Citrus Sinensis ID: 023188
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| 255570278 | 260 | Biotin carboxyl carrier protein subunit | 0.902 | 0.992 | 0.614 | 2e-77 | |
| 224141067 | 284 | predicted protein [Populus trichocarpa] | 0.975 | 0.982 | 0.618 | 1e-75 | |
| 224077764 | 281 | predicted protein [Populus trichocarpa] | 0.965 | 0.982 | 0.604 | 3e-74 | |
| 225452976 | 270 | PREDICTED: biotin carboxyl carrier prote | 0.825 | 0.874 | 0.625 | 9e-74 | |
| 401712956 | 270 | biotin carboxyl carrier protein [Vernici | 0.930 | 0.985 | 0.6 | 3e-72 | |
| 253721463 | 270 | biotin carboxyl carrier protein subunit | 0.933 | 0.988 | 0.574 | 6e-69 | |
| 356551156 | 276 | PREDICTED: biotin carboxyl carrier prote | 0.930 | 0.963 | 0.581 | 6e-69 | |
| 12006187 | 284 | biotin carboxyl carrier protein subunit | 0.954 | 0.961 | 0.555 | 3e-67 | |
| 351721795 | 284 | biotin carboxyl carrier protein subunit | 0.954 | 0.961 | 0.555 | 6e-67 | |
| 357496855 | 278 | Biotin carboxyl carrier protein of acety | 0.926 | 0.953 | 0.585 | 3e-64 |
| >gi|255570278|ref|XP_002526099.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) [Ricinus communis] gi|223534596|gb|EEF36293.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP2) [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 294 bits (753), Expect = 2e-77, Method: Compositional matrix adjust.
Identities = 177/288 (61%), Positives = 206/288 (71%), Gaps = 30/288 (10%)
Query: 1 MASIWIPCPKISWVAPVGSTGGQQPQQQKQMLSFQNSSNSNPSLSFASSAPFSGFQCSIK 60
MAS +PCPK S++A +GS N+SNS P + S P GF+ I+
Sbjct: 1 MASTSVPCPKTSFIARIGS----------------NASNSLPKHTI--SFPSRGFKWPIR 42
Query: 61 KQSAVWKVQAKVNDVIAKKPLNSTAAVDTGSEVASSEEKVESAEKKIPDASAISAFMTQV 120
KQSAV KV+A++N+VI K NS +DT S++A SE K E+ K +PDASAI+ FMTQV
Sbjct: 43 KQSAVTKVKAQLNEVIVKGSSNSVPMLDTNSKLAPSEVKDEAVVKNVPDASAITEFMTQV 102
Query: 121 SDLVKLVDSRDIMELQMKQSDCELIVRKKEALQPPEC--IVNMPPTMPHMMYPTPPPAAP 178
SDLVKLVDSRDI ELQ+KQ DCE+I+RKKEALQPP +++MPP+ H+M P PP AAP
Sbjct: 103 SDLVKLVDSRDITELQLKQLDCEIIIRKKEALQPPPAAQVISMPPSYQHVMLPPPPSAAP 162
Query: 179 AAAPTPAPAPASPASSVPVPALPPPAKKSSHPPLKCPMAGTFYRCPAPGEPAFVKVGDKV 238
+ PAPA SPA +V SSHP KCPMAGTFYRCPAPGEP FVKVGDKV
Sbjct: 163 PPSSAPAPALPSPAKAV----------TSSHPAFKCPMAGTFYRCPAPGEPPFVKVGDKV 212
Query: 239 QKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 286
QKGQVVCIIEAMKLMNEIEADQSGTI E+LAEDGK VSVDTPL VIVP
Sbjct: 213 QKGQVVCIIEAMKLMNEIEADQSGTITEVLAEDGKPVSVDTPLFVIVP 260
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224141067|ref|XP_002323896.1| predicted protein [Populus trichocarpa] gi|222866898|gb|EEF04029.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224077764|ref|XP_002305399.1| predicted protein [Populus trichocarpa] gi|222848363|gb|EEE85910.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225452976|ref|XP_002284374.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Vitis vinifera] gi|296082996|emb|CBI22297.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|401712956|gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] | Back alignment and taxonomy information |
|---|
| >gi|253721463|gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|356551156|ref|XP_003543944.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|12006187|gb|AAG44776.1|AF271796_1 biotin carboxyl carrier protein subunit [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351721795|ref|NP_001235174.1| biotin carboxyl carrier protein subunit [Glycine max] gi|12006165|gb|AAG44765.1|AF271071_1 biotin carboxyl carrier protein subunit precursor [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357496855|ref|XP_003618716.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago truncatula] gi|355493731|gb|AES74934.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| TAIR|locus:2180927 | 255 | BCCP2 "biotin carboxyl carrier | 0.258 | 0.290 | 0.675 | 4.7e-41 | |
| TAIR|locus:2171307 | 280 | CAC1 "chloroplastic acetylcoen | 0.258 | 0.264 | 0.608 | 7.2e-36 | |
| UNIPROTKB|Q9KV61 | 196 | VC_0296 "Acetyl-CoA carboxylas | 0.244 | 0.357 | 0.514 | 1.8e-17 | |
| TIGR_CMR|VC_0296 | 196 | VC_0296 "acetyl-CoA carboxylas | 0.244 | 0.357 | 0.514 | 1.8e-17 | |
| UNIPROTKB|P0ABD8 | 156 | accB [Escherichia coli K-12 (t | 0.251 | 0.461 | 0.5 | 6e-17 | |
| TIGR_CMR|CPS_0947 | 148 | CPS_0947 "acetyl-CoA carboxyla | 0.251 | 0.486 | 0.444 | 1.4e-15 | |
| TIGR_CMR|BA_4409 | 164 | BA_4409 "acetyl-CoA carboxylas | 0.244 | 0.426 | 0.402 | 1.3e-13 | |
| TIGR_CMR|SPO_1011 | 164 | SPO_1011 "acetyl-CoA carboxyla | 0.244 | 0.426 | 0.428 | 6.8e-13 | |
| TIGR_CMR|CHY_1999 | 617 | CHY_1999 "oxaloacetate decarbo | 0.244 | 0.113 | 0.528 | 1.1e-12 | |
| TIGR_CMR|GSU_2020 | 158 | GSU_2020 "acetyl-CoA carboxyla | 0.251 | 0.455 | 0.402 | 1.4e-12 |
| TAIR|locus:2180927 BCCP2 "biotin carboxyl carrier protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 247 (92.0 bits), Expect = 4.7e-41, Sum P(3) = 4.7e-41
Identities = 50/74 (67%), Positives = 53/74 (71%)
Query: 213 KCPMAGTFYRCPAPGEPAFXXXXXXXXXXXXXCIIEAMKLMNEIEADQSGTIAEILAEDG 272
K PMAGTFYR P PGEP F CIIEAMKLMNEIEA++SGTI E+LAEDG
Sbjct: 182 KSPMAGTFYRSPGPGEPPFVKVGDKVQKGQIVCIIEAMKLMNEIEAEKSGTIMELLAEDG 241
Query: 273 KSVSVDTPLLVIVP 286
K VSVDTPL VI P
Sbjct: 242 KPVSVDTPLFVIAP 255
|
|
| TAIR|locus:2171307 CAC1 "chloroplastic acetylcoenzyme A carboxylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KV61 VC_0296 "Acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0296 VC_0296 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0ABD8 accB [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0947 CPS_0947 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4409 BA_4409 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1011 SPO_1011 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1999 CHY_1999 "oxaloacetate decarboxylase, alpha subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2020 GSU_2020 "acetyl-CoA carboxylase, biotin carboxyl carrier protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 1e-95 | |
| PRK06302 | 155 | PRK06302, PRK06302, acetyl-CoA carboxylase biotin | 4e-45 | |
| TIGR00531 | 156 | TIGR00531, BCCP, acetyl-CoA carboxylase, biotin ca | 8e-36 | |
| COG0511 | 140 | COG0511, AccB, Biotin carboxyl carrier protein [Li | 3e-30 | |
| PRK09282 | 592 | PRK09282, PRK09282, pyruvate carboxylase subunit B | 1e-27 | |
| pfam00364 | 73 | pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | 3e-23 | |
| cd06850 | 67 | cd06850, biotinyl_domain, The biotinyl-domain or b | 4e-23 | |
| PRK07051 | 80 | PRK07051, PRK07051, hypothetical protein; Validate | 3e-18 | |
| PRK14040 | 593 | PRK14040, PRK14040, oxaloacetate decarboxylase; Pr | 1e-17 | |
| PRK05641 | 153 | PRK05641, PRK05641, putative acetyl-CoA carboxylas | 3e-14 | |
| cd06849 | 74 | cd06849, lipoyl_domain, Lipoyl domain of the dihyd | 7e-14 | |
| cd06663 | 73 | cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ | 1e-13 | |
| PRK06549 | 130 | PRK06549, PRK06549, acetyl-CoA carboxylase biotin | 2e-13 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 1e-11 | |
| PRK11856 | 411 | PRK11856, PRK11856, branched-chain alpha-keto acid | 2e-11 | |
| TIGR01108 | 582 | TIGR01108, oadA, oxaloacetate decarboxylase alpha | 1e-10 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 5e-10 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 6e-10 | |
| COG1038 | 1149 | COG1038, PycA, Pyruvate carboxylase [Energy produc | 2e-09 | |
| PRK12999 | 1146 | PRK12999, PRK12999, pyruvate carboxylase; Reviewed | 3e-09 | |
| COG0508 | 404 | COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena | 5e-09 | |
| TIGR01235 | 1143 | TIGR01235, pyruv_carbox, pyruvate carboxylase | 4e-08 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 9e-08 | |
| PRK08225 | 70 | PRK08225, PRK08225, acetyl-CoA carboxylase biotin | 2e-07 | |
| PRK14875 | 371 | PRK14875, PRK14875, acetoin dehydrogenase E2 subun | 4e-07 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 2e-06 | |
| PRK14042 | 596 | PRK14042, PRK14042, pyruvate carboxylase subunit B | 3e-06 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 1e-05 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 4e-05 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 1e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-04 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 3e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-04 | |
| TIGR01349 | 436 | TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase | 9e-04 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 0.001 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.001 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.002 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.003 | |
| PRK11854 | 633 | PRK11854, aceF, pyruvate dehydrogenase dihydrolipo | 0.004 |
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
Score = 282 bits (723), Expect = 1e-95
Identities = 167/296 (56%), Positives = 191/296 (64%), Gaps = 32/296 (10%)
Query: 1 MASIWIPCPKISWVAPVGSTGGQQPQQQKQMLSFQNSSNSNPSLSFASSAPFSGFQCSIK 60
MAS+ +PC K + A + + + Q P++SF S P
Sbjct: 1 MASLSVPCAKTAAAAANVGSRLSRSSFRLQ---------PKPNISFPSKGP-------NP 44
Query: 61 KQSAVWKVQAKVNDVIAKKPLNSTAAVDTGSEVASSEEK-----VESAEKKIPDASAISA 115
K+SAV KV+A++N+V NS + D SEVA SE K S++ +PD +IS
Sbjct: 45 KRSAVPKVKAQLNEVAVDGSSNSAKSDDPKSEVAPSEPKDEPPSNSSSKPNLPDEESISE 104
Query: 116 FMTQVSDLVKLVDSRDIMELQMKQSDCELIVRKKEALQ---PPECIVNMPPTMPHMMYPT 172
FMTQVS LVKLVDSRDI+ELQ+KQ DCEL++RKKEAL PP +V M P PH M P
Sbjct: 105 FMTQVSSLVKLVDSRDIVELQLKQLDCELVIRKKEALPQPPPPAPVVMMQPPPPHAMPPA 164
Query: 173 PPPAAPAAAPTPAPAPASPASSVPVPALPPPAK--KSSHPPLKCPMAGTFYRCPAPGEPA 230
PPAA A PA +P P PA PPPAK KSSHPPLK PMAGTFYR PAPGEP
Sbjct: 165 SPPAAQPAPSAPASSPP------PTPASPPPAKAPKSSHPPLKSPMAGTFYRSPAPGEPP 218
Query: 231 FVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 286
FVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTI EILAEDGK VSVDTPL VI P
Sbjct: 219 FVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDTPLFVIEP 274
|
Length = 274 |
| >gnl|CDD|235777 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|188060 TIGR00531, BCCP, acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236449 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >gnl|CDD|180811 PRK07051, PRK07051, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237592 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233273 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181304 PRK08225, PRK08225, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|172536 PRK14042, PRK14042, pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 100.0 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 99.98 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.97 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 99.95 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 99.7 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.7 | |
| PRK07051 | 80 | hypothetical protein; Validated | 99.68 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.66 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 99.66 | |
| PRK06748 | 83 | hypothetical protein; Validated | 99.65 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 99.61 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 99.53 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 99.43 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 99.35 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 99.35 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 99.34 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 99.34 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 99.33 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 99.32 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 99.31 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 99.3 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 99.3 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 99.27 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 99.27 | |
| COG0508 | 404 | AceF Pyruvate/2-oxoglutarate dehydrogenase complex | 99.22 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 99.21 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 99.19 | |
| TIGR01347 | 403 | sucB 2-oxoglutarate dehydrogenase complex dihydrol | 99.12 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 99.07 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.07 | |
| PRK11854 | 633 | aceF pyruvate dehydrogenase dihydrolipoyltransacet | 99.04 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 98.99 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 98.96 | |
| PLN02528 | 416 | 2-oxoisovalerate dehydrogenase E2 component | 98.96 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 98.93 | |
| KOG0559 | 457 | consensus Dihydrolipoamide succinyltransferase (2- | 98.89 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 98.89 | |
| TIGR01348 | 546 | PDHac_trf_long pyruvate dehydrogenase complex dihy | 98.87 | |
| PRK11855 | 547 | dihydrolipoamide acetyltransferase; Reviewed | 98.81 | |
| PLN02744 | 539 | dihydrolipoyllysine-residue acetyltransferase comp | 98.81 | |
| TIGR01349 | 435 | PDHac_trf_mito pyruvate dehydrogenase complex dihy | 98.81 | |
| PRK11856 | 411 | branched-chain alpha-keto acid dehydrogenase subun | 98.81 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 98.79 | |
| KOG0557 | 470 | consensus Dihydrolipoamide acetyltransferase [Ener | 98.75 | |
| PRK11892 | 464 | pyruvate dehydrogenase subunit beta; Provisional | 98.71 | |
| TIGR02927 | 590 | SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo | 98.69 | |
| PRK01202 | 127 | glycine cleavage system protein H; Provisional | 98.38 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 98.32 | |
| cd06848 | 96 | GCS_H Glycine cleavage H-protein. Glycine cleavage | 98.31 | |
| KOG0558 | 474 | consensus Dihydrolipoamide transacylase (alpha-ket | 98.2 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 98.15 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 98.14 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 98.03 | |
| TIGR03077 | 110 | not_gcvH glycine cleavage protein H-like protein, | 98.0 | |
| TIGR03309 | 256 | matur_yqeB selenium-dependent molybdenum hydroxyla | 98.0 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 98.0 | |
| TIGR00527 | 127 | gcvH glycine cleavage system H protein. The genome | 97.93 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 97.88 | |
| PRK00624 | 114 | glycine cleavage system protein H; Provisional | 97.87 | |
| PRK13380 | 144 | glycine cleavage system protein H; Provisional | 97.87 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 97.85 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 97.79 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 97.79 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 97.64 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 97.64 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.63 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 97.57 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 97.51 | |
| PF13533 | 50 | Biotin_lipoyl_2: Biotin-lipoyl like | 97.5 | |
| PF12700 | 328 | HlyD_2: HlyD family secretion protein; PDB: 3LNN_B | 97.47 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 97.44 | |
| PRK12784 | 84 | hypothetical protein; Provisional | 97.41 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 97.38 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 97.33 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 97.25 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 97.22 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 97.12 | |
| PRK05889 | 71 | putative acetyl-CoA carboxylase biotin carboxyl ca | 97.07 | |
| PF01597 | 122 | GCV_H: Glycine cleavage H-protein; InterPro: IPR00 | 97.01 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.94 | |
| COG0509 | 131 | GcvH Glycine cleavage system H protein (lipoate-bi | 96.88 | |
| PF13375 | 101 | RnfC_N: RnfC Barrel sandwich hybrid domain | 96.85 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 96.85 | |
| PRK06748 | 83 | hypothetical protein; Validated | 96.66 | |
| PRK08225 | 70 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 96.61 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 96.51 | |
| cd06850 | 67 | biotinyl_domain The biotinyl-domain or biotin carb | 96.35 | |
| COG0511 | 140 | AccB Biotin carboxyl carrier protein [Lipid metabo | 95.79 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 95.77 | |
| PRK06549 | 130 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 95.66 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 95.61 | |
| PF00364 | 74 | Biotin_lipoyl: Biotin-requiring enzyme; InterPro: | 95.5 | |
| PRK07051 | 80 | hypothetical protein; Validated | 95.38 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 95.32 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 95.27 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.15 | |
| PRK05641 | 153 | putative acetyl-CoA carboxylase biotin carboxyl ca | 95.13 | |
| PRK11556 | 415 | multidrug efflux system subunit MdtA; Provisional | 94.99 | |
| PRK09859 | 385 | multidrug efflux system protein MdtE; Provisional | 94.96 | |
| PRK11578 | 370 | macrolide transporter subunit MacA; Provisional | 94.95 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 94.92 | |
| PRK09578 | 385 | periplasmic multidrug efflux lipoprotein precursor | 94.91 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.9 | |
| PF13437 | 105 | HlyD_3: HlyD family secretion protein | 94.88 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 94.81 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 94.66 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 94.53 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 94.4 | |
| TIGR01936 | 447 | nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo | 94.36 | |
| PRK15030 | 397 | multidrug efflux system transporter AcrA; Provisio | 94.32 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 94.19 | |
| PRK10559 | 310 | p-hydroxybenzoic acid efflux subunit AaeA; Provisi | 94.06 | |
| PF09891 | 150 | DUF2118: Uncharacterized protein conserved in arch | 94.01 | |
| PRK05352 | 448 | Na(+)-translocating NADH-quinone reductase subunit | 93.81 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 93.58 | |
| PF00529 | 305 | HlyD: HlyD family secretion protein the correspond | 93.35 | |
| TIGR01945 | 435 | rnfC electron transport complex, RnfABCDGE type, C | 93.34 | |
| PF05896 | 257 | NQRA: Na(+)-translocating NADH-quinone reductase s | 93.29 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 93.11 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 92.77 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 92.51 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 92.0 | |
| PRK09783 | 409 | copper/silver efflux system membrane fusion protei | 91.99 | |
| PRK09439 | 169 | PTS system glucose-specific transporter subunit; P | 91.87 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 91.78 | |
| KOG3373 | 172 | consensus Glycine cleavage system H protein (lipoa | 91.62 | |
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 91.54 | |
| TIGR01995 | 610 | PTS-II-ABC-beta PTS system, beta-glucoside-specifi | 91.51 | |
| TIGR00531 | 156 | BCCP acetyl-CoA carboxylase, biotin carboxyl carri | 91.33 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 91.03 | |
| PRK06302 | 155 | acetyl-CoA carboxylase biotin carboxyl carrier pro | 90.97 | |
| PRK09824 | 627 | PTS system beta-glucoside-specific transporter sub | 90.94 | |
| PRK05305 | 206 | phosphatidylserine decarboxylase; Provisional | 90.75 | |
| PRK14042 | 596 | pyruvate carboxylase subunit B; Provisional | 90.73 | |
| PRK10255 | 648 | PTS system N-acetyl glucosamine specific transport | 90.7 | |
| PRK09824 | 627 | PTS system beta-glucoside-specific transporter sub | 90.5 | |
| COG1726 | 447 | NqrA Na+-transporting NADH:ubiquinone oxidoreducta | 90.46 | |
| TIGR00164 | 189 | PS_decarb_rel phosphatidylserine decarboxylase pre | 90.36 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 90.26 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 89.99 | |
| PLN02983 | 274 | biotin carboxyl carrier protein of acetyl-CoA carb | 89.85 | |
| PF07831 | 75 | PYNP_C: Pyrimidine nucleoside phosphorylase C-term | 89.42 | |
| TIGR01108 | 582 | oadA oxaloacetate decarboxylase alpha subunit. Thi | 89.08 | |
| PRK14040 | 593 | oxaloacetate decarboxylase; Provisional | 89.05 | |
| TIGR01995 | 610 | PTS-II-ABC-beta PTS system, beta-glucoside-specifi | 88.68 | |
| PLN02226 | 463 | 2-oxoglutarate dehydrogenase E2 component | 88.52 | |
| cd06663 | 73 | Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar | 88.52 | |
| PRK10255 | 648 | PTS system N-acetyl glucosamine specific transport | 88.3 | |
| PRK09282 | 592 | pyruvate carboxylase subunit B; Validated | 88.11 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 87.53 | |
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 87.5 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 87.23 | |
| PF02666 | 202 | PS_Dcarbxylase: Phosphatidylserine decarboxylase; | 87.11 | |
| TIGR00830 | 121 | PTBA PTS system, glucose subfamily, IIA component. | 86.82 | |
| PF00358 | 132 | PTS_EIIA_1: phosphoenolpyruvate-dependent sugar ph | 85.97 | |
| cd06849 | 74 | lipoyl_domain Lipoyl domain of the dihydrolipoyl a | 85.61 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 85.41 | |
| cd00210 | 124 | PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose s | 85.16 | |
| PTZ00144 | 418 | dihydrolipoamide succinyltransferase; Provisional | 84.87 | |
| COG2190 | 156 | NagE Phosphotransferase system IIA components [Car | 83.34 | |
| PRK05704 | 407 | dihydrolipoamide succinyltransferase; Validated | 81.91 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 81.83 | |
| PF06898 | 385 | YqfD: Putative stage IV sporulation protein YqfD; | 81.82 | |
| TIGR02876 | 382 | spore_yqfD sporulation protein YqfD. YqfD is part | 81.74 | |
| TIGR00999 | 265 | 8a0102 Membrane Fusion Protein cluster 2 (function | 81.46 | |
| TIGR01730 | 322 | RND_mfp RND family efflux transporter, MFP subunit | 81.33 | |
| COG0845 | 372 | AcrA Membrane-fusion protein [Cell envelope biogen | 80.96 |
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.1e-53 Score=386.88 Aligned_cols=263 Identities=64% Similarity=0.924 Sum_probs=208.4
Q ss_pred CCcccccCCCcccc-cccCCCCCCCchhhhhhhhhccCCCCCCCccccCCCCCCcceeeecccceeeEEEeeeeeeeecC
Q 023188 1 MASIWIPCPKISWV-APVGSTGGQQPQQQKQMLSFQNSSNSNPSLSFASSAPFSGFQCSIKKQSAVWKVQAKVNDVIAKK 79 (286)
Q Consensus 1 mas~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (286)
|||||+||+||.+. +..|.... ..+||+ .+||+|+|.++. ++++|..+|+||||+|||.+++
T Consensus 1 mas~~~~~~~~~~~~~~~~~~~~--------~~~~~~--~~~~~~~f~~~~-------~~~~~~~~~~~~a~~ne~~~~~ 63 (274)
T PLN02983 1 MASLSVPCAKTAAAAANVGSRLS--------RSSFRL--QPKPNISFPSKG-------PNPKRSAVPKVKAQLNEVAVDG 63 (274)
T ss_pred CCccccCcccceeeccccccccc--------cccccc--CCCCCcccccCC-------CCcccceeeeEEeeeceeeecc
Confidence 99999999999987 33552222 234555 789999999973 6899999999999999999999
Q ss_pred CCCCcccccCCCcccCchhhhccc-----cCCCCChHHHHHHHHHHHHHHHHHhhCCCcEEEEEeCCEEEEEEeccCCCC
Q 023188 80 PLNSTAAVDTGSEVASSEEKVESA-----EKKIPDASAISAFMTQVSDLVKLVDSRDIMELQMKQSDCELIVRKKEALQP 154 (286)
Q Consensus 80 ~~n~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~i~~~i~eI~eLiklvd~s~I~ELelk~~d~~L~Irk~~~~~~ 154 (286)
|||++++..+++.++.++++++.+ +++++|+++|+.||.|+.+|+|++|++||.||+||+.||+|.|||++.+++
T Consensus 64 ~sn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~is~f~~qv~~lv~lv~~~di~e~~lk~~~~e~~irkkeal~~ 143 (274)
T PLN02983 64 SSNSAKSDDPKSEVAPSEPKDEPPSNSSSKPNLPDEESISEFMTQVSSLVKLVDSRDIVELQLKQLDCELVIRKKEALPQ 143 (274)
T ss_pred ccccccccCCcccccccccccccccccCCCcccCCHHHHHHHHHHHHHHHhhhccccceeeeccccceEEEEecccccCC
Confidence 999999999999999999888773 589999999999999999999999999999999999999999999998865
Q ss_pred Ccc---ccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCccCCcceEEEccCCCCCC
Q 023188 155 PEC---IVNMPPTMPHMMYPTPPPAAPAAAPTPAPAPASPASSVPVPALPPPAK--KSSHPPLKCPMAGTFYRCPAPGEP 229 (286)
Q Consensus 155 ~~~---~~~~~~~~~~~~~p~~~~~~~~a~~~~a~~~a~~~~~~~~~a~~~~~~--~~~~~~I~AP~~G~~~~~p~~~~~ 229 (286)
+++ +..++.+.++...|.. ++++.. +.+.++..++ ++++.+.+++ .+++..|+|||.|+||+.|.+++.
T Consensus 144 ~~~~~~~~~~~~~~~~~~~p~~---~~~~~~-~~~~~~~~~~--~~~~~~~~~~~~~s~~~~V~APmaGtf~r~p~pge~ 217 (274)
T PLN02983 144 PPPPAPVVMMQPPPPHAMPPAS---PPAAQP-APSAPASSPP--PTPASPPPAKAPKSSHPPLKSPMAGTFYRSPAPGEP 217 (274)
T ss_pred CCCCCceEEecCCCcccCCCCC---CcccCC-CCCCCCCCCC--CCCCCCCCCCCCcCCCCeEeCCcCeEEEeccCCCCc
Confidence 431 2223222222222211 111011 0001111111 1111121222 267789999999999999999999
Q ss_pred ccccCCCEEecCCeEEEEEecCeeeeEecCCCeEEEEEEcCCCCccCCCCeEEEEcC
Q 023188 230 AFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 286 (286)
Q Consensus 230 ~~VkvGd~V~~Gq~L~~IEamK~~~eI~Ap~sGvV~~Ilve~Gd~V~~G~~L~~Iep 286 (286)
|+|++||.|++||+||+||+||++++|+|+.+|+|++|++++|+.|.+|++|++|+|
T Consensus 218 w~VkvGDsVkkGQvLavIEAMKmeieV~AP~sGtV~eIlVkeGD~V~vGqpL~~IEP 274 (274)
T PLN02983 218 PFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDTPLFVIEP 274 (274)
T ss_pred ceeCCCCEecCCCEEEEEEeeceeeEEecCCCeEEEEEecCCCCEeCCCCEEEEecC
Confidence 999999999999999999999999999999999999999999999999999999987
|
|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02528 2-oxoisovalerate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11855 dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed | Back alignment and domain information |
|---|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11892 pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >PRK01202 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06848 GCS_H Glycine cleavage H-protein | Back alignment and domain information |
|---|
| >KOG0558 consensus Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial | Back alignment and domain information |
|---|
| >TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >TIGR00527 gcvH glycine cleavage system H protein | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PRK00624 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK13380 glycine cleavage system protein H; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF13533 Biotin_lipoyl_2: Biotin-lipoyl like | Back alignment and domain information |
|---|
| >PF12700 HlyD_2: HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK12784 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional | Back alignment and domain information |
|---|
| >PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13375 RnfC_N: RnfC Barrel sandwich hybrid domain | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK06748 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase | Back alignment and domain information |
|---|
| >COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid | Back alignment and domain information |
|---|
| >PRK07051 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK11556 multidrug efflux system subunit MdtA; Provisional | Back alignment and domain information |
|---|
| >PRK09859 multidrug efflux system protein MdtE; Provisional | Back alignment and domain information |
|---|
| >PRK11578 macrolide transporter subunit MacA; Provisional | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF13437 HlyD_3: HlyD family secretion protein | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit | Back alignment and domain information |
|---|
| >PRK15030 multidrug efflux system transporter AcrA; Provisional | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional | Back alignment and domain information |
|---|
| >PF09891 DUF2118: Uncharacterized protein conserved in archaea (DUF2118); InterPro: IPR019217 This entry represents a family of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry | Back alignment and domain information |
|---|
| >TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit | Back alignment and domain information |
|---|
| >PF05896 NQRA: Na(+)-translocating NADH-quinone reductase subunit A (NQRA); InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional | Back alignment and domain information |
|---|
| >PRK09439 PTS system glucose-specific transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >KOG3373 consensus Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component | Back alignment and domain information |
|---|
| >TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >PRK05305 phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK14042 pyruvate carboxylase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] | Back alignment and domain information |
|---|
| >TIGR01108 oadA oxaloacetate decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >PRK14040 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component | Back alignment and domain information |
|---|
| >PLN02226 2-oxoglutarate dehydrogenase E2 component | Back alignment and domain information |
|---|
| >cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) | Back alignment and domain information |
|---|
| >PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional | Back alignment and domain information |
|---|
| >PRK09282 pyruvate carboxylase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF02666 PS_Dcarbxylase: Phosphatidylserine decarboxylase; InterPro: IPR003817 Phosphatidylserine decarboxylase plays a pivotal role in the synthesis of phospholipid by the mitochondria | Back alignment and domain information |
|---|
| >TIGR00830 PTBA PTS system, glucose subfamily, IIA component | Back alignment and domain information |
|---|
| >PF00358 PTS_EIIA_1: phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1; InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria | Back alignment and domain information |
|---|
| >cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit | Back alignment and domain information |
|---|
| >PTZ00144 dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05704 dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins | Back alignment and domain information |
|---|
| >TIGR02876 spore_yqfD sporulation protein YqfD | Back alignment and domain information |
|---|
| >TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters) | Back alignment and domain information |
|---|
| >TIGR01730 RND_mfp RND family efflux transporter, MFP subunit | Back alignment and domain information |
|---|
| >COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 286 | ||||
| 3bdo_A | 82 | Solution Structure Of Apo-Biotinyl Domain From Acet | 6e-15 | ||
| 1bdo_A | 80 | Structure Of The Biotinyl Domain Of Acetyl-Coenzyme | 6e-15 | ||
| 1a6x_A | 87 | Structure Of The Apo-Biotin Carboxyl Carrier Protei | 7e-15 |
| >pdb|3BDO|A Chain A, Solution Structure Of Apo-Biotinyl Domain From Acetyl Coenzyme A Carboxylase Of Escherichia Coli Determined By Triple-Resonance Nmr Spectroscopy Length = 82 | Back alignment and structure |
|
| >pdb|1BDO|A Chain A, Structure Of The Biotinyl Domain Of Acetyl-Coenzyme A Carboxylase Determined By Mad Phasing Length = 80 | Back alignment and structure |
| >pdb|1A6X|A Chain A, Structure Of The Apo-Biotin Carboxyl Carrier Protein (Apo- Bccp87) Of Escherichia Coli Acetyl-Coa Carboxylase, Nmr, 49 Structures Length = 87 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 8e-38 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 4e-18 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 5e-17 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 7e-17 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 9e-17 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 3e-16 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 8e-16 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 1e-15 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 2e-15 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 2e-13 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 4e-11 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 4e-11 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 1e-10 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 8e-10 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 2e-09 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 6e-09 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 2e-08 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 4e-08 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 5e-08 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 9e-08 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 3e-07 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 4e-07 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 3e-06 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 5e-06 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 1e-04 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 2e-04 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 2e-04 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 2e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 4e-04 |
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Length = 80 | Back alignment and structure |
|---|
Score = 127 bits (322), Expect = 8e-38
Identities = 41/73 (56%), Positives = 54/73 (73%)
Query: 212 LKCPMAGTFYRCPAPGEPAFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAED 271
++ PM GTFYR P+P AF++VG KV G +CI+EAMK+MN+IEAD+SGT+ IL E
Sbjct: 7 VRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVES 66
Query: 272 GKSVSVDTPLLVI 284
G+ V D PL+VI
Sbjct: 67 GQPVEFDEPLVVI 79
|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 99.68 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 99.57 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 99.57 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.53 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 99.53 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 99.52 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 99.51 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 99.51 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 99.5 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 99.5 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 99.49 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 99.48 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.48 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 99.47 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.46 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 99.44 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 99.44 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.44 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 99.43 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 99.42 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 99.41 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 99.39 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 99.38 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 99.37 | |
| 1zko_A | 136 | Glycine cleavage system H protein; TM0212, structu | 99.23 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 99.21 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 99.19 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 99.16 | |
| 1zy8_K | 229 | Pyruvate dehydrogenase protein X component, mitoch | 99.12 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 99.01 | |
| 1hpc_A | 131 | H protein of the glycine cleavage system; transit | 98.76 | |
| 1onl_A | 128 | Glycine cleavage system H protein; hybrid barrel-s | 98.74 | |
| 3a7l_A | 128 | H-protein, glycine cleavage system H protein; lipo | 98.73 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 98.27 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 98.18 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 98.17 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 98.17 | |
| 3klr_A | 125 | Glycine cleavage system H protein; antiparallel be | 98.07 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 97.98 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 97.87 | |
| 3mxu_A | 143 | Glycine cleavage system H protein; seattle structu | 97.79 | |
| 3tzu_A | 137 | GCVH, glycine cleavage system H protein 1; ssgcid, | 97.78 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 97.73 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 97.66 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 97.65 | |
| 2dn8_A | 100 | Acetyl-COA carboxylase 2; biotin required enzyme, | 97.47 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 97.44 | |
| 3hgb_A | 155 | Glycine cleavage system H protein; ssgcid, niaid, | 97.41 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 97.38 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 97.35 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 96.95 | |
| 1z6h_A | 72 | Biotin/lipoyl attachment protein; solution structu | 96.78 | |
| 2d5d_A | 74 | Methylmalonyl-COA decarboxylase gamma chain; bioti | 96.63 | |
| 1dcz_A | 77 | Transcarboxylase 1.3S subunit; antiparallel beta s | 96.52 | |
| 2kcc_A | 84 | Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, | 96.32 | |
| 2l5t_A | 77 | Lipoamide acyltransferase; E2 lipoyl domain; NMR { | 95.8 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 95.76 | |
| 2ejm_A | 99 | Methylcrotonoyl-COA carboxylase subunit alpha; bio | 95.75 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 95.71 | |
| 2jku_A | 94 | Propionyl-COA carboxylase alpha chain, mitochondri | 95.69 | |
| 3lnn_A | 359 | Membrane fusion protein (MFP) heavy metal cation Z | 95.67 | |
| 1bdo_A | 80 | Acetyl-COA carboxylase; BCCPSC, carboxyl transfera | 95.35 | |
| 1qjo_A | 80 | Dihydrolipoamide acetyltransferase; lipoyl domain, | 95.29 | |
| 1iyu_A | 79 | E2P, dihydrolipoamide acetyltransferase component | 95.05 | |
| 1vf7_A | 369 | Multidrug resistance protein MEXA; alpha hairpin, | 94.92 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 94.89 | |
| 1ghj_A | 79 | E2, E2, the dihydrolipoamide succinyltransferase c | 94.79 | |
| 3crk_C | 87 | Dihydrolipoyllysine-residue acetyltransferase COM | 94.64 | |
| 1k8m_A | 93 | E2 component of branched-chain ahpha-ketoacid dehy | 94.61 | |
| 2dne_A | 108 | Dihydrolipoyllysine-residue acetyltransferase comp | 94.49 | |
| 4dk0_A | 369 | Putative MACA; alpha-hairpin, lipoyl, beta-barrel, | 94.35 | |
| 1gjx_A | 81 | Pyruvate dehydrogenase; oxidoreductase, lipoyl dom | 94.28 | |
| 2k7v_A | 85 | Dihydrolipoyllysine-residue acetyltransferase comp | 94.07 | |
| 1pmr_A | 80 | Dihydrolipoyl succinyltransferase; 2-oxoglutarate | 93.99 | |
| 3ne5_B | 413 | Cation efflux system protein CUSB; transmembrane h | 93.95 | |
| 2gpr_A | 154 | Glucose-permease IIA component; phosphotransferase | 93.94 | |
| 2dnc_A | 98 | Pyruvate dehydrogenase protein X component; lipoic | 93.79 | |
| 3d4r_A | 169 | Domain of unknown function from the PFAM-B_34464; | 93.37 | |
| 1y8o_B | 128 | Dihydrolipoyllysine-residue acetyltransferase COM | 93.16 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 93.06 | |
| 2xha_A | 193 | NUSG, transcription antitermination protein NUSG; | 92.97 | |
| 2auk_A | 190 | DNA-directed RNA polymerase beta' chain; sandwich- | 92.86 | |
| 1ax3_A | 162 | Iiaglc, glucose permease IIA domain; phosphotransf | 92.79 | |
| 1f3z_A | 161 | EIIA-GLC, glucose-specific phosphocarrier; phospho | 91.69 | |
| 2bco_A | 350 | Succinylglutamate desuccinylase; NESG, VPR14, stru | 91.37 | |
| 2k32_A | 116 | A; NMR {Campylobacter jejuni} PDB: 2k33_A* | 91.28 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 91.24 | |
| 3our_B | 183 | EIIA, phosphotransferase system IIA component; exh | 90.01 | |
| 3lu0_D | 1407 | DNA-directed RNA polymerase subunit beta'; E. coli | 88.22 | |
| 3bg3_A | 718 | Pyruvate carboxylase, mitochondrial; TIM barrel, A | 88.03 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 87.31 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 86.83 | |
| 2xhc_A | 352 | Transcription antitermination protein NUSG; 2.45A | 86.52 | |
| 2f1m_A | 277 | Acriflavine resistance protein A; helical hairpin, | 85.93 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 85.81 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 84.08 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 80.07 |
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
Probab=99.68 E-value=1.5e-16 Score=119.85 Aligned_cols=76 Identities=54% Similarity=0.960 Sum_probs=73.3
Q ss_pred CCccCCcceEEEccCCCCCCccccCCCEEecCCeEEEEEecCeeeeEecCCCeEEEEEEcCCCCccCCCCeEEEEc
Q 023188 210 PPLKCPMAGTFYRCPAPGEPAFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIV 285 (286)
Q Consensus 210 ~~I~AP~~G~~~~~p~~~~~~~VkvGd~V~~Gq~L~~IEamK~~~eI~Ap~sGvV~~Ilve~Gd~V~~G~~L~~Ie 285 (286)
..|+||+.|++++.+.+...|++++||.|++||.|+.||+||+..+|+||++|+|.++++++|+.|..|++|+.|+
T Consensus 5 ~~v~a~~~G~v~~~~~~~~~~~v~~G~~V~~G~~l~~ie~~k~~~~i~Ap~~G~v~~~~v~~G~~V~~G~~L~~i~ 80 (80)
T 1bdo_A 5 HIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE 80 (80)
T ss_dssp EEEECSSSEEEESSSSTTSCCSCCTTCEECTTCEEEEEEETTEEEEEECSSCEEEEEECSCTTCEECTTCEEEEEC
T ss_pred eEEEcCCCeEEEEecccCcccccCCcCEECCCCEEEEEEeccEEEEEECCCCEEEEEEEcCCCCEECCCCEEEEEC
Confidence 3699999999999988999999999999999999999999999999999999999999999999999999999985
|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* | Back alignment and structure |
|---|
| >1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} | Back alignment and structure |
|---|
| >3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* | Back alignment and structure |
|---|
| >2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A | Back alignment and structure |
|---|
| >1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A | Back alignment and structure |
|---|
| >2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A | Back alignment and structure |
|---|
| >1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A | Back alignment and structure |
|---|
| >1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A | Back alignment and structure |
|---|
| >3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* | Back alignment and structure |
|---|
| >1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A | Back alignment and structure |
|---|
| >2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A | Back alignment and structure |
|---|
| >1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 | Back alignment and structure |
|---|
| >3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B | Back alignment and structure |
|---|
| >2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d4r_A Domain of unknown function from the PFAM-B_34464; structural genomics, joint center for structural genomics; HET: MSE; 2.20A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2auk_A DNA-directed RNA polymerase beta' chain; sandwich-barrel hybrid motif, transferase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A | Back alignment and structure |
|---|
| >1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A | Back alignment and structure |
|---|
| >2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A | Back alignment and structure |
|---|
| >2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3our_B EIIA, phosphotransferase system IIA component; exhibit no hydrolase activity1, lyase-transferase complex; 2.20A {Vibrio vulnificus} SCOP: b.84.3.1 | Back alignment and structure |
|---|
| >3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* | Back alignment and structure |
|---|
| >3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 286 | ||||
| d1bdoa_ | 80 | b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox | 3e-20 | |
| d1dcza_ | 77 | b.84.1.1 (A:) Biotin carboxyl carrier domain of tr | 5e-16 | |
| d1laba_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 4e-14 | |
| d1k8ma_ | 87 | b.84.1.1 (A:) Lipoyl domain of the mitochondrial b | 5e-14 | |
| d1pmra_ | 80 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 7e-13 | |
| d1gjxa_ | 81 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 7e-13 | |
| d1qjoa_ | 80 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 2e-12 | |
| d1iyua_ | 79 | b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac | 4e-12 | |
| d1ghja_ | 79 | b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate | 9e-12 | |
| d1y8ob1 | 102 | b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa | 2e-09 |
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Biotinyl domain of acetyl-CoA carboxylase species: Escherichia coli [TaxId: 562]
Score = 80.8 bits (199), Expect = 3e-20
Identities = 41/72 (56%), Positives = 53/72 (73%)
Query: 213 KCPMAGTFYRCPAPGEPAFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDG 272
+ PM GTFYR P+P AF++VG KV G +CI+EAMK+MN+IEAD+SGT+ IL E G
Sbjct: 8 RSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESG 67
Query: 273 KSVSVDTPLLVI 284
+ V D PL+VI
Sbjct: 68 QPVEFDEPLVVI 79
|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 99.89 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 99.8 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.66 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.6 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.6 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 99.56 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.55 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.5 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 99.46 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 99.45 | |
| d1onla_ | 127 | Protein H of glycine cleavage system {Thermus ther | 96.99 | |
| d1vf7a_ | 237 | Multidrug resistance protein MexA domain {Pseudomo | 96.99 | |
| d1hpca_ | 131 | Protein H of glycine cleavage system {Pea (Pisum s | 96.97 | |
| d1dcza_ | 77 | Biotin carboxyl carrier domain of transcarboxylase | 96.86 | |
| d1iyua_ | 79 | Lipoyl domain of dihydrolipoamide acetyltransferas | 96.23 | |
| d1bdoa_ | 80 | Biotinyl domain of acetyl-CoA carboxylase {Escheri | 96.15 | |
| d1qjoa_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.98 | |
| d1k8ma_ | 87 | Lipoyl domain of the mitochondrial branched-chain | 95.96 | |
| d1ghja_ | 79 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.57 | |
| d1pmra_ | 80 | Lipoyl domain of the 2-oxoglutarate dehydrogenase | 95.51 | |
| d1laba_ | 80 | Lipoyl domain of dihydrolipoamide acetyltransferas | 95.38 | |
| d1gjxa_ | 81 | Lipoyl domain of dihydrolipoamide acetyltransferas | 94.99 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 94.69 | |
| d1gpra_ | 158 | Glucose permease IIa domain, IIa-glc {Bacillus sub | 94.55 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 94.1 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 94.01 | |
| d2f3ga_ | 150 | Glucose-specific factor III (glsIII) {Escherichia | 93.64 | |
| d2gpra_ | 154 | Glucose permease IIa domain, IIa-glc {Mycoplasma c | 93.04 | |
| d1y8ob1 | 102 | Lipoyl domain of dihydrolipoamide acetyltransferas | 92.65 | |
| d1brwa3 | 103 | Pyrimidine nucleoside phosphorylase {Bacillus stea | 81.54 | |
| d1e2wa2 | 64 | Cytochrome f, small domain {Chlamydomonas reinhard | 80.89 |
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Barrel-sandwich hybrid superfamily: Single hybrid motif family: Biotinyl/lipoyl-carrier proteins and domains domain: Biotinyl domain of acetyl-CoA carboxylase species: Escherichia coli [TaxId: 562]
Probab=99.89 E-value=6.3e-24 Score=162.05 Aligned_cols=76 Identities=54% Similarity=0.960 Sum_probs=74.3
Q ss_pred CCccCCcceEEEccCCCCCCccccCCCEEecCCeEEEEEecCeeeeEecCCCeEEEEEEcCCCCccCCCCeEEEEc
Q 023188 210 PPLKCPMAGTFYRCPAPGEPAFVKVGDKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIV 285 (286)
Q Consensus 210 ~~I~AP~~G~~~~~p~~~~~~~VkvGd~V~~Gq~L~~IEamK~~~eI~Ap~sGvV~~Ilve~Gd~V~~G~~L~~Ie 285 (286)
..|+|||+|+||+.|+|+.++||++||+|++||+||+||+|||+++|+|+.+|+|++|++++|+.|++|++||.|+
T Consensus 5 ~~I~aPm~G~~~~~~~p~~~~~V~~Gd~V~~Gq~l~~iEamKm~~~i~a~~~G~v~~i~v~~G~~V~~G~~L~~ie 80 (80)
T d1bdoa_ 5 HIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE 80 (80)
T ss_dssp EEEECSSSEEEESSSSTTSCCSCCTTCEECTTCEEEEEEETTEEEEEECSSCEEEEEECSCTTCEECTTCEEEEEC
T ss_pred CEEeCCCcEEEEecCCCCCCeEccCCCeEeCCCEEEEEEcCcccEEEEcCCCeEEEEEEeCCCCEECCCCEEEEEC
Confidence 4799999999999999999999999999999999999999999999999999999999999999999999999986
|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gpra_ b.84.3.1 (A:) Glucose permease IIa domain, IIa-glc {Mycoplasma capricolum [TaxId: 2095]} | Back information, alignment and structure |
|---|
| >d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e2wa2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|