEEccccHHHHccHHHHHHHHHHHHc
cHHHHHccccccEEccHHHHHHHcccccEHHEEEccccccccHHHHHHHHHHHHHHcccEEEEEcEEEEEEEccccEEEEEccccccccccEEEccccccEEEEEEEEEcccccHHHHHHHHccccccccccHHEEcccEEEEcccccccccEEEcccccccccEEEEEcccccEEEEcccEEEEccccccHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccHEEEEcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHc
mkrgtangvhglrmlegfeamkmEPELQCVKALlspasgivdsHSLMLSLVGeaenhgttfsnntsvigghlegNCMNVYISesknlrnwdgvsplqpeltlipklvvnsaglsaPALAKRFigldnvfippayyargcyfslantkvapfkhliypipedgglgvhvtldldgqikfgpdvewidgidDTLSFLNRfdysvnanraerfYPEIRkyypdlrdgslqpsyagirpklsgprqspidfviqgddthgvpglvnlfgiespgltsSMAIAEYVAAKFLR
mkrgtangvhglrMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDysvnanraerfypEIRKYYPDLRDGSLQPSYAgirpklsgprQSPIDFVIQGDDTHGVPGLVNLFGiespgltssMAIAEYVAAKFLR
MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFLR
***********LRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDG********************IDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAK***
MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFLR
MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFLR
MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFLR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query287 2.2.26 [Sep-21-2011]
Q91YP0464 L-2-hydroxyglutarate dehy yes no 0.933 0.577 0.264 6e-11
Q5R9N7419 L-2-hydroxyglutarate dehy yes no 0.578 0.396 0.291 7e-09
P37339422 L-2-hydroxyglutarate oxid N/A no 0.885 0.601 0.260 9e-09
A7MBI3463 L-2-hydroxyglutarate dehy yes no 0.937 0.580 0.255 1e-08
Q9H9P8463 L-2-hydroxyglutarate dehy yes no 0.585 0.362 0.288 1e-07
A7SMW7456 L-2-hydroxyglutarate dehy N/A no 0.944 0.594 0.252 3e-07
Q9N4Z0433 L-2-hydroxyglutarate dehy no no 0.905 0.600 0.233 3e-05
P75063384 Uncharacterized protein M yes no 0.853 0.638 0.259 5e-05
P47285384 Uncharacterized protein M yes no 0.547 0.408 0.291 7e-05
A8X2R1434 L-2-hydroxyglutarate dehy N/A no 0.926 0.612 0.208 0.0003
>sp|Q91YP0|L2HDH_MOUSE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=L2hgdh PE=2 SV=1 Back     alignment and function desciption
 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 136/314 (43%), Gaps = 46/314 (14%)

Query: 2   KRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTF 61
           +RG  NGV GLR+++  +  K EP  + + A+  P +GIV+   + LS   + +  G + 
Sbjct: 155 ERGLQNGVEGLRLIQQEDIKKKEPYCRGLMAIDCPYTGIVNYQQVALSFAQDFQEAGGSI 214

Query: 62  SNNTSVIGGHLEGNCMNVYISESKNLRNWDGVS-PLQPELT----LIPKLVVNSAGLSAP 116
             +  V G         + I++  + R+ DG++ P+  + +    +  + VV  AGL + 
Sbjct: 215 LRDFEVKG---------IEIAKENSSRSKDGMNYPIAVKNSKGKEIRCRYVVTCAGLYSD 265

Query: 117 ALAK-RFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDG--GLGVHVTLDLD 173
            +++      D   +P     RG Y  L   K    K  IYP+P+     LGVH T  LD
Sbjct: 266 RISELSGCNPDPQIVP----FRGDYLVLKPEKGYLVKGNIYPVPDSRFPFLGVHFTPRLD 321

Query: 174 GQIKFGP--------------DVEWIDGIDDTLS--FLN----RFDYSVNANRAERFYPE 213
           G I  GP              D +  D ++  L   F+N     F Y VN      F  E
Sbjct: 322 GTIWLGPNAVLAFKREGYRPFDFDARDVMEVILKSGFINLVFQHFSYGVNEMYKACFLSE 381

Query: 214 ----IRKYYPDLRDGSLQPSYAGIRPK-LSGPRQSPIDFVIQGDDTHGVPGLVNLFGIES 268
               ++K+ P++    +    AG+R + L        DFV  G        ++++    S
Sbjct: 382 TVKHLQKFIPEITISDVLRGPAGVRAQALDRDGNLVEDFVFDGGTGEIADRVLHVRNAPS 441

Query: 269 PGLTSSMAIAEYVA 282
           P  TSS+AI+  +A
Sbjct: 442 PAATSSLAISRMIA 455





Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 2
>sp|Q5R9N7|L2HDH_PONAB L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=L2HGDH PE=2 SV=1 Back     alignment and function description
>sp|P37339|LHGO_ECOLI L-2-hydroxyglutarate oxidase LhgO OS=Escherichia coli (strain K12) GN=lhgO PE=1 SV=3 Back     alignment and function description
>sp|A7MBI3|L2HDH_BOVIN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=L2HGDH PE=2 SV=1 Back     alignment and function description
>sp|Q9H9P8|L2HDH_HUMAN L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=L2HGDH PE=1 SV=3 Back     alignment and function description
>sp|A7SMW7|L2HDH_NEMVE L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Nematostella vectensis GN=v1g172254 PE=3 SV=1 Back     alignment and function description
>sp|Q9N4Z0|L2HDH_CAEEL L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=Y45G12B.3 PE=3 SV=2 Back     alignment and function description
>sp|P75063|Y051_MYCPN Uncharacterized protein MG039 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_051 PE=4 SV=1 Back     alignment and function description
>sp|P47285|Y039_MYCGE Uncharacterized protein MG039 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG039 PE=4 SV=1 Back     alignment and function description
>sp|A8X2R1|L2HDH_CAEBR L-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Caenorhabditis briggsae GN=CBG06643 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
224089869 430 predicted protein [Populus trichocarpa] 1.0 0.667 0.795 1e-135
225440270 424 PREDICTED: l-2-hydroxyglutarate dehydrog 1.0 0.676 0.773 1e-129
357497233 483 L-2-hydroxyglutarate dehydrogenase [Medi 0.996 0.592 0.700 1e-127
255572899 417 NAD dehydrogenase, putative [Ricinus com 0.979 0.673 0.729 1e-123
356514080 410 PREDICTED: l-2-hydroxyglutarate dehydrog 0.986 0.690 0.727 1e-123
388493312 418 unknown [Lotus japonicus] 0.996 0.684 0.720 1e-122
188509918 423 putative oxidoreductase protein [Gossypi 0.989 0.671 0.738 1e-119
133902300 423 putative FAD-dependent oxidoreductase [G 0.989 0.671 0.738 1e-119
133902322 423 putative FAD-dependent oxidoreductase [G 0.989 0.671 0.738 1e-119
133902307 423 putative FAD-dependent oxidoreductase [G 0.989 0.671 0.735 1e-118
>gi|224089869|ref|XP_002308844.1| predicted protein [Populus trichocarpa] gi|222854820|gb|EEE92367.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/288 (79%), Positives = 262/288 (90%), Gaps = 1/288 (0%)

Query: 1   MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTT 60
           M RGT NGV  L+MLEGFEAMKMEPELQC KALLSP SGIVDSHSLMLSLVGEAEN+GTT
Sbjct: 143 MDRGTQNGVDNLKMLEGFEAMKMEPELQCKKALLSPVSGIVDSHSLMLSLVGEAENNGTT 202

Query: 61  FSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAK 120
           FS N++VI GHLEGNC+++YI ESK+L NW+G  PL PEL L+PKLVVNSAGLS+ ALAK
Sbjct: 203 FSYNSTVISGHLEGNCLHLYIVESKDLENWNGDYPLHPELVLVPKLVVNSAGLSSLALAK 262

Query: 121 RFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGP 180
           RF GLDN  IPP ++ARGCYF+L++TKV PF+HLIYPIPEDGGLGVHVTLDLDG +KFGP
Sbjct: 263 RFHGLDNGIIPPGFFARGCYFTLSSTKVPPFEHLIYPIPEDGGLGVHVTLDLDGHLKFGP 322

Query: 181 DVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGP 240
           DVEWIDGIDD  SFLN++DYSV+A+RAERFYPEIRKYYP+L+DGSLQP Y+GIRPK+SGP
Sbjct: 323 DVEWIDGIDDVSSFLNKYDYSVSASRAERFYPEIRKYYPNLKDGSLQPGYSGIRPKISGP 382

Query: 241 RQSPIDFVI-QGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFLR 287
           RQSPIDFVI QG+D HGVPGLVNLFGIESPGLT+SMAIAE++A++FL+
Sbjct: 383 RQSPIDFVIQQGEDIHGVPGLVNLFGIESPGLTASMAIAEHIASRFLK 430




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225440270|ref|XP_002278843.1| PREDICTED: l-2-hydroxyglutarate dehydrogenase, mitochondrial [Vitis vinifera] gi|297741744|emb|CBI32876.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357497233|ref|XP_003618905.1| L-2-hydroxyglutarate dehydrogenase [Medicago truncatula] gi|355493920|gb|AES75123.1| L-2-hydroxyglutarate dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255572899|ref|XP_002527381.1| NAD dehydrogenase, putative [Ricinus communis] gi|223533252|gb|EEF35006.1| NAD dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356514080|ref|XP_003525735.1| PREDICTED: l-2-hydroxyglutarate dehydrogenase, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|388493312|gb|AFK34722.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|188509918|gb|ACD56607.1| putative oxidoreductase protein [Gossypioides kirkii] Back     alignment and taxonomy information
>gi|133902300|gb|ABO41831.1| putative FAD-dependent oxidoreductase [Gossypium raimondii] Back     alignment and taxonomy information
>gi|133902322|gb|ABO41850.1| putative FAD-dependent oxidoreductase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|133902307|gb|ABO41837.1| putative FAD-dependent oxidoreductase [Gossypium arboreum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query287
TAIR|locus:2103660483 AT3G56840 [Arabidopsis thalian 0.989 0.587 0.636 6.4e-99
CGD|CAL0000481400 orf19.6238 [Candida albicans ( 0.843 0.605 0.350 2e-31
UNIPROTKB|Q5AB11400 CaO19.6238 "Potential FAD-depe 0.843 0.605 0.350 2e-31
FB|FBgn0032729455 CG10639 [Drosophila melanogast 0.933 0.589 0.299 5e-13
UNIPROTKB|F1SHX9463 L2HGDH "Uncharacterized protei 0.581 0.360 0.292 4.8e-08
DICTYBASE|DDB_G0267656446 l2hgdh "L-2-hydroxyglutarate d 0.585 0.376 0.281 5.9e-08
UNIPROTKB|A7MBI3463 L2HGDH "L-2-hydroxyglutarate d 0.581 0.360 0.292 6e-08
UNIPROTKB|Q9KN19403 VC_A0147 "Transcriptional regu 0.522 0.372 0.304 6.6e-08
TIGR_CMR|VC_A0147403 VC_A0147 "transcriptional regu 0.522 0.372 0.304 6.6e-08
RGD|1306250463 L2hgdh "L-2-hydroxyglutarate d 0.581 0.360 0.281 8.4e-08
TAIR|locus:2103660 AT3G56840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 982 (350.7 bits), Expect = 6.4e-99, P = 6.4e-99
 Identities = 194/305 (63%), Positives = 236/305 (77%)

Query:     1 MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLV--------- 51
             M  GT N V GLRMLEGFEAM+MEP+L+CVKALLSP SGI+D+HS MLSLV         
Sbjct:   182 MHLGTQNRVSGLRMLEGFEAMRMEPQLRCVKALLSPESGILDTHSFMLSLVEKSFDFMVY 241

Query:    52 ---------GEAENHGTTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTL 102
                      GEA+N+  TFS NT V+ G +E   M++Y++++   R  +     + +L L
Sbjct:   242 RDNNNLRLQGEAQNNHATFSYNTVVLNGRVEEKKMHLYVADT---RFSESRCEAEAQLEL 298

Query:   103 IPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDG 162
             IP LVVNSAGL A ALAKR  GLD+ F+P ++YARGCYF+L+  K  PF  L+YPIPE+G
Sbjct:   299 IPNLVVNSAGLGAQALAKRLHGLDHRFVPSSHYARGCYFTLSGIKAPPFNKLVYPIPEEG 358

Query:   163 GLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLR 222
             GLGVHVT+DL+G +KFGPDVEWI+  DDT SFLN+FDY VN  R+E+FYPEIRKYYPDL+
Sbjct:   359 GLGVHVTVDLNGLVKFGPDVEWIECTDDTSSFLNKFDYRVNPQRSEKFYPEIRKYYPDLK 418

Query:   223 DGSLQPSYAGIRPKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVA 282
             DGSL+P Y+GIRPKLSGP+QSP DFVIQG++THGVPGLVNLFGIESPGLTSS+AIAE++A
Sbjct:   419 DGSLEPGYSGIRPKLSGPKQSPADFVIQGEETHGVPGLVNLFGIESPGLTSSLAIAEHIA 478

Query:   283 AKFLR 287
              KFLR
Sbjct:   479 NKFLR 483




GO:0005739 "mitochondrion" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
CGD|CAL0000481 orf19.6238 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AB11 CaO19.6238 "Potential FAD-dependent oxidoreductase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
FB|FBgn0032729 CG10639 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHX9 L2HGDH "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267656 l2hgdh "L-2-hydroxyglutarate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBI3 L2HGDH "L-2-hydroxyglutarate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KN19 VC_A0147 "Transcriptional regulator, putative" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0147 VC_A0147 "transcriptional regulator, putative" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
RGD|1306250 L2hgdh "L-2-hydroxyglutarate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VI.2345.1
hypothetical protein (392 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.2059.13.1
annotation not avaliable (156 aa)
       0.621
fgenesh4_pm.C_scaffold_44000008
glycerol kinase (EC-2.7.1.30) (519 aa)
       0.563
gw1.2233.1.1
Predicted protein (347 aa)
       0.416

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 4e-56
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 5e-26
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 1e-08
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 9e-06
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
 Score =  186 bits (474), Expect = 4e-56
 Identities = 99/290 (34%), Positives = 135/290 (46%), Gaps = 32/290 (11%)

Query: 1   MKRGTANGVHGLRMLEGFEAMKMEPELQ--CVKALLSPASGIVDSHSLMLSLVGEAENHG 58
            +RG ANGV  L +L+  E  ++EP L    V ALL P+ GIVD   L  +L  EA+ +G
Sbjct: 108 YERGKANGVFDLEILDKEEIKELEPLLNEGAVAALLVPSGGIVDPGELTRALAEEAQANG 167

Query: 59  TTFSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPAL 118
                NT V G   + +   V++  + N            E TL  K V+N+AGL A  L
Sbjct: 168 VELRLNTEVTGIEKQSD--GVFVLNTSN-----------GEETLEAKFVINAAGLYADPL 214

Query: 119 AKRFIGLDNVF-IPPAYYARGCYFSLANTKVAPFKHLIYPIPEDG--GLGVHVTLDLDGQ 175
           A+   G+   F I P    RG Y  L N   A  +H IYP+P  G  GLGVH T  +DG 
Sbjct: 215 AQM-AGIPEDFKIFP---VRGEYLVLDNEVKALLRHKIYPVPNPGLPGLGVHHTPTIDGS 270

Query: 176 IKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDL-RDGSLQPSYAGIR 234
           + FGP+               + D  V+ +  +       +  PDL    ++  +YAGIR
Sbjct: 271 LLFGPNALDS-------PKFLKGDRGVDFDLLDSVRKANSRGMPDLGIKNNVLANYAGIR 323

Query: 235 PKLSGPRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAK 284
           P L  PR   +DF+I           +N+ GI S GLT+  AIA  V   
Sbjct: 324 PILKEPRLPALDFIIPEA--KDEDWFINVAGIRSQGLTADPAIAGGVLEL 371


Length = 429

>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 287
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 100.0
PRK11728393 hydroxyglutarate oxidase; Provisional 100.0
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 100.0
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 100.0
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 100.0
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.98
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.97
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.97
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 99.97
COG0579429 Predicted dehydrogenase [General function predicti 99.97
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 99.97
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.97
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.97
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 99.97
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 99.96
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 99.96
PLN02464 627 glycerol-3-phosphate dehydrogenase 99.96
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 99.96
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.95
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 99.95
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.95
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.95
KOG2853509 consensus Possible oxidoreductase [General functio 99.93
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.93
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.93
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.92
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 99.91
PRK05257494 malate:quinone oxidoreductase; Validated 99.91
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 99.88
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 99.71
KOG2852380 consensus Possible oxidoreductase [General functio 99.56
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.56
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.64
PLN02697 529 lycopene epsilon cyclase 98.35
PRK10157428 putative oxidoreductase FixC; Provisional 98.3
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.29
PRK06185407 hypothetical protein; Provisional 98.29
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.29
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.29
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.23
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.21
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.15
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.14
PLN02463 447 lycopene beta cyclase 98.03
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.99
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.96
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.93
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.92
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.92
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 97.91
PRK06847375 hypothetical protein; Provisional 97.87
PRK10015429 oxidoreductase; Provisional 97.78
COG2081408 Predicted flavoproteins [General function predicti 97.75
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.7
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.69
PLN02612567 phytoene desaturase 97.68
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.66
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.65
PRK07233434 hypothetical protein; Provisional 97.63
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.61
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.57
PRK08244 493 hypothetical protein; Provisional 97.55
PRK09126392 hypothetical protein; Provisional 97.47
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.46
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 97.42
TIGR00275400 flavoprotein, HI0933 family. The model when search 97.42
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 97.39
PRK06834 488 hypothetical protein; Provisional 97.22
PRK06996398 hypothetical protein; Provisional 97.11
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.1
PRK08163396 salicylate hydroxylase; Provisional 97.03
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.02
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 96.9
PRK08132 547 FAD-dependent oxidoreductase; Provisional 96.89
PRK06481506 fumarate reductase flavoprotein subunit; Validated 96.86
PRK08013400 oxidoreductase; Provisional 96.84
PRK11445351 putative oxidoreductase; Provisional 96.83
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.83
PRK06126 545 hypothetical protein; Provisional 96.79
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 96.73
COG1233487 Phytoene dehydrogenase and related proteins [Secon 96.72
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 96.71
PLN02487569 zeta-carotene desaturase 96.7
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.69
PRK08274 466 tricarballylate dehydrogenase; Validated 96.64
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.63
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.55
PRK06184 502 hypothetical protein; Provisional 96.54
PRK07588391 hypothetical protein; Provisional 96.5
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.48
PRK07121492 hypothetical protein; Validated 96.45
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.45
PRK07190 487 hypothetical protein; Provisional 96.43
PRK12839 572 hypothetical protein; Provisional 96.4
PRK07045388 putative monooxygenase; Reviewed 96.36
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.35
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.31
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 96.31
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 96.26
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 96.23
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.2
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 96.18
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 96.15
PRK12842 574 putative succinate dehydrogenase; Reviewed 96.11
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 96.09
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.05
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 95.94
PRK09897 534 hypothetical protein; Provisional 95.9
PRK08401 466 L-aspartate oxidase; Provisional 95.87
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.83
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 95.82
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.82
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 95.76
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 95.73
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 95.72
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 95.71
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 95.71
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.71
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 95.69
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 95.68
PRK14727479 putative mercuric reductase; Provisional 95.62
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 95.58
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 95.57
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 95.54
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.54
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 95.53
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 95.53
PRK06175433 L-aspartate oxidase; Provisional 95.51
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 95.51
PRK08071 510 L-aspartate oxidase; Provisional 95.43
PRK09564444 coenzyme A disulfide reductase; Reviewed 95.43
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 95.42
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 95.41
PRK07512 513 L-aspartate oxidase; Provisional 95.41
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 95.4
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.36
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.26
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 95.25
PF01134392 GIDA: Glucose inhibited division protein A; InterP 95.25
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 95.25
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 95.21
PRK14694468 putative mercuric reductase; Provisional 95.18
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 95.15
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 95.14
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 95.12
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 95.02
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 95.01
PRK06116450 glutathione reductase; Validated 94.96
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 94.94
PLN02676487 polyamine oxidase 94.94
PRK06475400 salicylate hydroxylase; Provisional 94.93
PRK12416463 protoporphyrinogen oxidase; Provisional 94.92
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 94.92
PRK07804 541 L-aspartate oxidase; Provisional 94.91
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.91
PRK05868372 hypothetical protein; Validated 94.91
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 94.88
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 94.88
PRK08275 554 putative oxidoreductase; Provisional 94.86
PRK13977 576 myosin-cross-reactive antigen; Provisional 94.8
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 94.76
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 94.69
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 94.64
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 94.61
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 94.57
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 94.55
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 94.52
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 94.51
PRK06753373 hypothetical protein; Provisional 94.5
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 94.46
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 94.43
PRK11883451 protoporphyrinogen oxidase; Reviewed 94.34
PRK13748561 putative mercuric reductase; Provisional 94.33
PLN02268435 probable polyamine oxidase 94.31
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 94.29
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 94.27
KOG0404322 consensus Thioredoxin reductase [Posttranslational 94.22
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 94.17
PRK10262321 thioredoxin reductase; Provisional 94.17
PLN02507499 glutathione reductase 94.14
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 94.02
PRK07538413 hypothetical protein; Provisional 93.97
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 93.95
PRK07236386 hypothetical protein; Provisional 93.89
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 93.78
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 93.69
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 93.69
PRK07845466 flavoprotein disulfide reductase; Reviewed 93.56
PRK07208479 hypothetical protein; Provisional 93.48
PLN02985 514 squalene monooxygenase 93.39
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 93.37
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 93.33
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 93.27
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 93.16
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 93.07
PRK06327475 dihydrolipoamide dehydrogenase; Validated 92.91
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 92.89
PLN02568539 polyamine oxidase 92.78
TIGR02053463 MerA mercuric reductase. This model represents the 92.76
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 92.73
PLN02661357 Putative thiazole synthesis 92.73
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 92.66
PRK09564 444 coenzyme A disulfide reductase; Reviewed 92.65
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 92.63
PRK06370463 mercuric reductase; Validated 92.62
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 92.61
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 92.36
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 92.29
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 92.29
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 92.24
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 92.22
PRK09077 536 L-aspartate oxidase; Provisional 92.22
PRK07395 553 L-aspartate oxidase; Provisional 92.2
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 92.08
PTZ00052499 thioredoxin reductase; Provisional 92.07
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 92.06
PLN02815 594 L-aspartate oxidase 91.84
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 91.81
PTZ00318424 NADH dehydrogenase-like protein; Provisional 91.62
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 91.6
PRK13512 438 coenzyme A disulfide reductase; Provisional 91.55
PRK05976472 dihydrolipoamide dehydrogenase; Validated 91.49
PRK07846451 mycothione reductase; Reviewed 91.09
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 91.06
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 90.89
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 90.87
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 90.86
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 90.8
COG1231450 Monoamine oxidase [Amino acid transport and metabo 90.78
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 90.71
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 90.64
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 90.57
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 90.38
PLN02529 738 lysine-specific histone demethylase 1 90.36
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 90.14
PLN03000 881 amine oxidase 89.9
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 89.89
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 89.88
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 89.18
PTZ00058561 glutathione reductase; Provisional 88.91
PLN02576496 protoporphyrinogen oxidase 88.77
PRK14989 847 nitrite reductase subunit NirD; Provisional 88.7
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 88.35
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 87.97
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 87.94
PRK14989 847 nitrite reductase subunit NirD; Provisional 87.58
PLN02546558 glutathione reductase 87.32
PRK07845 466 flavoprotein disulfide reductase; Reviewed 87.32
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 86.89
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 86.49
PRK13512438 coenzyme A disulfide reductase; Provisional 86.49
PRK02106 560 choline dehydrogenase; Validated 86.04
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 85.87
PRK10262321 thioredoxin reductase; Provisional 85.86
PLN02328 808 lysine-specific histone demethylase 1 homolog 85.74
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 85.63
PRK08294 634 phenol 2-monooxygenase; Provisional 85.36
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 84.95
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 84.53
PRK06292460 dihydrolipoamide dehydrogenase; Validated 84.01
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 83.62
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 83.45
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 83.09
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 82.59
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 82.49
PLN02976 1713 amine oxidase 82.4
TIGR01424 446 gluta_reduc_2 glutathione-disulfide reductase, pla 81.97
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 81.63
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 81.47
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 81.24
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 81.15
PTZ00153659 lipoamide dehydrogenase; Provisional 80.61
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 80.42
PLN02507 499 glutathione reductase 80.38
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
Probab=100.00  E-value=6.9e-34  Score=257.88  Aligned_cols=237  Identities=22%  Similarity=0.263  Sum_probs=194.7

Q ss_pred             cchhcCCCeeeeeCHHHHHhhCCCcc--cceeEEcCCceeecHHHHHHHHHHHHHHCCcEEEcCceeEEEEEeCCeE-EE
Q 023079            3 RGTANGVHGLRMLEGFEAMKMEPELQ--CVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCM-NV   79 (287)
Q Consensus         3 ~~~~~g~~~~~~L~~~ei~~~~P~l~--~~~al~~p~~g~vdp~~l~~~l~~~a~~~Gv~~~~~~~V~~i~~~~~~~-~V   79 (287)
                      ..+..|++ +++|+++|+++++|.++  ..+|+|.|.+|++||.+++.+|++.|+++|++++++++|+++..++++| .|
T Consensus        95 ~~~~~~~~-~~~l~~~e~~~~~p~l~~~~~~g~~~~~~g~v~p~~l~~~l~~~~~~~g~~~~~~~~v~~i~~~~~~~~~v  173 (337)
T TIGR02352        95 LQSATGME-VEWLSGRALRRLEPYLSGGIRGAVFYPDDAHVDPRALLKALEKALEKLGVEIIEHTEVQHIEIRGEKVTAI  173 (337)
T ss_pred             HHHhcCCc-eEEcCHHHHHHhCCCCCcccceEEEcCCCceEChHHHHHHHHHHHHHcCCEEEccceEEEEEeeCCEEEEE
Confidence            35667886 99999999999999985  6799999999999999999999999999999999999999999887776 48


Q ss_pred             EecCCcccccCCCCCCCCCceeEecCEEEEcCCCCchHHHHHhCCCCCcccCCccccceEEEEEcCCCCCCCCceeeeCC
Q 023079           80 YISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIP  159 (287)
Q Consensus        80 ~t~~g~~~~~~~~~~~~~~~~~i~a~~VV~aaG~~s~~l~~~~~~~~~~~~p~~~~~~g~~~~~~~~~~~~~~~~i~~~~  159 (287)
                      .|.+|                .++||+||+|+|+|+..|.+      .++.|    .+|+++.+...........+....
T Consensus       174 ~~~~g----------------~~~a~~vV~a~G~~~~~l~~------~~~~~----~~g~~~~~~~~~~~~~~~~~~~~~  227 (337)
T TIGR02352       174 VTPSG----------------DVQADQVVLAAGAWAGELLP------LPLRP----VRGQPLRLEAPAVPLLNRPLRAVV  227 (337)
T ss_pred             EcCCC----------------EEECCEEEEcCChhhhhccc------CCccc----cCceEEEeeccccccCCcccceEE
Confidence            88888                89999999999999999864      34456    889998886541111111110000


Q ss_pred             CCCCceeEEeeecCCcEEECCCccccCCcccccccccccccCCChhhHHHHHHHHhhhCCCCCCCCcccccccccceecC
Q 023079          160 EDGGLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSG  239 (287)
Q Consensus       160 ~~~~~~~~~~~~~~g~l~iG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~~i~~~~~G~r~~~~~  239 (287)
                        ...+.|++|..+|++++|++.+..           ..+...+++.++.+++.+.++||.+++.++.+.|+|+||+   
T Consensus       228 --~~~~~y~~p~~~g~~~iG~~~~~~-----------~~~~~~~~~~~~~l~~~~~~~~P~l~~~~~~~~~~g~r~~---  291 (337)
T TIGR02352       228 --YGRRVYIVPRRDGRLVVGATMEES-----------GFDTTPTLGGIKELLRDAYTILPALKEARLLETWAGLRPG---  291 (337)
T ss_pred             --EcCCEEEEEcCCCeEEEEEecccc-----------CccCCCCHHHHHHHHHHHHHhCCCcccCcHHHheecCCCC---
Confidence              123478899888899999776532           2344456788999999999999999999999999999999   


Q ss_pred             CCCCCCCeEEecCCCCCCCCeEEEeCCCCchhhhhHHHHHHHHHHHh
Q 023079          240 PRQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFL  286 (287)
Q Consensus       240 ~~~~~~~~~i~~~~~~~~~~l~~~~G~~g~G~t~ap~~g~~va~~i~  286 (287)
                        ++|..|+||..+  ..+|+|+++|++|+|++++|++|+.+|++|+
T Consensus       292 --t~D~~piig~~~--~~~~~~~~~g~~g~G~~~~p~~g~~la~~i~  334 (337)
T TIGR02352       292 --TPDNLPYIGEHP--EDRRLLIATGHYRNGILLAPATAEVIADLIL  334 (337)
T ss_pred             --CCCCCCEeCccC--CCCCEEEEcccccCceehhhHHHHHHHHHHh
Confidence              456788999987  5789999999999999999999999999986



This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as E. coli that instead use tyrosine and the ThiH protein.

>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
3dme_A369 Crystal Structure Of Conserved Exported Protein Fro 6e-67
>pdb|3DME|A Chain A, Crystal Structure Of Conserved Exported Protein From Bordetella Pertussis. Northeast Structural Genomics Target Ber141 Length = 369 Back     alignment and structure

Iteration: 1

Score = 250 bits (638), Expect = 6e-67, Method: Compositional matrix adjust. Identities = 132/284 (46%), Positives = 177/284 (62%), Gaps = 24/284 (8%) Query: 2 KRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTF 61 +R ANGV L+ ++G A ++EP L C AL+SP++GIVDSH+LML+ G+AE+ G Sbjct: 108 RRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQL 167 Query: 62 SNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKR 121 +T +I G + E ++ G P+ TL ++++N+AGL AP LA+R Sbjct: 168 VFHTPLIAGRVR--------PEGGFELDFGGAEPM----TLSCRVLINAAGLHAPGLARR 215 Query: 122 FIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGPD 181 G+ IPP Y +G YF+LA APF LIYP+P+ GLGVH+TLDL GQ KFGPD Sbjct: 216 IEGIPRDSIPPEYLCKGSYFTLAGR--APFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPD 273 Query: 182 VEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPR 241 EWI DY+++ RA+ FY +R Y+P L DG+L P Y GIRPK+SGP Sbjct: 274 TEWI----------ATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPH 323 Query: 242 QSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKF 285 + DF I G +HGV GLVNL+GIESPGLT+S+AIAE A+ Sbjct: 324 EPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARL 367

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query287
3dme_A369 Conserved exported protein; structural genomics, P 1e-121
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 2e-09
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 4e-07
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 9e-07
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 5e-06
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 7e-05
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 6e-04
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
 Score =  350 bits (901), Expect = e-121
 Identities = 129/284 (45%), Positives = 172/284 (60%), Gaps = 24/284 (8%)

Query: 1   MKRGTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTT 60
            +R  ANGV  L+ ++G  A ++EP L C  AL+SP++GIVDSH+LML+  G+AE+ G  
Sbjct: 107 ARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQ 166

Query: 61  FSNNTSVIGGHLEGNCMNVYISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAK 120
              +T +I G +                           +TL  ++++N+AGL AP LA+
Sbjct: 167 LVFHTPLIAGRVRPEGGFELDFGGAE------------PMTLSCRVLINAAGLHAPGLAR 214

Query: 121 RFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGLGVHVTLDLDGQIKFGP 180
           R  G+    IPP Y  +G YF+LA    APF  LIYP+P+  GLGVH+TLDL GQ KFGP
Sbjct: 215 RIEGIPRDSIPPEYLCKGSYFTLA--GRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGP 272

Query: 181 DVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGP 240
           D EWI   D          Y+++  RA+ FY  +R Y+P L DG+L P Y GIRPK+SGP
Sbjct: 273 DTEWIATED----------YTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGP 322

Query: 241 RQSPIDFVIQGDDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAK 284
            +   DF I G  +HGV GLVNL+GIESPGLT+S+AIAE   A+
Sbjct: 323 HEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLAR 366


>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
3dme_A369 Conserved exported protein; structural genomics, P 100.0
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 100.0
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.98
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.97
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.97
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.96
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.96
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.96
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.96
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.95
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.95
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.95
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.95
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 99.95
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.94
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 99.94
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 99.94
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.93
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 99.92
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.01
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.77
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.73
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 98.63
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.47
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.37
3atr_A 453 Conserved archaeal protein; saturating double bond 98.3
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.28
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.26
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.2
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.18
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.12
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.09
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.07
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.02
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.93
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 97.92
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.9
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.89
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.88
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.81
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.81
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.73
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.72
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.71
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.58
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.57
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.52
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.52
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 97.48
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.46
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.44
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.43
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.4
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.39
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.32
2cul_A232 Glucose-inhibited division protein A-related PROT 97.3
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.21
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.19
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.18
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.14
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.07
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.0
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.99
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.96
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.81
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.8
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 96.75
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.75
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.72
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.72
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 96.72
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.69
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.69
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 96.69
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 96.66
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.66
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 96.66
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.65
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.62
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 96.62
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.6
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.6
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.6
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 96.57
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.52
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 96.51
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.49
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.46
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 96.44
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 96.44
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 96.43
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.41
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 96.41
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.39
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.34
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 96.33
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.32
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.28
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 96.26
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.23
2bry_A497 NEDD9 interacting protein with calponin homology a 96.23
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.23
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 96.17
4dna_A463 Probable glutathione reductase; structural genomic 96.13
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 96.06
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 96.05
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 95.99
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 95.97
1fec_A490 Trypanothione reductase; redox-active center, oxid 95.96
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 95.95
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 95.93
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 95.89
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.87
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 95.85
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 95.77
1vg0_A650 RAB proteins geranylgeranyltransferase component A 95.69
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 95.68
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 95.68
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.66
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.64
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.59
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 95.56
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 95.54
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 95.46
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 95.46
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.44
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 95.42
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 95.39
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 95.23
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 95.17
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.17
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 95.17
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.14
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.1
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.09
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 95.06
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 95.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 94.94
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 94.94
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 94.93
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.85
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 94.73
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 94.72
1ojt_A482 Surface protein; redox-active center, glycolysis, 94.68
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 94.68
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 94.64
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 94.58
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 94.51
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 94.48
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 94.46
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 94.42
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 94.22
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 94.17
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 94.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 93.99
4gut_A776 Lysine-specific histone demethylase 1B; histone de 93.98
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 93.93
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 93.89
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 93.87
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 93.79
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 93.73
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 93.56
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 93.55
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 93.51
4b63_A 501 L-ornithine N5 monooxygenase; oxidoreductase, side 93.51
4fk1_A304 Putative thioredoxin reductase; structural genomic 93.5
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 93.32
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 93.1
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 92.85
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.8
3r9u_A315 Thioredoxin reductase; structural genomics, center 92.77
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 92.65
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 92.63
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 92.56
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 92.54
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 92.34
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 92.23
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 92.2
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 92.03
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 91.88
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 91.71
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 91.7
3r9u_A315 Thioredoxin reductase; structural genomics, center 91.66
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 91.54
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 91.53
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 91.01
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 90.78
1ebd_A 455 E3BD, dihydrolipoamide dehydrogenase; redox-active 90.76
1ojt_A 482 Surface protein; redox-active center, glycolysis, 90.68
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 90.47
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 90.47
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 90.47
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 90.43
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 90.41
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 90.4
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 90.28
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 90.27
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 90.26
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 90.12
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 89.95
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 89.76
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 89.6
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 89.48
4hb9_A412 Similarities with probable monooxygenase; flavin, 89.44
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 89.3
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 89.19
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 88.8
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 88.65
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 88.48
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 88.25
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 88.12
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 87.93
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 87.9
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 87.75
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 87.72
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 87.46
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 87.4
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 87.15
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 87.14
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 87.0
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 86.83
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 86.8
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 86.29
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 85.79
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 85.32
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 85.27
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 85.24
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 84.54
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 84.48
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 83.36
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 83.35
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 83.26
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 83.16
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 82.8
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 82.27
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 82.2
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 81.98
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 81.4
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 81.34
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 80.89
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 80.79
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 80.74
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
Probab=100.00  E-value=2e-35  Score=268.22  Aligned_cols=256  Identities=49%  Similarity=0.908  Sum_probs=214.5

Q ss_pred             chhcCCCeeeeeCHHHHHhhCCCcccceeEEcCCceeecHHHHHHHHHHHHHHCCcEEEcCceeEEEEEeCCe-EEEEec
Q 023079            4 GTANGVHGLRMLEGFEAMKMEPELQCVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNC-MNVYIS   82 (287)
Q Consensus         4 ~~~~g~~~~~~L~~~ei~~~~P~l~~~~al~~p~~g~vdp~~l~~~l~~~a~~~Gv~~~~~~~V~~i~~~~~~-~~V~t~   82 (287)
                      .+..|+++.++++.+++.+++|.+...+++|.|.+++++|..++.+|.+.++++|++|+++++|+++..++++ +.|++.
T Consensus       110 ~~~~g~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~Gv~i~~~~~v~~i~~~~~~~~~v~~~  189 (369)
T 3dme_A          110 AGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFG  189 (369)
T ss_dssp             HHHTTCCCCEEEEHHHHHHHCTTCCCSEEEEETTCEEECHHHHHHHHHHHHHHTTCEEECSCCEEEEEECTTSSEEEEEC
T ss_pred             HHHcCCCceeecCHHHHHHhCCCceeeeeeECCCCEEECHHHHHHHHHHHHHHCCCEEECCCEEEEEEEcCCceEEEEEC
Confidence            3456775589999999999999998889999999999999999999999999999999999999999988765 889888


Q ss_pred             CCcccccCCCCCCCCCceeEecCEEEEcCCCCchHHHHHhCCCCCcccCCccccceEEEEEcCCCCCCCCceeeeCCCCC
Q 023079           83 ESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDG  162 (287)
Q Consensus        83 ~g~~~~~~~~~~~~~~~~~i~a~~VV~aaG~~s~~l~~~~~~~~~~~~p~~~~~~g~~~~~~~~~~~~~~~~i~~~~~~~  162 (287)
                      +|.             ..+++||+||+|+|+|+..|++++.+.+....+++++.||+++.++.+  ..+++.+|+.|...
T Consensus       190 ~g~-------------~~~~~a~~VV~A~G~~s~~l~~~~~g~~~~~~~~i~p~rG~~~~~~~~--~~~~~~~~~~p~~~  254 (369)
T 3dme_A          190 GAE-------------PMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGR--APFSRLIYPVPQHA  254 (369)
T ss_dssp             TTS-------------CEEEEEEEEEECCGGGHHHHHHTEETSCGGGSCCCEEEEEEEEECSSS--CSCSSEEEECTTCS
T ss_pred             CCc-------------eeEEEeCEEEECCCcchHHHHHHhcCCCccccceeeecceEEEEECCC--CccCceeecCCCCC
Confidence            772             237999999999999999999888223322223466699999998764  34667788888765


Q ss_pred             CceeEEeeecCCcEEECCCccccCCcccccccccccccCCChhhHHHHHHHHhhhCCCCCCCCcccccccccceecCCCC
Q 023079          163 GLGVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDGSLQPSYAGIRPKLSGPRQ  242 (287)
Q Consensus       163 ~~~~~~~~~~~g~l~iG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~l~~~~i~~~~~G~r~~~~~~~~  242 (287)
                      +.++++++..+|++++|++.++.+          ..+...+.+.++.+++.+.++||.+.+.++.+.|+|+||+..++++
T Consensus       255 ~~~~~~~~~~~g~~~iG~t~e~~~----------~~~~~~~~~~~~~l~~~~~~~~P~l~~~~v~~~w~G~Rp~~~~~~~  324 (369)
T 3dme_A          255 GLGVHLTLDLGGQAKFGPDTEWIA----------TEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHE  324 (369)
T ss_dssp             SCCCCEEECTTSCEEECCCCEEES----------SCCCCCCGGGGGGHHHHHHTTCTTCCTTCCEEEEEEEEEESSCTTS
T ss_pred             CceEEEeCccCCcEEECCCccccc----------ccccccCHHHHHHHHHHHHHHCCCCChhhceecceeccccccCCCC
Confidence            667888888899999999877532          2455667888999999999999999999999999999999764445


Q ss_pred             CCCCeEE-ec-CCCCCCCCeEEEeCCCCchhhhhHHHHHHHHHHHh
Q 023079          243 SPIDFVI-QG-DDTHGVPGLVNLFGIESPGLTSSMAIAEYVAAKFL  286 (287)
Q Consensus       243 ~~~~~~i-~~-~~~~~~~~l~~~~G~~g~G~t~ap~~g~~va~~i~  286 (287)
                      ++++|+| |+ .+  ..+|+|+++|++|+|||++|++|++++++|.
T Consensus       325 ~d~~p~i~g~~~~--~~~~l~~~~G~~~~G~t~ap~~a~~~a~~i~  368 (369)
T 3dme_A          325 PAADFAIAGPASH--GVAGLVNLYGIESPGLTASLAIAEETLARLA  368 (369)
T ss_dssp             CCCCCEEECHHHH--CCTTEEEEECCCTTHHHHHHHHHHHHHHHHC
T ss_pred             CcCCeEEeccccc--CCCCEEEEeCCCCchHhccHHHHHHHHHHhh
Confidence            6788888 76 34  4689999999999999999999999999985



>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 287
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 0.002
d1ryia288 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillu 0.004
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: N,N-dimethylglycine oxidase
species: Arthrobacter globiformis [TaxId: 1665]
 Score = 36.7 bits (83), Expect = 0.002
 Identities = 17/140 (12%), Positives = 27/140 (19%), Gaps = 28/140 (20%)

Query: 105 KLVVNSAGLSAPALAKRFIGLDNVFIPPAYYARGCYFSLANTKVAPFKHLIYPIPEDGGL 164
            +VV+ AG     +             P              +     H          L
Sbjct: 194 DIVVSCAGFWGAKIGAMIGMAVPPDGGPLLGESKELDGFYVAEAVWVTHSAGVAKAMAEL 253

Query: 165 GVHVTLDLDGQIKFGPDVEWIDGIDDTLSFLNRFDYSVNANRAERFYPEIRKYYPDLRDG 224
                 + D                             +  R E       +Y  +    
Sbjct: 254 LTTGRSETDL-------------------------GECDITRFEDVQ-LTPEYVSETSQQ 287

Query: 225 SLQPSYAGIRPKLSGPRQSP 244
           +    Y  + P    PR SP
Sbjct: 288 NFVEIYDVLHPLQ--PRLSP 305


>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query287
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.79
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.78
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.77
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.19
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 98.97
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 98.84
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.02
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.93
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.92
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.86
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.8
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.59
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.52
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.52
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.49
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 97.46
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.35
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.32
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.26
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.14
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 97.12
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.1
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.1
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.05
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 97.04
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.01
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.9
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.88
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.76
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.69
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 96.67
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.58
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 96.51
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.41
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.36
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 96.36
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 96.29
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.07
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.77
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 95.54
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 95.38
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 95.17
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.73
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.73
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 94.41
d1pj5a3119 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.85
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 93.77
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 93.41
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 92.75
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 92.72
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 92.69
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 91.49
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 90.1
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 90.05
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 89.53
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 89.3
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 88.5
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 88.42
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 87.23
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 86.2
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 85.97
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 85.9
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 85.12
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 84.18
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 84.08
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 83.78
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 81.83
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Sarcosine oxidase
species: Bacillus sp., strain b0618 [TaxId: 1409]
Probab=99.79  E-value=5.5e-19  Score=152.67  Aligned_cols=103  Identities=18%  Similarity=0.252  Sum_probs=96.2

Q ss_pred             cchhcCCCeeeeeCHHHHHhhCCCcc---cceeEEcCCceeecHHHHHHHHHHHHHHCCcEEEcCceeEEEEEeCCeEEE
Q 023079            3 RGTANGVHGLRMLEGFEAMKMEPELQ---CVKALLSPASGIVDSHSLMLSLVGEAENHGTTFSNNTSVIGGHLEGNCMNV   79 (287)
Q Consensus         3 ~~~~~g~~~~~~L~~~ei~~~~P~l~---~~~al~~p~~g~vdp~~l~~~l~~~a~~~Gv~~~~~~~V~~i~~~~~~~~V   79 (287)
                      ..+..|.+ .++|+++|+.+++|.++   ..++++.|++|++||.+++.+|.+.|+++|++|+++++|+++..++++|.|
T Consensus       107 ~~~~~g~~-~~~l~~~e~~~~~p~~~~~~~~~~~~~~~~g~~~p~~~~~~l~~~a~~~Gv~i~~~~~V~~i~~~~~~v~V  185 (281)
T d2gf3a1         107 AAKEHSLT-VDLLEGDEINKRWPGITVPENYNAIFEPNSGVLFSENCIRAYRELAEARGAKVLTHTRVEDFDISPDSVKI  185 (281)
T ss_dssp             HHHHTTCC-CEEEETHHHHHHSTTCCCCTTEEEEEETTCEEEEHHHHHHHHHHHHHHTTCEEECSCCEEEEEECSSCEEE
T ss_pred             hhccccch-hhhhhhHhhhhhhhcccccccceeeeccccccccccccccccccccccccccccCCcEEEEEEEECCEEEE
Confidence            35677887 99999999999999985   578999999999999999999999999999999999999999999999999


Q ss_pred             EecCCcccccCCCCCCCCCceeEecCEEEEcCCCCchHHHHHh
Q 023079           80 YISESKNLRNWDGVSPLQPELTLIPKLVVNSAGLSAPALAKRF  122 (287)
Q Consensus        80 ~t~~g~~~~~~~~~~~~~~~~~i~a~~VV~aaG~~s~~l~~~~  122 (287)
                      +|++|                +|+||+||||+|+|+..|++++
T Consensus       186 ~t~~g----------------~i~a~~VViAaG~~s~~l~~~l  212 (281)
T d2gf3a1         186 ETANG----------------SYTADKLIVSMGAWNSKLLSKL  212 (281)
T ss_dssp             EETTE----------------EEEEEEEEECCGGGHHHHGGGG
T ss_pred             EECCc----------------EEEcCEEEECCCCcchhhHHhc
Confidence            99999                8999999999999999998766



>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a3 d.16.1.5 (A:220-338) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure