Citrus Sinensis ID: 023403

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--

MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH

ccHHHHHHccccccccEEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEcccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHcccccccEEEccccccccHHHHHHHHHcccccccccccccccccccccccEEEccccccccHHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHHHccccccccccccc

ccHHHHHHHHccccccEEEcccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEccccHHHccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEcccccHccHHHHHHHHHcccHHHEEcHcccccccccccccEEEccccccccHHHHHHHHHHcccHHcccHccEEEccccHHHHHHHHHHHHHHHHHHHccccccc

MNNLVLSLAPKLTKLQTlvlrqdkpqledNAVEAIANschdlqdldlsksfklsdrSLYALAhgcpnltrlnisgctsfsDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNqlqslnlgwcedvgdvgvmnlaygcpdlrsldlcgcvcitdDSVIALangcphlrslGLYYCRNITDRAIYSLAQsgvknkpgiwesmkgrydeeglqslnisqctaltppavqalcdtfpalhtcsgrhslvmsgclnltsvhcvcagqshrtassiphpah

MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLaqsgvknkpgIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQshrtassiphpah

*******LAPKLTKLQTLVLR*********AVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAG**************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		282	2.2.26 [Sep-21-2011]
Q9LPL4		360	F-box protein SKP2A OS=Ar	yes	no	1.0	0.783	0.802	1e-134
O49286		360	F-box protein SKP2B OS=Ar	no	no	1.0	0.783	0.791	1e-129
A6H779		423	F-box/LRR-repeat protein	yes	no	0.773	0.515	0.324	3e-22
Q5R3Z8		423	F-box/LRR-repeat protein	yes	no	0.801	0.534	0.303	8e-22
Q9UKC9		423	F-box/LRR-repeat protein	yes	no	0.801	0.534	0.303	9e-22
Q8BH16		423	F-box/LRR-repeat protein	yes	no	0.776	0.517	0.315	1e-21
Q9CZV8		436	F-box/LRR-repeat protein	no	no	0.592	0.383	0.363	2e-21
Q96IG2		436	F-box/LRR-repeat protein	no	no	0.592	0.383	0.363	2e-21
Q58DG6		436	F-box/LRR-repeat protein	no	no	0.592	0.383	0.363	2e-21
Q9C5D2		610	F-box/LRR-repeat protein	no	no	0.744	0.344	0.282	2e-20

>sp\|Q9LPL4\|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1	Back alignment and function desciption

 Score =  477 bits (1228), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/283 (80%), Positives = 258/283 (91%), Gaps = 1/283 (0%)

Query: 1   MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYA 60
           MN+LVLSL PK  KLQTL LRQDKPQLEDNAVEAIAN CH+LQ+LDLSKS K++DRSLYA
Sbjct: 78  MNSLVLSLVPKFVKLQTLNLRQDKPQLEDNAVEAIANHCHELQELDLSKSLKITDRSLYA 137

Query: 61  LAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQ 120
           LAHGCP+LT+LN+SGCTSFSD A+AYL  FCRKLK+LNLCGCVKA TD AL+AIG NCNQ
Sbjct: 138 LAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQ 197

Query: 121 LQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYY 180
           +QSLNLGWCE++ D GVM+LAYGCPDLR+LDLCGCV ITD+SV+ALA+ C HLRSLGLYY
Sbjct: 198 MQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSLGLYY 257

Query: 181 CRNITDRAIYSLAQSGVKNKPGIWESM-KGRYDEEGLQSLNISQCTALTPPAVQALCDTF 239
           CRNITDRA+YSLAQSGVKNKPG W+S+ KG+YDEEGL+SLNISQCTALTP AVQA+CD+F
Sbjct: 258 CRNITDRAMYSLAQSGVKNKPGSWKSVKKGKYDEEGLRSLNISQCTALTPSAVQAVCDSF 317

Query: 240 PALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH 282
           PALHTCSGRHSLVMSGCLNLT+VHC C  Q+HR  +++PHPAH
Sbjct: 318 PALHTCSGRHSLVMSGCLNLTTVHCACILQAHRAHNAVPHPAH 360

Component of SCF(SKP2A) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins (including cell cycle repressors). Acts as an auxin receptor. Regulates the stability of the transcription factors E2FC and DPB, repressors of cell proliferation. Confers increase tolerance to osmotic stress by promoting cell division, especially in meristems. Promotes the formation of lateral root primordia.
Arabidopsis thaliana (taxid: 3702)

>sp\|O49286\|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1	Back alignment and function description

>sp\|A6H779\|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q5R3Z8\|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1	Back alignment and function description

>sp\|Q9UKC9\|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3	Back alignment and function description

>sp\|Q8BH16\|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1	Back alignment and function description

>sp\|Q9CZV8\|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3	Back alignment and function description

>sp\|Q96IG2\|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2	Back alignment and function description

>sp\|Q58DG6\|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2	Back alignment and function description

>sp\|Q9C5D2\|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		282
224066761		358	predicted protein [Populus trichocarpa]	1.0	0.787	0.861	1e-139
224082382		363	predicted protein [Populus trichocarpa]	1.0	0.776	0.858	1e-138
255558466		373	F-box/LRR-repeat protein, putative [Rici	1.0	0.756	0.861	1e-136
18394987		360	F-box protein SKP2A [Arabidopsis thalian	1.0	0.783	0.802	1e-132
21554029		360	F-box protein AtFBL5 [Arabidopsis thalia	1.0	0.783	0.802	1e-132
302142727		428	unnamed protein product [Vitis vinifera]	1.0	0.658	0.815	1e-131
359492292		370	PREDICTED: F-box protein SKP2B-like [Vit	1.0	0.762	0.815	1e-131
297845122		361	F-box family protein [Arabidopsis lyrata	1.0	0.781	0.799	1e-131
312282179		367	unnamed protein product [Thellungiella h	1.0	0.768	0.803	1e-128
217073061		368	unknown [Medicago truncatula]	0.992	0.760	0.780	1e-127

>gi\|224066761\|ref\|XP_002302202.1\| predicted protein [Populus trichocarpa] gi\|222843928\|gb\|EEE81475.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/282 (86%), Positives = 259/282 (91%)

Query: 1   MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYA 60
           MNNLVLSLAPK TKLQTLVLRQDKPQLEDNAVE IA+ CHDLQDLDLSKSFKLSD SLYA
Sbjct: 77  MNNLVLSLAPKFTKLQTLVLRQDKPQLEDNAVETIASYCHDLQDLDLSKSFKLSDLSLYA 136

Query: 61  LAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQ 120
           LAHG PNLT+LNISGCT+FSD +L YL  FCRKLKILNLCGCV  ATD ALQAIGRNC+Q
Sbjct: 137 LAHGFPNLTKLNISGCTAFSDVSLEYLTEFCRKLKILNLCGCVNGATDRALQAIGRNCSQ 196

Query: 121 LQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYY 180
           LQSLNLGWCE+V DVGVM+LAYGCPD+R+LDLCGCVCITDDSVIALAN CPHLRSL LYY
Sbjct: 197 LQSLNLGWCENVSDVGVMSLAYGCPDIRTLDLCGCVCITDDSVIALANRCPHLRSLCLYY 256

Query: 181 CRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFP 240
           CRNITDRA+YSL  + VKNKP +WESMKGRYDEEGL+SLNISQCTA+TPPAVQALCD+FP
Sbjct: 257 CRNITDRAMYSLVHNRVKNKPAMWESMKGRYDEEGLKSLNISQCTAITPPAVQALCDSFP 316

Query: 241 ALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH 282
           ALHTCSGRHSLVMSGC NLTSVHC CA Q+H TASSIPHPAH
Sbjct: 317 ALHTCSGRHSLVMSGCWNLTSVHCACAVQAHHTASSIPHPAH 358

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224082382\|ref\|XP_002306672.1\| predicted protein [Populus trichocarpa] gi\|222856121\|gb\|EEE93668.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255558466\|ref\|XP_002520258.1\| F-box/LRR-repeat protein, putative [Ricinus communis] gi\|223540477\|gb\|EEF42044.1\| F-box/LRR-repeat protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi|18394987|ref|NP_564139.1| F-box protein SKP2A [Arabidopsis thaliana] gi|75177240|sp|Q9LPL4.1|SKP2A_ARATH RecName: Full=F-box protein SKP2A; AltName: Full=FBL5-like protein; Short=AtFBL5; AltName: Full=SKP2-like protein 1; Short=AtSKP2;1 gi|9454572|gb|AAF87895.1|AC015447_5 Unknown protein [Arabidopsis thaliana] gi|16604366|gb|AAL24189.1| At1g21410/F24J8_17 [Arabidopsis thaliana] gi|19699206|gb|AAL90969.1| At1g21410/F24J8_17 [Arabidopsis thaliana] gi|332191979|gb|AEE30100.1| F-box protein SKP2A [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|21554029\|gb\|AAM63110.1\| F-box protein AtFBL5 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|302142727\|emb\|CBI19930.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359492292\|ref\|XP_002268441.2\| PREDICTED: F-box protein SKP2B-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297845122\|ref\|XP_002890442.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi\|297336284\|gb\|EFH66701.1\| F-box family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|312282179\|dbj\|BAJ33955.1\| unnamed protein product [Thellungiella halophila]	Back alignment and taxonomy information

>gi\|217073061\|gb\|ACJ84890.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		282
TAIR\|locus:2027082		360	SKP2A [Arabidopsis thaliana (t	1.0	0.783	0.802	6.8e-127
TAIR\|locus:2025222		360	SKP2B "AT1G77000" [Arabidopsis	1.0	0.783	0.791	5.1e-122
TAIR\|locus:2166978		405	AT5G23340 [Arabidopsis thalian	0.897	0.624	0.305	2.2e-25
UNIPROTKB\|A6H779		423	FBXL2 "F-box/LRR-repeat protei	0.875	0.583	0.310	2.9e-25
RGD\|1562243		422	Fbxl2 "F-box and leucine-rich	0.599	0.400	0.364	4.9e-25
UNIPROTKB\|F1NHD2		423	FBXL2 "Uncharacterized protein	0.599	0.399	0.358	1.6e-24
UNIPROTKB\|F1PWK1		422	FBXL2 "Uncharacterized protein	0.875	0.585	0.302	2e-24
MGI\|MGI:1919429		423	Fbxl2 "F-box and leucine-rich	0.599	0.399	0.352	2e-24
UNIPROTKB\|Q9UKC9		423	FBXL2 "F-box/LRR-repeat protei	0.599	0.399	0.352	2.7e-24
UNIPROTKB\|Q5R3Z8		423	FBXL2 "F-box/LRR-repeat protei	0.599	0.399	0.352	2.7e-24

TAIR\|locus:2027082 SKP2A [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1246 (443.7 bits), Expect = 6.8e-127, P = 6.8e-127
 Identities = 227/283 (80%), Positives = 258/283 (91%)

Query:     1 MNNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYA 60
             MN+LVLSL PK  KLQTL LRQDKPQLEDNAVEAIAN CH+LQ+LDLSKS K++DRSLYA
Sbjct:    78 MNSLVLSLVPKFVKLQTLNLRQDKPQLEDNAVEAIANHCHELQELDLSKSLKITDRSLYA 137

Query:    61 LAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQ 120
             LAHGCP+LT+LN+SGCTSFSD A+AYL  FCRKLK+LNLCGCVKA TD AL+AIG NCNQ
Sbjct:   138 LAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQ 197

Query:   121 LQSLNLGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYY 180
             +QSLNLGWCE++ D GVM+LAYGCPDLR+LDLCGCV ITD+SV+ALA+ C HLRSLGLYY
Sbjct:   198 MQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSLGLYY 257

Query:   181 CRNITDRAIYSLAQSGVKNKPGIWESMK-GRYDEEGLQSLNISQCTALTPPAVQALCDTF 239
             CRNITDRA+YSLAQSGVKNKPG W+S+K G+YDEEGL+SLNISQCTALTP AVQA+CD+F
Sbjct:   258 CRNITDRAMYSLAQSGVKNKPGSWKSVKKGKYDEEGLRSLNISQCTALTPSAVQAVCDSF 317

Query:   240 PALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTASSIPHPAH 282
             PALHTCSGRHSLVMSGCLNLT+VHC C  Q+HR  +++PHPAH
Sbjct:   318 PALHTCSGRHSLVMSGCLNLTTVHCACILQAHRAHNAVPHPAH 360

GO:0005737 "cytoplasm" evidence=ISM

GO:0005515 "protein binding" evidence=IPI

GO:0019005 "SCF ubiquitin ligase complex" evidence=IDA;IPI

GO:0031146 "SCF-dependent proteasomal ubiquitin-dependent protein catabolic process" evidence=IDA;IPI

GO:0005634 "nucleus" evidence=IDA

GO:0010311 "lateral root formation" evidence=IMP

GO:0051781 "positive regulation of cell division" evidence=IMP

GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA

GO:0016567 "protein ubiquitination" evidence=IDA

GO:0071365 "cellular response to auxin stimulus" evidence=IDA

GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA

TAIR\|locus:2025222 SKP2B "AT1G77000" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9LPL4	SKP2A_ARATH	No assigned EC number	0.8021	1.0	0.7833	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		282
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	6e-24
cd09293		226	cd09293, AMN1, Antagonist of mitotic exit network	2e-11
smart00367		26	smart00367, LRR_CC, Leucine-rich repeat - CC (cyst	3e-05
smart00367		26	smart00367, LRR_CC, Leucine-rich repeat - CC (cyst	3e-04
smart00367		26	smart00367, LRR_CC, Leucine-rich repeat - CC (cyst	0.003

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

 Score = 96.2 bits (240), Expect = 6e-24
 Identities = 58/155 (37%), Positives = 79/155 (50%), Gaps = 6/155 (3%)

Query: 38  SCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKIL 97
           +C+ L+ L L  S  + D  L ALA  CPNL  L++  C + +D  +  L   C KL+ +
Sbjct: 50  NCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQTI 109

Query: 98  NLCGCVK--AATDYALQAIGRNCNQLQSLNLGWCEDVGDVGVMNLAYGC-PDLRSLDLCG 154
           NL         TD +L A+G+NC  LQ++    C DV D GV  LA GC   L  L L  
Sbjct: 110 NLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERLSLNN 168

Query: 155 CVCITDDSVIAL--ANGCPHLRSLGLYYCRNITDR 187
           C  +TD S+ A+  +N  P+L  L    C  ITD 
Sbjct: 169 CRNLTDQSIPAILASNYFPNLSVLEFRGCPLITDF 203

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226

>gnl\|CDD\|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1	Back alignment and domain information

>gnl\|CDD\|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>gnl\|CDD\|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>gnl\|CDD\|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		282
KOG4341		483	consensus F-box protein containing LRR [General fu	99.86
KOG4341		483	consensus F-box protein containing LRR [General fu	99.85
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.69
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	99.64
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.64
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.61
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.54
KOG1947		482	consensus Leucine rich repeat proteins, some prote	99.54
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.39
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.38
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.37
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.35
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.26
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.11
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.07
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	99.03
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.92
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.86
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.85
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	98.59
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.57
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.4
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.34
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.3
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.26
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.23
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.22
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.19
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.13
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.08
KOG3864		221	consensus Uncharacterized conserved protein [Funct	98.07
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	97.93
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.84
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	97.8
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	97.79
KOG0472		565	consensus Leucine-rich repeat protein [Function un	97.64
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.55
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.27
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	97.19
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	97.15
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.77
PLN03150		623	hypothetical protein; Provisional	96.71
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	96.67
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	96.64
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.59
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	96.56
PRK15386		426	type III secretion protein GogB; Provisional	96.52
KOG0617		264	consensus Ras suppressor protein (contains leucine	96.52
PLN03150		623	hypothetical protein; Provisional	96.47
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	96.33
KOG4237		498	consensus Extracellular matrix protein slit, conta	96.33
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	96.27
KOG0617		264	consensus Ras suppressor protein (contains leucine	96.22
KOG4308		478	consensus LRR-containing protein [Function unknown	96.13
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	96.0
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.87
KOG4308		478	consensus LRR-containing protein [Function unknown	95.87
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.71
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	95.7
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.43
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	95.03
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	94.65
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.46
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	94.36
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	94.17
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	93.86
KOG0472		565	consensus Leucine-rich repeat protein [Function un	93.59
PRK15386		426	type III secretion protein GogB; Provisional	93.36
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	92.94
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.76
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	89.52
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	88.6
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	85.37
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	84.99
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	83.21
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	80.7
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	80.07

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

Probab=99.86  E-value=3.6e-22  Score=164.30  Aligned_cols=250  Identities=31%  Similarity=0.537  Sum_probs=181.9

Q ss_pred             hhHHHHccCCCCccEEEccCCCCCCcHHHHHHHHhhCCCccEEEcCCCCCCChHHHHHHHHcCCCCcEEeccCCCCCCHH
Q 023403            3 NLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDH   82 (282)
Q Consensus         3 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~   82 (282)
                      ..+..+.++|++|+.|++.+| ..+++..+..+...|++|++|++++|+.++..++..+...++.++.+...||......
T Consensus       180 ~s~~sla~~C~~l~~l~L~~c-~~iT~~~Lk~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le  258 (483)
T KOG4341|consen  180 SSLLSLARYCRKLRHLNLHSC-SSITDVSLKYLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELE  258 (483)
T ss_pred             HHHHHHHHhcchhhhhhhccc-chhHHHHHHHHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHH
Confidence            345567778899999999873 5778888888888899999999999888888777776666666666655555554444


Q ss_pred             HHHH--------------------------HHHcCCCCeEEEecCCcccccHHHHHHHHHhCCCCCEEEecCCCCCCHHH
Q 023403           83 ALAY--------------------------LCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLGWCEDVGDVG  136 (282)
Q Consensus        83 ~~~~--------------------------~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~~~~~~~  136 (282)
                      .+..                          +...+..|+.++.++|.. +++..+..+.+++++|+.|.+..|..+++.+
T Consensus       259 ~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~-~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~  337 (483)
T KOG4341|consen  259 ALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTD-ITDEVLWALGQHCHNLQVLELSGCQQFSDRG  337 (483)
T ss_pred             HHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCC-CchHHHHHHhcCCCceEEEeccccchhhhhh
Confidence            4443                          334455666666666654 6666666666667777777777777777777


Q ss_pred             HHHHHhcCCCCcEEEecCCCccCHHHHHHHHhcCCCCCEEeecCCCCCcHHHHHHHHhcCcCCCCcchhcccccCcccCc
Q 023403          137 VMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGL  216 (282)
Q Consensus       137 ~~~l~~~~~~L~~L~l~~~~~l~~~~l~~l~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L  216 (282)
                      +..+..+++.|+.+++.+|..+.+..+..+..+|+.|+.|.+++|..+++.++..+....              .....|
T Consensus       338 ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslshce~itD~gi~~l~~~~--------------c~~~~l  403 (483)
T KOG4341|consen  338 FTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSHCELITDEGIRHLSSSS--------------CSLEGL  403 (483)
T ss_pred             hhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCChhhhhhhhhhhhhhhhhcc--------------cccccc
Confidence            777777777777777777666666666667667777777777777777777666655532              223678


Q ss_pred             ceEeccCCCCCCHHHHHHHHhhCCCCccCCCcceeeecCCCCccchhhccCCCCcCCcC
Q 023403          217 QSLNISQCTALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTAS  275 (282)
Q Consensus       217 ~~L~l~~~~~l~~~~~~~l~~~~~~l~~~~~L~~L~l~~c~~~~~~~~~~~~~~~~~~~  275 (282)
                      +.+.+++|+.+++..++.+.       .|++|+.+++.+|..++...+..+-+..|.+.
T Consensus       404 ~~lEL~n~p~i~d~~Le~l~-------~c~~Leri~l~~~q~vtk~~i~~~~~~lp~i~  455 (483)
T KOG4341|consen  404 EVLELDNCPLITDATLEHLS-------ICRNLERIELIDCQDVTKEAISRFATHLPNIK  455 (483)
T ss_pred             ceeeecCCCCchHHHHHHHh-------hCcccceeeeechhhhhhhhhHHHHhhCccce
Confidence            88888898888887777654       78899999999999999999988888877653

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		282
1fqv_A		336	Insights Into Scf Ubiquitin Ligases From The Struct		5e-12
1fs2_A		272	Insights Into Scf Ubiquitin Ligases From The Struct		9e-12
2p1m_B		594	Tir1-ask1 Complex Structure Length = 594		1e-08
3ogk_B		592	Structure Of Coi1-Ask1 In Complex With Coronatine A		4e-07

>pdb|1FQV|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 336

Back alignment and structure

Iteration: 1

Score = 68.2 bits (165), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 51/169 (30%), Positives = 79/169 (46%), Gaps = 4/169 (2%) Query: 27 LEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAY 86 +E + + I + C LQ+L L + +LSD + LA NL RLN+SGC+ FS+ AL Sbjct: 105 IEVSTLHGILSQCSKLQNLSL-EGLRLSDPIVNTLAKNS-NLVRLNLSGCSGFSEFALQT 162 Query: 87 LCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNL-GWCEDVGDVGVMNLAYGCP 145 L C +L LNL C + A+ + LNL G+ +++ + L CP Sbjct: 163 LLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCP 222 Query: 146 DLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQ 194 +L LDL V + +D +L+ L L C +I + L + Sbjct: 223 NLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSRCYDIIPETLLELGE 270

PyMOL of 1fqv

>pdb|1FS2|A Chain A, Insights Into Scf Ubiquitin Ligases From The Structure Of The Skp1-Skp2 Complex Length = 272

Back alignment and structure

>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure Length = 594

Back alignment and structure

>pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		282
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-45
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-35
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	4e-24
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-39
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	9e-36
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	9e-33
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	8e-25
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-20
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-38
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-34
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	8e-28
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-25
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-22
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-08
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	2e-16
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	9e-16
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	1e-15
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	5e-10
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-13
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-13
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-13
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	6e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-13
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	4e-13
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	6e-13
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	1e-12
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	3e-09
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	4e-08
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	9e-12
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	1e-10
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	5e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-06
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	5e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	6e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-04
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-04

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

 Score =  155 bits (393), Expect = 2e-45
 Identities = 59/242 (24%), Positives = 97/242 (40%), Gaps = 24/242 (9%)

Query: 2   NNLVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYAL 61
           + +   LA   +  +   +      +E + +  I + C  LQ+L L    +LSD  +  L
Sbjct: 80  SFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLE-GLRLSDPIVNTL 138

Query: 62  AHGCPNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQL 121
           A    NL RLN+SGC+ FS+ AL  L   C +L  LNL  C      +   A+      +
Sbjct: 139 AK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETI 197

Query: 122 QSLNL-GWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYY 180
             LNL G+ +++    +  L   CP+L  LDL   V + +D          +L+ L L  
Sbjct: 198 TQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-LNYLQHLSLSR 256

Query: 181 CRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFP 240
           C +I    +  L +                     L++L +     +    +Q L +  P
Sbjct: 257 CYDIIPETLLELGEI------------------PTLKTLQVFGI--VPDGTLQLLKEALP 296

Query: 241 AL 242
            L
Sbjct: 297 HL 298

PyMOL of 2ast

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		282
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.89
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.88
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.87
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.86
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.84
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.84
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.76
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.75
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.75
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.74
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.67
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.65
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.51
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.5
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.5
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.45
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	99.43
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.41
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.38
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.38
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.34
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.3
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.29
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.29
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.27
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.26
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.24
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.23
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.22
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.22
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.22
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.22
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.21
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.21
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.2
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.19
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.18
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.18
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.18
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.18
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.18
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.17
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.17
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.17
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.16
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.15
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.15
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.14
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.14
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.14
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.12
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.12
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	99.12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.11
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.11
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.1
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.06
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.06
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.03
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.03
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.02
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.02
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.01
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	98.99
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	98.98
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	98.98
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	98.97
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	98.96
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	98.95
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	98.95
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.93
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.91
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.9
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.9
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.9
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	98.89
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	98.87
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.87
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	98.86
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.85
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.83
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.81
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.8
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.79
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	98.79
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.71
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	98.68
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	98.67
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.63
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	98.62
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.58
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.57
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	98.57
3m19_A		251	Variable lymphocyte receptor A diversity region; a	98.56
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.55
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.47
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	98.43
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	98.41
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.39
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.33
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.33
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.31
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.3
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.3
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.29
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.28
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.23
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.21
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.21
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.21
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.18
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.16
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.13
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.1
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.1
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	98.1
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.1
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.09
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.09
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.06
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.02
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	97.99
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.85
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.69
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.62
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.53
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	97.52
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.51
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.4
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	97.4
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	97.29
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.29
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	97.21
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.94
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.48
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.4
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	96.28
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	96.23
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	95.52
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	95.06
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	94.64
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	93.92
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	90.81
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	88.62

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

Probab=99.89  E-value=2.6e-21  Score=175.20  Aligned_cols=239  Identities=23%  Similarity=0.285  Sum_probs=194.1

Q ss_pred             hHHHHccCCCCccEEEccCCCCCCcHHHHHHHHhhCCCccEEEcCCCCCCChHHHHHHHHcCCCCcEEeccC--------
Q 023403            4 LVLSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISG--------   75 (282)
Q Consensus         4 ~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~--------   75 (282)
                      .++.++..+++|++|+++++  .+++..+..+...+++|++|++++  .+.+..+..+...|++|++|++.+        
T Consensus       284 ~l~~~~~~~~~L~~L~Ls~~--~l~~~~~~~~~~~~~~L~~L~L~~--~~~~~~l~~~~~~~~~L~~L~L~~g~~~~~~~  359 (592)
T 3ogk_B          284 EMPILFPFAAQIRKLDLLYA--LLETEDHCTLIQKCPNLEVLETRN--VIGDRGLEVLAQYCKQLKRLRIERGADEQGME  359 (592)
T ss_dssp             TGGGGGGGGGGCCEEEETTC--CCCHHHHHHHHTTCTTCCEEEEEG--GGHHHHHHHHHHHCTTCCEEEEECCCCSSTTS
T ss_pred             HHHHHHhhcCCCcEEecCCC--cCCHHHHHHHHHhCcCCCEEeccC--ccCHHHHHHHHHhCCCCCEEEeecCccccccc
Confidence            35566778899999999986  377777777778899999999994  467788888888899999999994        


Q ss_pred             --CCCCCHHHHHHHHHcCCCCeEEEecCCcccccHHHHHHHHHhCCCCCEEEec---CCCCCCH----HHHHHHHhcCCC
Q 023403           76 --CTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLNLG---WCEDVGD----VGVMNLAYGCPD  146 (282)
Q Consensus        76 --~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~l~~~~~~L~~L~l~---~~~~~~~----~~~~~l~~~~~~  146 (282)
                        |+.++...+..+...+++|+.|++..  +.+++..+..+...+++|++|++.   .|+.+++    .++..+...+++
T Consensus       360 ~~~~~~~~~~~~~l~~~~~~L~~L~l~~--~~l~~~~~~~l~~~~~~L~~L~l~~~~~~n~l~~~p~~~~~~~~~~~~~~  437 (592)
T 3ogk_B          360 DEEGLVSQRGLIALAQGCQELEYMAVYV--SDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKK  437 (592)
T ss_dssp             STTCCCCHHHHHHHHHHCTTCSEEEEEE--SCCCHHHHHHHHHHCCSCCEEEEEECSCCSCCSSCCCHHHHHHHHHHCTT
T ss_pred             cccCccCHHHHHHHHhhCccCeEEEeec--CCccHHHHHHHHhhCCCCcEEEEeecCCCccccCchHHHHHHHHHHhCCC
Confidence              78888888888777899999999954  348888888888889999999997   3556665    467777778999


Q ss_pred             CcEEEecCCC-ccCHHHHHHHHhcCCCCCEEeecCCCCCcHHHHHHHHhcCcCCCCcchhcccccCcccCcceEeccCCC
Q 023403          147 LRSLDLCGCV-CITDDSVIALANGCPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCT  225 (282)
Q Consensus       147 L~~L~l~~~~-~l~~~~l~~l~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  225 (282)
                      |++|++++|. .+++..+..+.+.+++|++|++++| .+++.++..+....                 ++|++|++++|+
T Consensus       438 L~~L~L~~~~~~l~~~~~~~~~~~~~~L~~L~L~~n-~l~~~~~~~~~~~~-----------------~~L~~L~l~~n~  499 (592)
T 3ogk_B          438 LRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYV-GESDEGLMEFSRGC-----------------PNLQKLEMRGCC  499 (592)
T ss_dssp             CCEEEEECCGGGCCHHHHHHHHHSCTTCCEEEECSC-CSSHHHHHHHHTCC-----------------TTCCEEEEESCC
T ss_pred             CCEEEEecCCCCccHHHHHHHHHhCccceEeeccCC-CCCHHHHHHHHhcC-----------------cccCeeeccCCC
Confidence            9999998764 4888888888888999999999987 48887777775543                 899999999987


Q ss_pred             CCCHHHHHHHHhhCCCCccCCCcceeeecCCCCccchhhccCCCCcCCc
Q 023403          226 ALTPPAVQALCDTFPALHTCSGRHSLVMSGCLNLTSVHCVCAGQSHRTA  274 (282)
Q Consensus       226 ~l~~~~~~~l~~~~~~l~~~~~L~~L~l~~c~~~~~~~~~~~~~~~~~~  274 (282)
                       +++.++..+..      .+++|++|++++|. +++..+.......|.+
T Consensus       500 -l~~~~~~~~~~------~l~~L~~L~ls~n~-it~~~~~~l~~~~p~l  540 (592)
T 3ogk_B          500 -FSERAIAAAVT------KLPSLRYLWVQGYR-ASMTGQDLMQMARPYW  540 (592)
T ss_dssp             -CBHHHHHHHHH------HCSSCCEEEEESCB-CCTTCTTGGGGCCTTE
T ss_pred             -CcHHHHHHHHH------hcCccCeeECcCCc-CCHHHHHHHHHhCCCc
Confidence             89988888876      45667999999999 8887665555555543

PyMOL of 3ogk

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		282
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-09
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	9e-05
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	0.004

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 54.7 bits (130), Expect = 2e-09
 Identities = 50/252 (19%), Positives = 86/252 (34%), Gaps = 24/252 (9%)

Query: 6   LSLAPKLTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGC 65
           L+      ++Q + L      +E + +  I + C  LQ+L L    +LSD  +  LA   
Sbjct: 39  LAEHFSPFRVQHMDLSNSV--IEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-N 94

Query: 66  PNLTRLNISGCTSFSDHALAYLCGFCRKLKILNLCGCVKAATDYALQAIGRNCNQLQSLN 125
            NL RLN+SGC+ FS+ AL  L   C +L  LNL  C      +   A+      +  LN
Sbjct: 95  SNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLN 154

Query: 126 LGWCEDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANGCPHLRSLGLYYCRNIT 185
           L           ++                  +  +          +L+ L L  C +I 
Sbjct: 155 LSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDII 214

Query: 186 DRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTC 245
              +  L +                     L++L +     +    +Q L +  P L   
Sbjct: 215 PETLLELGEI------------------PTLKTLQVFGI--VPDGTLQLLKEALPHLQIN 254

Query: 246 SGRHSLVMSGCL 257
               + +    +
Sbjct: 255 CSHFTTIARPTI 266

PyMOL of d2astb2

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		282
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.93
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.93
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.58
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.55
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.5
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.22
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.94
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.88
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.87
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.81
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.79
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.78
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	98.77
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.77
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.73
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.73
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	98.71
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	98.65
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.61
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.52
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.5
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	98.47
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.42
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.41
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.41
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.35
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.32
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.13
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.04
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.02
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	97.98
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	97.89
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	97.8
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.38
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	97.37
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	97.32
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.2
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	96.81
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	95.71
d2ifga3		156	High affinity nerve growth factor receptor, N-term	95.47
d2ifga3		156	High affinity nerve growth factor receptor, N-term	95.3
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	95.28

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=6.2e-25  Score=179.23  Aligned_cols=220  Identities=28%  Similarity=0.463  Sum_probs=152.0

Q ss_pred             CCCccEEEccCCCCCCcHHHHHHHHhhCCCccEEEcCCCCCCChHHHHHHHHcCCCCcEEeccCCCCCCHHHHHHHHHcC
Q 023403           12 LTKLQTLVLRQDKPQLEDNAVEAIANSCHDLQDLDLSKSFKLSDRSLYALAHGCPNLTRLNISGCTSFSDHALAYLCGFC   91 (282)
Q Consensus        12 ~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~   91 (282)
                      ..+|++|+++++  .+++..+..+...|++|++|.+++| .+++..+..+.. +++|++|++++|..+++..+..+...+
T Consensus        45 ~~~L~~LdLs~~--~i~~~~l~~l~~~c~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~~l~~~~  120 (284)
T d2astb2          45 PFRVQHMDLSNS--VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSC  120 (284)
T ss_dssp             CBCCCEEECTTC--EECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHHHHHHHC
T ss_pred             CCCCCEEECCCC--ccCHHHHHHHHHhCCCccccccccc-CCCcHHHHHHhc-CCCCcCccccccccccccccchhhHHH
Confidence            457778888765  5666677777777788888888876 466666666553 778888888877777777777766677


Q ss_pred             CCCeEEEecCCcccccHHHHHH-HHHhCCCCCEEEecCC-CCCCHHHHHHHHhcCCCCcEEEecCCCccCHHHHHHHHhc
Q 023403           92 RKLKILNLCGCVKAATDYALQA-IGRNCNQLQSLNLGWC-EDVGDVGVMNLAYGCPDLRSLDLCGCVCITDDSVIALANG  169 (282)
Q Consensus        92 ~~L~~L~l~~~~~~~~~~~~~~-l~~~~~~L~~L~l~~~-~~~~~~~~~~l~~~~~~L~~L~l~~~~~l~~~~l~~l~~~  169 (282)
                      ++|++|++++|.. ++++.+.. +...+++|++|++.+| ..+++.++..+...+|+|++|++++|..+++..+..+.+ 
T Consensus       121 ~~L~~L~ls~c~~-~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~-  198 (284)
T d2astb2         121 SRLDELNLSWCFD-FTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ-  198 (284)
T ss_dssp             TTCCEEECCCCTT-CCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGG-
T ss_pred             Hhccccccccccc-cccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcc-
Confidence            8888888887754 66665544 3334567888888765 346777777777777888888888777777776666653 


Q ss_pred             CCCCCEEeecCCCCCcHHHHHHHHhcCcCCCCcchhcccccCcccCcceEeccCCCCCCHHHHHHHHhhCCCCccCCCcc
Q 023403          170 CPHLRSLGLYYCRNITDRAIYSLAQSGVKNKPGIWESMKGRYDEEGLQSLNISQCTALTPPAVQALCDTFPALHTCSGRH  249 (282)
Q Consensus       170 ~~~L~~L~l~~~~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~l~~~~~L~  249 (282)
                      +++|++|++++|..+++.++..+++.                  ++|++|++.+|  +++.++..+.+.+|++      +
T Consensus       199 ~~~L~~L~L~~C~~i~~~~l~~L~~~------------------~~L~~L~l~~~--~~d~~l~~l~~~lp~L------~  252 (284)
T d2astb2         199 LNYLQHLSLSRCYDIIPETLLELGEI------------------PTLKTLQVFGI--VPDGTLQLLKEALPHL------Q  252 (284)
T ss_dssp             CTTCCEEECTTCTTCCGGGGGGGGGC------------------TTCCEEECTTS--SCTTCHHHHHHHSTTS------E
T ss_pred             cCcCCEEECCCCCCCChHHHHHHhcC------------------CCCCEEeeeCC--CCHHHHHHHHHhCccc------c
Confidence            77888888888777776665555432                  77888888776  6777777777655544      3


Q ss_pred             eeeecCCCCccchhhccC
Q 023403          250 SLVMSGCLNLTSVHCVCA  267 (282)
Q Consensus       250 ~L~l~~c~~~~~~~~~~~  267 (282)
                         + +|..++++..+..
T Consensus       253 ---i-~~~~ls~~~~~~~  266 (284)
T d2astb2         253 ---I-NCSHFTTIARPTI  266 (284)
T ss_dssp             ---E-SCCCSCCTTCSSC
T ss_pred             ---c-cCccCCCCCCCcc
Confidence               2 4566666554433

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure