Citrus Sinensis ID: 023405

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MGKQKKSRVSHEEEELNQENLNRSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK
cccccccccccHHHHHHHHHHccccccccccHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccc
ccccccccccccHHcccHHHHHHcccccccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccHHHccccc
mgkqkksrvSHEEEELNqenlnrsssndkdlYEVLGVERTASQQEIKKAYYKLALRlhpdknpgdeEAKEKFQQLQKVISILGDEEKralydqtgcvddadlaGDVVQNLKEFFGAMYKKVTEADIEEFeanyrgsdsekKDLIDLYKKYKGNMNRLFCSMlcsdqkldshrFKDILDETIAAGELKATKAYQKWAKKvsetkpptsplkrkaksnkqsESDLYAVISERrsdrkdrfDSMFSSLVSkyggaaagseptdEEFEAAQKKIENRRaskksrrk
mgkqkksrvsheeeelnqenlnrsssndkdLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEfeanyrgsdsekkdLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWakkvsetkpptsplkrkaksnkqsesdlyaviserrsdrkdrfDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKienrraskksrrk
MGKQKKSRVsheeeelnqenlnrsssnDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEkkdlidlykkykGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK
*******************************YEVLGV*******EIKKAYYKLALRL*****************LQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYR******KDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKW***************************************************************************************
**************************NDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKN*****AKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVT***************SEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKA*******************************************************************************************
**********************RSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAY***************************ESDLYAVISERRSDRKDRFDSMFSSLVSK**********************************
****************NQENLNRSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETK****************ESDLYAVISERRSDRKDRFDSMFSSLVSKYGGA******************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKQKKSRVSHEEEELNQENLNRSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q9FL54284 Chaperone protein dnaJ 6 no no 0.989 0.982 0.655 7e-97
Q91WN1259 DnaJ homolog subfamily C yes no 0.812 0.884 0.317 6e-30
Q8WXX5260 DnaJ homolog subfamily C yes no 0.776 0.842 0.331 4e-29
Q9VGR7299 J domain-containing prote yes no 0.783 0.739 0.336 9e-28
Q9UTQ5282 Uncharacterized J domain- yes no 0.574 0.574 0.331 4e-17
Q8RB67 384 Chaperone protein DnaJ OS yes no 0.237 0.174 0.611 8e-17
Q9QYI7227 DnaJ homolog subfamily B no no 0.453 0.563 0.4 2e-16
A5CD86 377 Chaperone protein DnaJ OS yes no 0.241 0.180 0.573 4e-16
B8F7S3 378 Chaperone protein DnaJ OS yes no 0.237 0.177 0.582 4e-16
A1KR91 373 Chaperone protein DnaJ OS yes no 0.244 0.184 0.565 4e-16
>sp|Q9FL54|DNAJ6_ARATH Chaperone protein dnaJ 6 OS=Arabidopsis thaliana GN=ATJ6 PE=1 SV=1 Back     alignment and function desciption
 Score =  353 bits (906), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 188/287 (65%), Positives = 234/287 (81%), Gaps = 8/287 (2%)

Query: 1   MGKQKKSRVSH-EEEELNQENLNRSSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHP 59
           MG++KKSR S  EE+E+  +N   SS  +  LYEVLGVER A+ QEI+KAY+KLAL+LHP
Sbjct: 1   MGRKKKSRASTTEEDEIEMDNAGPSS--ETSLYEVLGVERRATSQEIRKAYHKLALKLHP 58

Query: 60  DKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLKEFFGAMYK 119
           DKN  D+EAK+KFQQLQKVISILGDEEKRA+YDQTG +DDAD+ GD  +NL++FF  MYK
Sbjct: 59  DKNQDDKEAKDKFQQLQKVISILGDEEKRAVYDQTGSIDDADIPGDAFENLRDFFRDMYK 118

Query: 120 KVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDE 179
           KV EADIEEFEANYRGS+SEKKDL++L+ K+KG MNRLFCSMLCSD KLDSHRFKD+LDE
Sbjct: 119 KVNEADIEEFEANYRGSESEKKDLLELFNKFKGKMNRLFCSMLCSDPKLDSHRFKDMLDE 178

Query: 180 TIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQ---SESDLYAVISERRSDRKD 236
            IAAGE+K++KAY+KWA K+SETKPPTSPL+++ K       SE+DL  +I++R+ +RK 
Sbjct: 179 AIAAGEVKSSKAYEKWANKISETKPPTSPLRKRKKKKSAAKDSETDLCLMIAKRQEERKG 238

Query: 237 RFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIEN-RRASKKSRRK 282
           + DSMFSSL+S+YGG A      +E  EAAQ++IE+ R+ SKKSR K
Sbjct: 239 KVDSMFSSLISRYGGDAEAEPTEEEF-EAAQRRIESKRKPSKKSRGK 284
Have a continuous role in plant development probably in the structural organization of compartments.
Arabidopsis thaliana (taxid: 3702)
>sp|Q91WN1|DNJC9_MOUSE DnaJ homolog subfamily C member 9 OS=Mus musculus GN=Dnajc9 PE=2 SV=2 Back     alignment and function description
>sp|Q8WXX5|DNJC9_HUMAN DnaJ homolog subfamily C member 9 OS=Homo sapiens GN=DNAJC9 PE=1 SV=1 Back     alignment and function description
>sp|Q9VGR7|Y6693_DROME J domain-containing protein CG6693 OS=Drosophila melanogaster GN=CG6693 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTQ5|YL39_SCHPO Uncharacterized J domain-containing protein C1071.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1071.09c PE=3 SV=1 Back     alignment and function description
>sp|Q8RB67|DNAJ_THETN Chaperone protein DnaJ OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 Back     alignment and function description
>sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / FAM18) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
147843683 973 hypothetical protein VITISV_040411 [Viti 1.0 0.289 0.800 1e-131
225441724291 PREDICTED: chaperone protein dnaJ 6 [Vit 1.0 0.969 0.800 1e-131
449437611282 PREDICTED: chaperone protein dnaJ 6-like 0.960 0.960 0.816 1e-125
449501888282 PREDICTED: chaperone protein dnaJ 6-like 0.960 0.960 0.813 1e-124
356500485280 PREDICTED: chaperone protein dnaJ 6-like 0.989 0.996 0.784 1e-124
224137970292 predicted protein [Populus trichocarpa] 0.932 0.900 0.795 1e-119
255571604258 Chaperone protein dnaJ, putative [Ricinu 0.843 0.922 0.882 1e-119
357509793275 Chaperone protein dnaJ [Medicago truncat 0.925 0.949 0.808 1e-119
356572054278 PREDICTED: chaperone protein dnaJ 6-like 0.968 0.982 0.769 1e-118
224120374287 predicted protein [Populus trichocarpa] 1.0 0.982 0.759 1e-118
>gi|147843683|emb|CAN81991.1| hypothetical protein VITISV_040411 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 233/291 (80%), Positives = 259/291 (89%), Gaps = 9/291 (3%)

Query: 1   MGKQKKSRVS----HEEEELNQ-----ENLNRSSSNDKDLYEVLGVERTASQQEIKKAYY 51
           MGK+KK+RVS     E+E + Q     E +++SS+N++ LYEVLGVE+TASQQEIKKAYY
Sbjct: 1   MGKKKKTRVSDNIAEEKEYVGQSSKEEEYVSQSSTNERSLYEVLGVEKTASQQEIKKAYY 60

Query: 52  KLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGDVVQNLK 111
           KLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAG+VVQNL 
Sbjct: 61  KLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAGEVVQNLH 120

Query: 112 EFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSH 171
           EFF  MYKKVTEADIEEFEANYRGSDSEK DLIDLYKK KGNMNRLFCSMLCSD KLDSH
Sbjct: 121 EFFRTMYKKVTEADIEEFEANYRGSDSEKNDLIDLYKKCKGNMNRLFCSMLCSDPKLDSH 180

Query: 172 RFKDILDETIAAGELKATKAYQKWAKKVSETKPPTSPLKRKAKSNKQSESDLYAVISERR 231
           RFKDILDE I AGELKATK YQKWAK+VSE KPPTSPL+++ KSNK+SESDL A+IS RR
Sbjct: 181 RFKDILDEAIXAGELKATKVYQKWAKQVSEAKPPTSPLRKRGKSNKESESDLLAIISXRR 240

Query: 232 SDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQKKIENRRASKKSRRK 282
           S+RKDRFDSMFSSLVSKYGG+   SEPT+EEFEA Q+K+E+ +ASKKS+RK
Sbjct: 241 SERKDRFDSMFSSLVSKYGGSGQVSEPTEEEFEATQRKLESLKASKKSKRK 291

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225441724|ref|XP_002283060.1| PREDICTED: chaperone protein dnaJ 6 [Vitis vinifera] gi|297739705|emb|CBI29887.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449437611|ref|XP_004136585.1| PREDICTED: chaperone protein dnaJ 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449501888|ref|XP_004161485.1| PREDICTED: chaperone protein dnaJ 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356500485|ref|XP_003519062.1| PREDICTED: chaperone protein dnaJ 6-like [Glycine max] Back     alignment and taxonomy information
>gi|224137970|ref|XP_002322697.1| predicted protein [Populus trichocarpa] gi|222867327|gb|EEF04458.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255571604|ref|XP_002526748.1| Chaperone protein dnaJ, putative [Ricinus communis] gi|223533937|gb|EEF35662.1| Chaperone protein dnaJ, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357509793|ref|XP_003625185.1| Chaperone protein dnaJ [Medicago truncatula] gi|124360117|gb|ABN08133.1| Heat shock protein DnaJ [Medicago truncatula] gi|355500200|gb|AES81403.1| Chaperone protein dnaJ [Medicago truncatula] gi|388492410|gb|AFK34271.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356572054|ref|XP_003554185.1| PREDICTED: chaperone protein dnaJ 6-like [Glycine max] Back     alignment and taxonomy information
>gi|224120374|ref|XP_002331032.1| predicted protein [Populus trichocarpa] gi|222872962|gb|EEF10093.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2082189262 AT3G12170 [Arabidopsis thalian 0.900 0.969 0.709 1.1e-94
TAIR|locus:2169449284 ATJ6 "AT5G06910" [Arabidopsis 0.992 0.985 0.639 5.7e-91
UNIPROTKB|E1C8S9260 DNAJC9 "Uncharacterized protei 0.812 0.880 0.366 6.5e-35
ZFIN|ZDB-GENE-040718-130252 dnajc9 "DnaJ (Hsp40) homolog, 0.804 0.900 0.370 8.3e-35
FB|FBgn0037878299 CG6693 [Drosophila melanogaste 0.893 0.842 0.310 1e-29
UNIPROTKB|F1MTK0261 DNAJC9 "Uncharacterized protei 0.769 0.831 0.350 1e-29
MGI|MGI:1915326259 Dnajc9 "DnaJ (Hsp40) homolog, 0.808 0.880 0.325 1e-29
UNIPROTKB|Q8WXX5260 DNAJC9 "DnaJ homolog subfamily 0.797 0.865 0.331 1.3e-29
RGD|1305009259 Dnajc9 "DnaJ (Hsp40) homolog, 0.801 0.872 0.323 1.9e-28
UNIPROTKB|G4NCV1324 MGG_01016 "Chaperone dnaJ 6" [ 0.595 0.518 0.348 8.4e-28
TAIR|locus:2082189 AT3G12170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 942 (336.7 bits), Expect = 1.1e-94, P = 1.1e-94
 Identities = 181/255 (70%), Positives = 219/255 (85%)

Query:    28 DKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEK 87
             +K+LYEVLGVE TAS QEI+KAY+KLALRLHPDKN  DE+AKEKFQQLQKVISILGDEEK
Sbjct:     9 EKNLYEVLGVEATASPQEIRKAYHKLALRLHPDKNKDDEDAKEKFQQLQKVISILGDEEK 68

Query:    88 RALYDQTGCVDDADLAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEXXXXXXXX 147
             RA+YDQTG VDDADL+GDVV NL++FF AMYKKVTE DIEEFEANYRGS+SE        
Sbjct:    69 RAVYDQTGSVDDADLSGDVVDNLRDFFKAMYKKVTEEDIEEFEANYRGSESEKNDLIELY 128

Query:   148 XXXXGNMNRLFCSMLCSDQKLDSHRFKDILDETIAAGELKATKAYQKWAKKVSETKPPTS 207
                 G M+RLFCSMLCS+ KLDSHRFKDI+DE IAAGE+K+TKAY+KWAK+++E +PPT+
Sbjct:   129 NKFKGKMSRLFCSMLCSNPKLDSHRFKDIIDEAIAAGEVKSTKAYKKWAKEIAEMEPPTN 188

Query:   208 PLKRKAKSNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEPTDEEFEAAQ 267
             P K + K+ K ++ DLYAV+S+R  +RK++FDSMFSSLVS+YG + A SEP +EEFEAAQ
Sbjct:   189 PQKMRRKAAKAADKDLYAVMSQRGDERKEKFDSMFSSLVSRYG-SNADSEPNEEEFEAAQ 247

Query:   268 KKIENRRASKKSRRK 282
             +K+E+RR+SKKSR+K
Sbjct:   248 RKVESRRSSKKSRKK 262
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
TAIR|locus:2169449 ATJ6 "AT5G06910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8S9 DNAJC9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-130 dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0037878 CG6693 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTK0 DNAJC9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915326 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WXX5 DNAJC9 "DnaJ homolog subfamily C member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305009 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G4NCV1 MGG_01016 "Chaperone dnaJ 6" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91WN1DNJC9_MOUSENo assigned EC number0.31790.81200.8841yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 5e-28
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-26
pfam0022663 pfam00226, DnaJ, DnaJ domain 1e-26
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 7e-23
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 6e-22
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 7e-22
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 7e-22
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-21
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-21
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 4e-21
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-20
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 4e-20
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 5e-20
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 8e-20
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 1e-19
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-19
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-19
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-18
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-18
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 6e-18
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 2e-17
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-17
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-16
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-16
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-16
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 5e-15
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 6e-15
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 8e-15
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-14
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-13
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-13
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-13
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 5e-13
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 2e-12
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 9e-11
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 3e-09
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 5e-09
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 3e-07
PTZ00341 1136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 6e-04
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  110 bits (277), Expect = 5e-28
 Identities = 39/67 (58%), Positives = 53/67 (79%)

Query: 29 KDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKR 88
          +D YE+LGV + AS++EIKKAY KLA + HPD+NPGD+EA+EKF+++ +   +L D EKR
Sbjct: 4  RDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPEKR 63

Query: 89 ALYDQTG 95
          A YDQ G
Sbjct: 64 AAYDQFG 70

Length = 371
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.94
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.9
PRK14288 369 chaperone protein DnaJ; Provisional 99.87
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.86
PRK14296 372 chaperone protein DnaJ; Provisional 99.86
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.84
PRK14286372 chaperone protein DnaJ; Provisional 99.84
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.84
PRK14287 371 chaperone protein DnaJ; Provisional 99.84
PRK14285365 chaperone protein DnaJ; Provisional 99.83
PRK14276 380 chaperone protein DnaJ; Provisional 99.83
PRK14298 377 chaperone protein DnaJ; Provisional 99.83
PRK14294366 chaperone protein DnaJ; Provisional 99.82
PRK14297 380 chaperone protein DnaJ; Provisional 99.82
PRK14301 373 chaperone protein DnaJ; Provisional 99.82
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.81
PRK10767 371 chaperone protein DnaJ; Provisional 99.81
PRK14299291 chaperone protein DnaJ; Provisional 99.81
PRK14282369 chaperone protein DnaJ; Provisional 99.81
PRK14280 376 chaperone protein DnaJ; Provisional 99.8
PRK14278 378 chaperone protein DnaJ; Provisional 99.8
PRK14291 382 chaperone protein DnaJ; Provisional 99.8
PRK14279 392 chaperone protein DnaJ; Provisional 99.79
PRK14277 386 chaperone protein DnaJ; Provisional 99.79
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.79
PRK14295 389 chaperone protein DnaJ; Provisional 99.79
PRK14283 378 chaperone protein DnaJ; Provisional 99.79
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.78
PRK14281 397 chaperone protein DnaJ; Provisional 99.77
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
PRK14290365 chaperone protein DnaJ; Provisional 99.77
PRK14292 371 chaperone protein DnaJ; Provisional 99.75
PRK14284 391 chaperone protein DnaJ; Provisional 99.75
PRK14289 386 chaperone protein DnaJ; Provisional 99.74
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.74
PRK14293 374 chaperone protein DnaJ; Provisional 99.73
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.73
PRK14300 372 chaperone protein DnaJ; Provisional 99.72
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.64
PHA03102153 Small T antigen; Reviewed 99.63
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.62
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.62
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.61
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
PHA02624 647 large T antigen; Provisional 99.57
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.5
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.5
PRK05014171 hscB co-chaperone HscB; Provisional 99.48
PRK01356166 hscB co-chaperone HscB; Provisional 99.46
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.45
PRK00294173 hscB co-chaperone HscB; Provisional 99.44
PRK03578176 hscB co-chaperone HscB; Provisional 99.43
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.42
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.34
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.33
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.21
PTZ00100116 DnaJ chaperone protein; Provisional 99.16
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.09
PRK01773173 hscB co-chaperone HscB; Provisional 99.07
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.05
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.93
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.02
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.95
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.21
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.82
KOG0431453 consensus Auxilin-like protein and related protein 96.36
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.95
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.5
KOG0724335 consensus Zuotin and related molecular chaperones 91.41
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 86.84
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-57  Score=400.48  Aligned_cols=247  Identities=58%  Similarity=0.912  Sum_probs=220.3

Q ss_pred             CCCCccccccccCccCCCCHHHHHHHHHHHHHHhCCCCCCC--chHHHHHHHHHHHHHHhcCChhHHHhhhccCCCCCCC
Q 023405           24 SSSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPG--DEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDAD  101 (282)
Q Consensus        24 ~~~~~~d~Y~vLgv~~~as~~eIKkAYrklal~~HPDk~~~--~~~a~~~F~~I~~AY~iLsdp~~R~~YD~~G~~~~~~  101 (282)
                      .+....|+|+||||.++||..+|++|||+|+|+||||+++.  ..+|+++||+|+.||+||+|.++|+.||++|.+++  
T Consensus         9 ~~f~~~d~YevLGVer~a~~~eIrkAY~klal~~HPDk~~eed~~ea~~kFq~l~k~y~iLsDeekR~~YDetG~idd--   86 (264)
T KOG0719|consen    9 GSFNKKDLYEVLGVERDATDKEIRKAYHKLALRLHPDKNHEEDKVEATEKFQQLQKAYQILSDEEKRAVYDETGSIDD--   86 (264)
T ss_pred             ccccccCHHHHhhhcccCCHHHHHHHHHHHHHHhCCCcchhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHhccCCCCC--
Confidence            34556799999999999999999999999999999999963  24799999999999999999999999999999973  


Q ss_pred             cCCcccccHHHHHHHhhccCCHHHHHhhhhccCCCchhhhHHHHHHHHhcChhhHHHhhhcccCccCChHHHHHHHHHHH
Q 023405          102 LAGDVVQNLKEFFGAMYKKVTEADIEEFEANYRGSDSEKKDLIDLYKKYKGNMNRLFCSMLCSDQKLDSHRFKDILDETI  181 (282)
Q Consensus       102 ~~~~~~~~~~~~f~~~f~~~t~~~i~~f~~~yrgs~ee~~dl~~~y~~~~G~~~~i~~~v~~s~~~~de~R~~~ii~~~I  181 (282)
                      .+++-+.+|.+||+.+|..||.++|++|...|+||++|+.||+.+|+.++|+|.+||++||||++. |++||++||+.+|
T Consensus        87 ~~~d~~~~~~e~~~~iyk~VteedIeef~a~Y~gSEeEk~Dl~~~Y~k~kG~m~~i~~~~l~~d~~-De~R~keiid~~I  165 (264)
T KOG0719|consen   87 ESGDIDEDWLEFWRAIYKKVTEEDIEEFEANYQGSEEEKKDLLKLYNKFKGKMNRILESVLCSDPK-DEDRFKEIIDEAI  165 (264)
T ss_pred             ccchhhhHHHHHHHHHHhhcccccHHHHHHHhcccHHHHHHHHHHHHhcCChHHHHHHhhhcCCcc-cHHHHHHHHHHHH
Confidence            567778899999999999999999999999999999999999999999999999999999999999 9999999999999


Q ss_pred             HcCCCcchhhhHHHHhhhhcCCCCCChhhhhh-h--hhcCChhHHHHHHHHHHHhhHHhHHHHHHHHHHHhCCCCCCCCC
Q 023405          182 AAGELKATKAYQKWAKKVSETKPPTSPLKRKA-K--SNKQSESDLYAVISERRSDRKDRFDSMFSSLVSKYGGAAAGSEP  258 (282)
Q Consensus       182 ~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-k--~~k~~~~~L~~li~~r~~~r~~~~~~~~~~Le~Ky~~~~~~~ep  258 (282)
                      .+|+|+.|++|.+|+++. +.++.+.++..+. +  .++....||.++|++|+..|+.++++||++|++||++. ..++|
T Consensus       166 ~~Gev~~yK~y~~~~~~~-K~r~~~~~re~r~ak~~~~~~~~~DL~~~i~~r~~eRk~~~~sl~~SL~~kY~~~-~~s~~  243 (264)
T KOG0719|consen  166 ADGEVKKYKAYEKWASEK-KMRAPKKAREKREAKVLAAKDNGIDLDAMIEKRGGERKGKFDSLLDSLEEKYGGN-ADSKP  243 (264)
T ss_pred             hcCCchhhhhcccchhhh-hhccccchHHHHHHHHHHHHhcCccHHHHHHHHhhhhhhhHHHHHHHHHHHhccc-cccch
Confidence            999999999999999876 4444433332222 2  24556779999999999999999999999999999987 55689


Q ss_pred             CHHHHHHHHHHHhhchh
Q 023405          259 TDEEFEAAQKKIENRRA  275 (282)
Q Consensus       259 ~~e~F~~~~~~~~~~~~  275 (282)
                      ..++|.++|++.+.+++
T Consensus       244 ~~~~~~aa~~~~ksk~~  260 (264)
T KOG0719|consen  244 EREEFEAAQRPKKSKRS  260 (264)
T ss_pred             hhhhhhhhcCccccccc
Confidence            99999999999877654

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-16
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-15
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-15
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-15
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 4e-15
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 8e-14
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 3e-13
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 4e-13
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-12
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-12
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-12
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 7e-12
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 8e-12
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 1e-11
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 2e-11
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 8e-11
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 9e-11
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-09
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 2e-08
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 4e-08
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-07
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 7e-07
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 1e-06
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 2e-05
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 3e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 3e-05
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 81.6 bits (200), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/68 (55%), Positives = 53/68 (77%), Gaps = 1/68 (1%)
Query: 30 DLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGD-EEAKEKFQQLQKVISILGDEEKR 88
          + YEVLGV+ +AS ++IKKAY KLALR HPDKNP + EEA++KF+ + +   +L D +KR
Sbjct: 10 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKR 69
Query: 89 ALYDQTGC 96
          +LYD+ GC
Sbjct: 70 SLYDRAGC 77
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-27
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 4e-27
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-27
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 7e-27
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-26
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-26
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-26
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 6e-26
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-24
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-24
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 5e-24
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 2e-23
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-23
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 4e-23
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-22
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 2e-22
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-22
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 4e-22
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 3e-21
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 6e-21
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 8e-21
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-20
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 9e-19
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-15
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 6e-11
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 8e-10
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 6e-09
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 6e-08
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-06
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-06
2guz_A71 Mitochondrial import inner membrane translocase su 5e-06
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 1e-05
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
 Score =  104 bits (260), Expect = 2e-27
 Identities = 30/67 (44%), Positives = 46/67 (68%)

Query: 29 KDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKR 88
          ++ Y +LGV +TAS +EI++A+ KLAL+LHPDKNP +  A   F ++ +   +L DE+ R
Sbjct: 2  QNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLR 61

Query: 89 ALYDQTG 95
            YD+ G
Sbjct: 62 KKYDKYG 68
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.85
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.85
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.85
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.84
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.83
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.83
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.82
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.82
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.82
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.82
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.82
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.82
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.81
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.81
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.81
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.79
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.78
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.78
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.75
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.75
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.73
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.71
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.7
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.67
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.67
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.65
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.65
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.64
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.63
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.62
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.61
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.59
2guz_A71 Mitochondrial import inner membrane translocase su 99.52
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.0
2guz_B65 Mitochondrial import inner membrane translocase su 98.5
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 87.51
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
Probab=99.85  E-value=4.1e-22  Score=159.37  Aligned_cols=91  Identities=38%  Similarity=0.659  Sum_probs=76.3

Q ss_pred             CCCccccccccCccCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHhcCChhHHHhhhccCCCCCCCcCC
Q 023405           25 SSNDKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCVDDADLAG  104 (282)
Q Consensus        25 ~~~~~d~Y~vLgv~~~as~~eIKkAYrklal~~HPDk~~~~~~a~~~F~~I~~AY~iLsdp~~R~~YD~~G~~~~~~~~~  104 (282)
                      .....+||+||||+++|+.++||+|||+|+++||||+++..+.+.+.|+.|+.||+||+||.+|..||.+|.........
T Consensus        13 ~~~~~~~Y~vLgv~~~as~~eIk~aYr~la~~~HPDk~~~~~~a~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~~~~~~   92 (109)
T 2ctw_A           13 STSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQ   92 (109)
T ss_dssp             TSCSCCHHHHHTCCTTCCHHHHHHHHHHHHHHSCTTTSTTCHHHHHHHHHHHHHHHHHTCHHHHHHHHHTCHHHHHHHHH
T ss_pred             CCCCCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHcCHHHHHHHHHhcccccccccc
Confidence            34568999999999999999999999999999999999888889999999999999999999999999998642211111


Q ss_pred             cccccHHHHHH
Q 023405          105 DVVQNLKEFFG  115 (282)
Q Consensus       105 ~~~~~~~~~f~  115 (282)
                      .+..+|..||.
T Consensus        93 ~~~~~~~~~~~  103 (109)
T 2ctw_A           93 FGEENVNTYFV  103 (109)
T ss_dssp             TCTTHHHHHHH
T ss_pred             cCCcchHHHhh
Confidence            22357777774
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-16
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 1e-14
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-14
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 3e-13
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 5e-13
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-11
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-11
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-11
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

 Score = 70.8 bits (173), Expect = 1e-16
 Identities = 34/67 (50%), Positives = 53/67 (79%)

Query: 29 KDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKR 88
          +D YE+LGV +TA ++EI+KAY +LA++ HPD+N GD+EA+ KF+++++   +L D +KR
Sbjct: 3  QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKR 62

Query: 89 ALYDQTG 95
          A YDQ G
Sbjct: 63 AAYDQYG 69
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.88
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.83
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.81
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.69
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.67
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.65
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.62
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.88  E-value=1.4e-23  Score=155.72  Aligned_cols=70  Identities=49%  Similarity=0.884  Sum_probs=66.8

Q ss_pred             ccccccccCccCCCCHHHHHHHHHHHHHHhCCCCCCCchHHHHHHHHHHHHHHhcCChhHHHhhhccCCC
Q 023405           28 DKDLYEVLGVERTASQQEIKKAYYKLALRLHPDKNPGDEEAKEKFQQLQKVISILGDEEKRALYDQTGCV   97 (282)
Q Consensus        28 ~~d~Y~vLgv~~~as~~eIKkAYrklal~~HPDk~~~~~~a~~~F~~I~~AY~iLsdp~~R~~YD~~G~~   97 (282)
                      ..|||+||||+++||.++||+|||+|+++||||++++++.+...|+.|+.||+||+||.+|..||.+|..
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~   71 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence            4799999999999999999999999999999999988888999999999999999999999999999863
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure