Citrus Sinensis ID: 023407

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKRSDACAVI
ccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcc
cccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHccEcc
MDSEGTQQAHLVLAHKRFllthpdvqdiekvglkGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFeeggdwerknRLKVYEGLYCMSTRNFKKAASLFLDSistfttyelfpydtfIFYTVLTSIISLdrvslkqkvvdapeiltviGKIPYLSEFLNSLYDCQYKSFFSafgekrsdacavi
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEEnlgesevreaHLAKSLFYIQIGDKEKALEQLKVTesktvavgqkMDLVFYTLQLGFFYMDFDLISKSIDKAKSLfeeggdwerknrLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKRSDACAVI
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKRSDACAVI
*********HLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEM*************************************AHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFG**********
**SEGTQQAHLVLAHKRFLLTHP********GLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIE**********************REAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLF*****WERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKRSDACAVI
********AHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEK********
*****TQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKRSDACAVI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKRSDACAVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q93Y35 387 Probable 26S proteasome n yes no 0.957 0.697 0.818 1e-130
Q8W425 389 26S proteasome non-ATPase yes no 0.950 0.688 0.809 1e-127
Q3T0B2 389 26S proteasome non-ATPase yes no 0.957 0.694 0.476 1e-72
Q99JI4 389 26S proteasome non-ATPase yes no 0.957 0.694 0.476 3e-72
Q15008 389 26S proteasome non-ATPase yes no 0.957 0.694 0.472 7e-72
Q9V3G7 389 26S proteasome non-ATPase yes no 0.921 0.668 0.450 1e-63
Q55C75 382 26S proteasome non-ATPase yes no 0.822 0.607 0.478 3e-63
Q20585 410 26S proteasome non-ATPase yes no 0.914 0.629 0.431 1e-55
Q10335 409 Probable 26S proteasome r yes no 0.964 0.665 0.367 3e-48
Q06103 429 26S proteasome regulatory yes no 0.861 0.566 0.334 1e-37
>sp|Q93Y35|PSMD6_ARATH Probable 26S proteasome non-ATPase regulatory subunit 6 OS=Arabidopsis thaliana GN=At4g24820 PE=2 SV=1 Back     alignment and function desciption
 Score =  466 bits (1198), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/270 (81%), Positives = 250/270 (92%)

Query: 3   SEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMD 62
           +EG+QQ HL+LA+K FLLTHPDV DIEKV LK EV   +++H MA  YETL+A SVL++D
Sbjct: 5   AEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSEVLDFIRSHGMAPLYETLIASSVLDLD 64

Query: 63  QSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKV 122
           QS+L+SMR   E+ELKKLD++IADAEENLGESEVREAHLAK+L++I+I DKEKALEQLK+
Sbjct: 65  QSLLESMRAANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLKL 124

Query: 123 TESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGL 182
           TE KTVAVGQKMD+VFYTLQL FFYMDFDL+SKSIDKAK LFEEGGDWERKNRLKVYEGL
Sbjct: 125 TEGKTVAVGQKMDVVFYTLQLAFFYMDFDLVSKSIDKAKKLFEEGGDWERKNRLKVYEGL 184

Query: 183 YCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEI 242
           YCMSTRNFKKAASLFLDSISTFTTYE+FPY+TFIFYTVLTSII+LDRVSLKQKVVDAPEI
Sbjct: 185 YCMSTRNFKKAASLFLDSISTFTTYEIFPYETFIFYTVLTSIITLDRVSLKQKVVDAPEI 244

Query: 243 LTVIGKIPYLSEFLNSLYDCQYKSFFSAFG 272
           LTV+GKIP+LSEFLNSLY+CQYK+FFSAF 
Sbjct: 245 LTVLGKIPFLSEFLNSLYECQYKAFFSAFA 274
Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8W425|PSMD6_ORYSJ 26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1 Back     alignment and function description
>sp|Q3T0B2|PSMD6_BOVIN 26S proteasome non-ATPase regulatory subunit 6 OS=Bos taurus GN=PSMD6 PE=2 SV=1 Back     alignment and function description
>sp|Q99JI4|PSMD6_MOUSE 26S proteasome non-ATPase regulatory subunit 6 OS=Mus musculus GN=Psmd6 PE=1 SV=1 Back     alignment and function description
>sp|Q15008|PSMD6_HUMAN 26S proteasome non-ATPase regulatory subunit 6 OS=Homo sapiens GN=PSMD6 PE=1 SV=1 Back     alignment and function description
>sp|Q9V3G7|PSMD6_DROME 26S proteasome non-ATPase regulatory subunit 6 OS=Drosophila melanogaster GN=Rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q55C75|PSMD6_DICDI 26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=1 SV=1 Back     alignment and function description
>sp|Q20585|PSMD6_CAEEL 26S proteasome non-ATPase regulatory subunit 6 OS=Caenorhabditis elegans GN=rpn-7 PE=3 SV=1 Back     alignment and function description
>sp|Q10335|RPN7_SCHPO Probable 26S proteasome regulatory subunit rpn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn7 PE=2 SV=1 Back     alignment and function description
>sp|Q06103|RPN7_YEAST 26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN7 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
225457441 386 PREDICTED: 26S proteasome non-ATPase reg 0.953 0.696 0.907 1e-139
255540369 386 26S proteasome non-atpase regulatory sub 0.953 0.696 0.892 1e-137
224133850 386 predicted protein [Populus trichocarpa] 0.964 0.704 0.879 1e-135
449469610 386 PREDICTED: probable 26S proteasome non-A 0.953 0.696 0.877 1e-134
307136119 386 26S proteasome non-ATPase regulatory sub 0.953 0.696 0.869 1e-133
224119590 386 predicted protein [Populus trichocarpa] 0.960 0.702 0.867 1e-133
449487714 386 PREDICTED: LOW QUALITY PROTEIN: probable 0.953 0.696 0.869 1e-132
4678261 406 putative proteasome regulatory subunit [ 0.960 0.667 0.819 1e-129
18416433 387 26S proteasome regulatory subunit N7 [Ar 0.957 0.697 0.818 1e-129
297799516 387 hypothetical protein ARALYDRAFT_492356 [ 0.957 0.697 0.822 1e-128
>gi|225457441|ref|XP_002262921.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 6 [Vitis vinifera] gi|297733617|emb|CBI14864.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 244/269 (90%), Positives = 255/269 (94%)

Query: 4   EGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQ 63
           +GTQQ HLVLAHK FLLTHPD QDIEKV LK EVF+ VK  DMAS YETL A+SVLEMDQ
Sbjct: 5   DGTQQPHLVLAHKLFLLTHPDAQDIEKVRLKEEVFAAVKVDDMASLYETLAADSVLEMDQ 64

Query: 64  SVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVT 123
           +VLD+MR KI+DELKKLD++IADAEENLGESEVREAHLAKSLFYI+IGDKEKALEQLKVT
Sbjct: 65  AVLDTMRAKIDDELKKLDEKIADAEENLGESEVREAHLAKSLFYIRIGDKEKALEQLKVT 124

Query: 124 ESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLY 183
           ESKTVAVGQKMDLVFYTL LGFFYMDFDLISKSIDKAK+LFEEGGDWERKNRLKVYEGLY
Sbjct: 125 ESKTVAVGQKMDLVFYTLLLGFFYMDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLY 184

Query: 184 CMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL 243
           CMSTRNFKKAA+LFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL
Sbjct: 185 CMSTRNFKKAANLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL 244

Query: 244 TVIGKIPYLSEFLNSLYDCQYKSFFSAFG 272
            VIGKIPYLSEFLNSLYDCQYKSFFSAF 
Sbjct: 245 AVIGKIPYLSEFLNSLYDCQYKSFFSAFA 273

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255540369|ref|XP_002511249.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] gi|223550364|gb|EEF51851.1| 26S proteasome non-atpase regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224133850|ref|XP_002321676.1| predicted protein [Populus trichocarpa] gi|222868672|gb|EEF05803.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469610|ref|XP_004152512.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136119|gb|ADN33965.1| 26S proteasome non-ATPase regulatory subunit [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|224119590|ref|XP_002318111.1| predicted protein [Populus trichocarpa] gi|222858784|gb|EEE96331.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449487714|ref|XP_004157764.1| PREDICTED: LOW QUALITY PROTEIN: probable 26S proteasome non-ATPase regulatory subunit 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|4678261|emb|CAB41122.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|7269333|emb|CAB79392.1| putative proteasome regulatory subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18416433|ref|NP_567709.1| 26S proteasome regulatory subunit N7 [Arabidopsis thaliana] gi|42573029|ref|NP_974611.1| 26S proteasome regulatory subunit N7 [Arabidopsis thaliana] gi|20978551|sp|Q93Y35.1|PSMD6_ARATH RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 6; AltName: Full=26S proteasome regulatory subunit RPN7 gi|15450840|gb|AAK96691.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|20259842|gb|AAM13268.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|21593433|gb|AAM65400.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|23397029|gb|AAN31800.1| putative proteasome regulatory subunit [Arabidopsis thaliana] gi|32700030|gb|AAP86665.1| 26S proteasome subunit RPN7 [Arabidopsis thaliana] gi|332659566|gb|AEE84966.1| 26S proteasome regulatory subunit N7 [Arabidopsis thaliana] gi|332659567|gb|AEE84967.1| 26S proteasome regulatory subunit N7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297799516|ref|XP_002867642.1| hypothetical protein ARALYDRAFT_492356 [Arabidopsis lyrata subsp. lyrata] gi|297313478|gb|EFH43901.1| hypothetical protein ARALYDRAFT_492356 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2126798 387 AT4G24820 "AT4G24820" [Arabido 0.953 0.695 0.821 1.4e-117
ZFIN|ZDB-GENE-040426-1038 386 psmd6 "proteasome (prosome, ma 0.939 0.686 0.498 2.1e-68
RGD|735127 389 Psmd6 "proteasome (prosome, ma 0.950 0.688 0.479 6.5e-67
UNIPROTKB|F1MXE4 389 PSMD6 "26S proteasome non-ATPa 0.950 0.688 0.479 8.2e-67
UNIPROTKB|Q3T0B2 389 PSMD6 "26S proteasome non-ATPa 0.950 0.688 0.479 8.2e-67
MGI|MGI:1913663 389 Psmd6 "proteasome (prosome, ma 0.950 0.688 0.479 1.1e-66
UNIPROTKB|F1N903 398 PSMD6 "Uncharacterized protein 0.946 0.670 0.481 2.2e-66
UNIPROTKB|Q15008 389 PSMD6 "26S proteasome non-ATPa 0.950 0.688 0.476 2.2e-66
UNIPROTKB|E2RN00 516 PSMD6 "Uncharacterized protein 0.950 0.519 0.472 5.8e-66
UNIPROTKB|Q6UV22 351 PSMD6 "KIAA0107 isoform" [Homo 0.804 0.646 0.524 1.2e-63
TAIR|locus:2126798 AT4G24820 "AT4G24820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1158 (412.7 bits), Expect = 1.4e-117, P = 1.4e-117
 Identities = 221/269 (82%), Positives = 250/269 (92%)

Query:     3 SEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMD 62
             +EG+QQ HL+LA+K FLLTHPDV DIEKV LK EV   +++H MA  YETL+A SVL++D
Sbjct:     5 AEGSQQPHLILANKLFLLTHPDVPDIEKVQLKSEVLDFIRSHGMAPLYETLIASSVLDLD 64

Query:    63 QSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKV 122
             QS+L+SMR   E+ELKKLD++IADAEENLGESEVREAHLAK+L++I+I DKEKALEQLK+
Sbjct:    65 QSLLESMRAANEEELKKLDEKIADAEENLGESEVREAHLAKALYFIRISDKEKALEQLKL 124

Query:   123 TESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGL 182
             TE KTVAVGQKMD+VFYTLQL FFYMDFDL+SKSIDKAK LFEEGGDWERKNRLKVYEGL
Sbjct:   125 TEGKTVAVGQKMDVVFYTLQLAFFYMDFDLVSKSIDKAKKLFEEGGDWERKNRLKVYEGL 184

Query:   183 YCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEI 242
             YCMSTRNFKKAASLFLDSISTFTTYE+FPY+TFIFYTVLTSII+LDRVSLKQKVVDAPEI
Sbjct:   185 YCMSTRNFKKAASLFLDSISTFTTYEIFPYETFIFYTVLTSIITLDRVSLKQKVVDAPEI 244

Query:   243 LTVIGKIPYLSEFLNSLYDCQYKSFFSAF 271
             LTV+GKIP+LSEFLNSLY+CQYK+FFSAF
Sbjct:   245 LTVLGKIPFLSEFLNSLYECQYKAFFSAF 273
GO:0003674 "molecular_function" evidence=ND
GO:0008541 "proteasome regulatory particle, lid subcomplex" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0005634 "nucleus" evidence=TAS
GO:0030163 "protein catabolic process" evidence=TAS
GO:0005886 "plasma membrane" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0000502 "proteasome complex" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009735 "response to cytokinin stimulus" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0043090 "amino acid import" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0051302 "regulation of cell division" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
GO:0051604 "protein maturation" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
ZFIN|ZDB-GENE-040426-1038 psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|735127 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXE4 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0B2 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1913663 Psmd6 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N903 PSMD6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q15008 PSMD6 "26S proteasome non-ATPase regulatory subunit 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN00 PSMD6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UV22 PSMD6 "KIAA0107 isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93Y35PSMD6_ARATHNo assigned EC number0.81850.95740.6976yesno
Q8W425PSMD6_ORYSJNo assigned EC number0.80970.95030.6889yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
pfam10602174 pfam10602, RPN7, 26S proteasome subunit RPN7 3e-75
COG5187 412 COG5187, RPN7, 26S proteasome regulatory complex c 8e-65
>gnl|CDD|220821 pfam10602, RPN7, 26S proteasome subunit RPN7 Back     alignment and domain information 
 Score =  226 bits (579), Expect = 3e-75
 Identities = 84/174 (48%), Positives = 122/174 (70%)

Query: 62  DQSVLDSMRTKIEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLK 121
           D++ ++ +R K E+EL++LD  + DA+ENLG+ E+R A L  +  Y +IGD E AL+   
Sbjct: 1   DEAWVEELRKKNEEELEELDAELKDAKENLGKEEIRRALLDLAEHYAKIGDLENALKAYS 60

Query: 122 VTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEG 181
                  ++G K+D+    +++G F+ D+D +SK I+KAKSL E+GGDWER+NRLKVYEG
Sbjct: 61  RAREYCTSLGHKIDMCLNLIRVGIFFNDWDHVSKYIEKAKSLIEKGGDWERRNRLKVYEG 120

Query: 182 LYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQK 235
           L  ++ R+FK+AA LFLDS+STFT+ EL  Y+    Y VL ++ SLDRV LK+K
Sbjct: 121 LALLAIRDFKEAAKLFLDSLSTFTSTELISYEDVAIYGVLCALASLDRVDLKKK 174

RPN7 (known as the non ATPase regulatory subunit 6 in higher eukaryotes) is one of the lid subunits of the 26S proteasome and has been shown in Saccharomyces cerevisiae to be required for structural integrity. The 26S proteasome is is involved in the ATP-dependent degradation of ubiquitinated proteins. Length = 174
>gnl|CDD|227514 COG5187, RPN7, 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
KOG0687 393 consensus 26S proteasome regulatory complex, subun 100.0
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 100.0
COG5187 412 RPN7 26S proteasome regulatory complex component, 100.0
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 100.0
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.32
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.29
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.69
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.44
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 96.28
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.99
KOG2908 380 consensus 26S proteasome regulatory complex, subun 95.91
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.73
PF12688120 TPR_5: Tetratrico peptide repeat 95.67
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.66
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.63
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.57
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 95.1
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.94
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 94.79
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.42
COG5159 421 RPN6 26S proteasome regulatory complex component [ 94.16
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.04
PRK11788389 tetratricopeptide repeat protein; Provisional 93.92
PRK11788389 tetratricopeptide repeat protein; Provisional 93.62
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 93.56
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 93.43
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 93.34
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 93.32
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 93.31
KOG2796366 consensus Uncharacterized conserved protein [Funct 93.25
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 93.14
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 93.14
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 93.11
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 93.09
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.08
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.85
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.56
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 92.42
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 92.42
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.92
KOG1125579 consensus TPR repeat-containing protein [General f 91.85
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 91.62
KOG1463411 consensus 26S proteasome regulatory complex, subun 91.46
PRK10370198 formate-dependent nitrite reductase complex subuni 91.35
PRK11189296 lipoprotein NlpI; Provisional 90.91
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 90.88
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.73
COG4235287 Cytochrome c biogenesis factor [Posttranslational 90.67
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.55
KOG2758 432 consensus Translation initiation factor 3, subunit 90.15
cd05804355 StaR_like StaR_like; a well-conserved protein foun 89.89
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 89.75
PRK10803263 tol-pal system protein YbgF; Provisional 89.44
PF1286294 Apc5: Anaphase-promoting complex subunit 5 89.43
PLN03218 1060 maturation of RBCL 1; Provisional 89.38
KOG1129478 consensus TPR repeat-containing protein [General f 89.02
cd05804355 StaR_like StaR_like; a well-conserved protein foun 88.74
PF1342844 TPR_14: Tetratricopeptide repeat 88.72
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 88.33
COG184990 Uncharacterized protein conserved in archaea [Func 88.25
CHL00033168 ycf3 photosystem I assembly protein Ycf3 88.1
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 88.1
PRK15359144 type III secretion system chaperone protein SscB; 88.06
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.84
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 87.24
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 86.94
PRK12370553 invasion protein regulator; Provisional 86.54
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 86.43
KOG0547 606 consensus Translocase of outer mitochondrial membr 86.24
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 85.83
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 85.78
PRK04841 903 transcriptional regulator MalT; Provisional 85.69
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 85.66
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 85.1
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 85.04
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 83.89
KOG0553304 consensus TPR repeat-containing protein [General f 83.52
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 83.35
PRK14574 822 hmsH outer membrane protein; Provisional 83.14
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.77
PRK11189296 lipoprotein NlpI; Provisional 82.65
PRK04841 903 transcriptional regulator MalT; Provisional 82.35
PF02064121 MAS20: MAS20 protein import receptor; InterPro: IP 81.69
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 81.38
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 80.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 80.63
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.35
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.8e-80  Score=563.25  Aligned_cols=274  Identities=54%  Similarity=0.937  Sum_probs=267.7

Q ss_pred             CCCCCCCCcchHHhhHhHhhcCCCCcchhhHHHHHHHHHHHHhcCCHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHH
Q 023407            1 MDSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVLEMDQSVLDSMRTKIEDELKKL   80 (282)
Q Consensus         1 ~~~~~~~~p~~~l~~l~f~~~~~~~~~~~~~~a~~~ll~~ik~~~m~~~Y~~l~~~~~~~~D~~~~~~~~~~n~~~l~~L   80 (282)
                      ++++++++|+++++|++|.++||.... .++++.+.+++.|+.++|+|+|+.+|+...|.+|+.++++|.++|++++++|
T Consensus         9 ~~e~~~~~p~le~sq~~FlLt~p~~~~-~~~~~~e~l~~~Ird~~Map~Ye~lce~~~i~~D~~~l~~m~~~neeki~el   87 (393)
T KOG0687|consen    9 EEETLMRVPDLELSQLRFLLTHPEVLG-QKAAAREKLLAAIRDEDMAPLYEYLCESLVIKLDQDLLNSMKKANEEKIKEL   87 (393)
T ss_pred             cccccccCcchhHHHHHHHHcCccccC-cCHHHHHHHHHHHHhcccchHHHHHHhhcceeccHHHHHHHHHhhHHHHHHH
Confidence            457788899999999999999998764 6889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhCHHHHHHHHHhhhhHHHHhCCHHHHHHHHHHhhccccCchhHHHHHHHHHHHHHHccChHHHHHHHHHH
Q 023407           81 DDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSIDKA  160 (282)
Q Consensus        81 e~~lk~~~~nl~~eeIr~a~~~la~~~~~iGd~~~A~k~y~~~~e~~~s~~~~id~~l~~irv~~~~~d~~~v~~~i~kA  160 (282)
                      +++++++++|+|+.|+|+|+..+|+|||+|||+++|++++.++.+++++.||+||++|+.||+|+|++|.+.|...|+||
T Consensus        88 d~~iedaeenlGE~ev~ea~~~kaeYycqigDkena~~~~~~t~~ktvs~g~kiDVvf~~iRlglfy~D~~lV~~~ieka  167 (393)
T KOG0687|consen   88 DEKIEDAEENLGESEVREAMLRKAEYYCQIGDKENALEALRKTYEKTVSLGHKIDVVFYKIRLGLFYLDHDLVTESIEKA  167 (393)
T ss_pred             HHHHHHHHHhcchHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHhhcccchhhHHHHHHHHHhhccHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhCCCcchhhHHHHHHHHHHhhcccHHHHHHHhhccccccccccccCchhHHHHHHHHHhccCChHHHHHHccCCh
Q 023407          161 KSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAP  240 (282)
Q Consensus       161 ~~~~e~ggdw~rrnrLkvy~gL~~l~~r~f~~AA~lfld~~~tft~~elis~~d~a~Y~~l~aLasl~R~eLk~kvl~~~  240 (282)
                      +.++|+|||||||||||+|+|+|+|+.||||+||.+|+|++|||||+|||||++||.|+|+||+++|+|++||+|||++|
T Consensus       168 k~liE~GgDWeRrNRlKvY~Gly~msvR~Fk~Aa~Lfld~vsTFtS~El~~Y~~~v~Ytv~~g~i~leR~dlktKVi~~~  247 (393)
T KOG0687|consen  168 KSLIEEGGDWERRNRLKVYQGLYCMSVRNFKEAADLFLDSVSTFTSYELMSYETFVRYTVITGLIALERVDLKTKVIKCP  247 (393)
T ss_pred             HHHHHhCCChhhhhhHHHHHHHHHHHHHhHHHHHHHHHHHcccccceecccHHHHHHHHHHHhhheeccchHHhhhcCcH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHhhcCCchHHHHHHHHhcCChhHHHHHHHHhh
Q 023407          241 EILTVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKR  275 (282)
Q Consensus       241 e~~~~l~~~P~l~~ll~sfy~~~Y~~~~~~L~~~~  275 (282)
                      |++++++..|.++++++|+|+|+|+.||..|..++
T Consensus       248 Evl~vl~~l~~~~q~l~SLY~C~Y~~Ff~~L~~~~  282 (393)
T KOG0687|consen  248 EVLEVLHKLPSVSQLLNSLYECDYSDFFNDLAAVE  282 (393)
T ss_pred             HHHHHhhcCchHHHHHHHHHhccHHHHHHHHHHHH
Confidence            99999999999999999999999999999997664

>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG1849 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
4b4t_R 429 Near-Atomic Resolution Structural Model Of The Yeas 9e-39
>pdb|4B4T|R Chain R, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 429 Back     alignment and structure 
Iteration: 1

 Score =  157 bits (396), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 156/293 (53%), Gaps = 50/293 (17%)
Query: 13  LAHKRFLLTHPDVQDIEKVGLKGE-VFSMVKAHDMASFYETLVAESV------------- 58
           ++ K FLLT   V  IE+     E V + +K  +MA +Y+ L  E +             
Sbjct: 26  VSEKAFLLTQSKV-SIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEK 84
Query: 59  -------LEMDQSVLDSMRTKIEDELKKLDDRI-------------ADAEENLGESEVRE 98
                  ++ DQ + + +  K E ++K+L+++I             A A  NLGE     
Sbjct: 85  SDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGE----- 139
Query: 99  AHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLGFFYMDFDLISKSID 158
                  +Y QIGDK+ A + L  + SK ++ G K+D++    +LGFFY D   + + ++
Sbjct: 140 -------YYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLE 192
Query: 159 KAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFY 218
              S+ E+GGDWER+NR K Y G++C++ RNFK+AA L +DS++TFT+ EL  Y++   Y
Sbjct: 193 AVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATY 252
Query: 219 TVLTSIISLDRVSLKQKVVDAPEILTVIGKIPYL---SEFLNSLYDCQYKSFF 268
             +T + +L+R  LK KV+D+PE+L++I     L   S    SLY   Y S+F
Sbjct: 253 ASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYF 305

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure
 Score = 62.2 bits (150), Expect = 3e-11
 Identities = 31/214 (14%), Positives = 66/214 (30%), Gaps = 13/214 (6%)

Query: 73  IEDELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQ 132
              E++   D I  A++       +         Y       +AL        +     +
Sbjct: 75  TGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLREL----K 130

Query: 133 KMDLVFYTLQLGFFYMDFDLISKSIDKAKSLFEEGG--------DWERKNRLKVYEGLYC 184
           K+D     +++            ++ KA++                + +  L +  G+  
Sbjct: 131 KLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILH 190

Query: 185 M-STRNFKKAASLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEIL 243
               R+FK A S F ++   F + +     T + Y +L  I+      + Q V     I 
Sbjct: 191 AADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAIT 250

Query: 244 TVIGKIPYLSEFLNSLYDCQYKSFFSAFGEKRSD 277
                I  +     + +      F +A  E + +
Sbjct: 251 YSGRDIDAMKSVAEASHKRSLADFQAALKEYKKE 284
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 100.0
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 99.87
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 99.06
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.86
4b4t_O 393 26S proteasome regulatory subunit RPN9; hydrolase, 98.64
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.96
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.94
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.86
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.84
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.78
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.73
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 97.7
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.66
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.65
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.63
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.61
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.55
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.52
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.5
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 97.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.47
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.38
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.37
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.33
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.3
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.29
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.27
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.26
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.18
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.13
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.98
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.94
4g1t_A 472 Interferon-induced protein with tetratricopeptide 96.9
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.88
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 96.87
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.83
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.77
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.77
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.75
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.74
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.73
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.72
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.69
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.55
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.54
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.54
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.51
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.48
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.42
3u4t_A272 TPR repeat-containing protein; structural genomics 96.36
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.35
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.34
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.28
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.25
3u4t_A272 TPR repeat-containing protein; structural genomics 96.23
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.22
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.22
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.2
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.14
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 96.06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.01
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.99
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.97
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.93
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 95.92
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 95.9
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.9
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.86
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.83
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.81
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.81
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.78
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 95.74
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 95.66
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.59
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.56
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 95.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.55
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.52
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.52
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 95.44
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.42
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.37
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.36
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.32
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.18
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.09
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.05
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 95.01
2gw1_A 514 Mitochondrial precursor proteins import receptor; 94.97
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.95
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 94.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 94.81
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 94.74
3k9i_A117 BH0479 protein; putative protein binding protein, 94.71
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.69
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 94.65
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.62
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.58
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.51
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.34
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 94.25
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 94.18
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.15
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 94.15
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 94.12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 94.09
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 94.01
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 93.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 93.83
3k9i_A117 BH0479 protein; putative protein binding protein, 93.79
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 93.77
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.66
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 93.55
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 93.51
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 93.5
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 93.35
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 93.28
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 92.91
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 92.76
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 92.74
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.68
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 92.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.67
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 92.58
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 92.49
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 92.46
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 92.16
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 92.07
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 92.03
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 91.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 91.85
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 91.78
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 91.32
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 91.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 91.25
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 91.19
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 91.08
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 91.01
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 90.84
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 90.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 90.68
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 90.57
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 90.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 90.3
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 89.85
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 89.74
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 89.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 89.2
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 88.88
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 88.43
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 88.35
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 88.14
4g1t_A472 Interferon-induced protein with tetratricopeptide 88.02
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 87.9
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 87.72
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 87.69
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.69
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 86.73
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 86.16
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 85.44
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 84.62
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 83.79
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 83.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 83.45
2l6j_A111 TPR repeat-containing protein associated with HSP; 83.14
3qww_A433 SET and MYND domain-containing protein 2; methyltr 82.98
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 82.7
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 82.66
2oo2_A86 Hypothetical protein AF_1782; structural genomics, 82.16
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 81.88
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 81.51
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 80.64
2pmr_A87 Uncharacterized protein; structural genomics, unkn 80.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 80.25
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1e-56  Score=433.69  Aligned_cols=275  Identities=35%  Similarity=0.617  Sum_probs=237.9

Q ss_pred             CCCCCCCcchHHhhHhHhhcCCCCcchhhHHHHHHHHHHHHhcCCHHHHHHHHHhcCC--------------------CC
Q 023407            2 DSEGTQQAHLVLAHKRFLLTHPDVQDIEKVGLKGEVFSMVKAHDMASFYETLVAESVL--------------------EM   61 (282)
Q Consensus         2 ~~~~~~~p~~~l~~l~f~~~~~~~~~~~~~~a~~~ll~~ik~~~m~~~Y~~l~~~~~~--------------------~~   61 (282)
                      ++.+.++||++|+++.|+++++...+..+.++++.+++.||+++|+|+|+.+|+++++                    |+
T Consensus        15 d~~~~k~P~~~la~~~f~l~~~~~~~~~~~~~~~~l~~~ik~~~ma~~y~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~   94 (429)
T 4b4t_R           15 DPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKF   94 (429)
T ss_dssp             ---------------------------CHHHHHHHHHHHHHHTCCHHHHHHHHHHSCCCCSCCSSCSHHHHHHHHHTTTT
T ss_pred             CcccccCCChHHHHHHHHhcCCCCChhhHHHHHHHHHHHHHHhCCHHHHHHHHHHHhhcccchhhhhhhhhhhhhhcchH
Confidence            5667899999999999999998766667889999999999999999999999999753                    78


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHH-hhCHHHHHHHHHhhhhHHHHhCCHHHHHHHHHHhhccccCchhHHHHHHHH
Q 023407           62 DQSVLDSMRTKIEDELKKLDDRIADAEE-NLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYT  140 (282)
Q Consensus        62 D~~~~~~~~~~n~~~l~~Le~~lk~~~~-nl~~eeIr~a~~~la~~~~~iGd~~~A~k~y~~~~e~~~s~~~~id~~l~~  140 (282)
                      |+.|++.+.++|++++++|++.++++++ |.|+.++|+++.++|+||+++||+++|+++|.+++++|++++|++||+|.+
T Consensus        95 d~~~~~~~~~~n~~~l~~l~~~~~~~~~~~~~e~e~~~~~~~la~~~~~~Gd~~~A~~~~~~~~~~~~~~~~kid~~l~~  174 (429)
T 4b4t_R           95 DQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTI  174 (429)
T ss_dssp             CCSSCTTTTCCSSCCHHHHHHHHHHHHHCCSCCCCCSSCCHHHHHHHHHHCCCTTHHHHHHHHHHHHTCCCSHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCChHHHHHHHHHH
Confidence            9999999999999999999999999976 889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHccChHHHHHHHHHHHHHHhhCCCcchhhHHHHHHHHHHhhcccHHHHHHHhhccccccccccccCchhHHHHHH
Q 023407          141 LQLGFFYMDFDLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPYDTFIFYTV  220 (282)
Q Consensus       141 irv~~~~~d~~~v~~~i~kA~~~~e~ggdw~rrnrLkvy~gL~~l~~r~f~~AA~lfld~~~tft~~elis~~d~a~Y~~  220 (282)
                      ||++++.+||.+++.++.||+.++++||||+++||+++|.|+++|..|+|++||+.|+++++||++.|++++.++++|++
T Consensus       175 irl~l~~~d~~~~~~~~~ka~~~~~~~~d~~~~~~lk~~~gl~~l~~r~f~~Aa~~f~e~~~t~~~~e~~~~~~~~~y~~  254 (429)
T 4b4t_R          175 ARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYAS  254 (429)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHHTTCCCTHHHHHHHHHHHHGGGGTSCHHHHHHHHHHHHHHSCCSCHHHHHHHHHHHH
T ss_pred             HHHHHHhccHHHHHHHHHHHHHhhhcCCCHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHhccCCccchhhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhccCChHHHHHHccCChhHHHhhcCCchHH---HHHHHHhcCChhHHHHHHHHhhh
Q 023407          221 LTSIISLDRVSLKQKVVDAPEILTVIGKIPYLS---EFLNSLYDCQYKSFFSAFGEKRS  276 (282)
Q Consensus       221 l~aLasl~R~eLk~kvl~~~e~~~~l~~~P~l~---~ll~sfy~~~Y~~~~~~L~~~~~  276 (282)
                      ||++++++|++++.+|++||+|+.+++..|.++   +++.+||+|+|..||+.+.+..+
T Consensus       255 l~al~~~~r~~l~~~v~~~~~~~~~l~~~p~~~~~~~l~~~~~~~~~~~~~~~~l~~~~  313 (429)
T 4b4t_R          255 VTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYA  313 (429)
T ss_dssp             HHHHHTTCHHHHHHSSSSSHHHHHGGGSHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHS
T ss_pred             HHHHhcCCHHHHHHHHhcCHHHHhhccCChhHHHHHHHHHHHHhccHHHHHHHHHHHHH
Confidence            999999999999999999999999999998765   56899999999999998765544
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2oo2_A Hypothetical protein AF_1782; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Archaeoglobus fulgidus dsm 4304} SCOP: a.8.11.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pmr_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.32A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.8.11.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.93
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.66
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.52
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.42
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.23
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.08
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.93
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.84
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.81
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.79
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 95.48
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.27
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 94.89
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.55
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.37
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 94.36
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.32
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 92.95
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.26
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 92.07
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 91.39
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 90.45
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 89.95
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 89.36
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 88.16
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 87.76
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 86.88
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 86.67
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 86.31
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 85.69
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 84.39
d2oo2a175 Hypothetical protein AF1782 {Archaeoglobus fulgidu 83.66
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 83.65
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.93  E-value=0.0012  Score=56.36  Aligned_cols=158  Identities=11%  Similarity=0.071  Sum_probs=109.7

Q ss_pred             HHHHHHHHHHHHHHHhhCHHHHHHHHHhhhhHHHHhCCHHHHHHHHHHhhccccCchhHHHHHHHHHHHH---H-HccCh
Q 023407           75 DELKKLDDRIADAEENLGESEVREAHLAKSLFYIQIGDKEKALEQLKVTESKTVAVGQKMDLVFYTLQLG---F-FYMDF  150 (282)
Q Consensus        75 ~~l~~Le~~lk~~~~nl~~eeIr~a~~~la~~~~~iGd~~~A~k~y~~~~e~~~s~~~~id~~l~~irv~---~-~~~d~  150 (282)
                      +-++-.+.-++-+.+.....+.-..+..+|..|.+.|++++|+++|.++.+.....+..-...-...++|   . ..||+
T Consensus        55 ~A~~~y~kA~~~~~~~~~~~~~a~~~~~~g~~y~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  134 (290)
T d1qqea_          55 LAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDY  134 (290)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCCH
T ss_pred             HHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhCCcHHHHHHHHHhhHHhhhcccchhHHHHHHHHHHhHhhHHHHH
Confidence            3344455555556666677888899999999999999999999999998887766665555555555555   2 25999


Q ss_pred             HHHHHHHHHHHHHHhhCCCcchhhHHHHHHHHHHhhcccHHHHHHHhhccccccccccccCc--hhHHHHHHHHHhccCC
Q 023407          151 DLISKSIDKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAASLFLDSISTFTTYELFPY--DTFIFYTVLTSIISLD  228 (282)
Q Consensus       151 ~~v~~~i~kA~~~~e~ggdw~rrnrLkvy~gL~~l~~r~f~~AA~lfld~~~tft~~elis~--~d~a~Y~~l~aLasl~  228 (282)
                      .....+..+|-.+....+++....+...-.|-.....|+|.+|.+.|-.+...+.......+  ...-+-.++|-+..-+
T Consensus       135 ~~A~~~~~~A~~l~~~~~~~~~~~~~~~~la~~~~~~g~y~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d  214 (290)
T d1qqea_         135 AKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATD  214 (290)
T ss_dssp             HHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTSSCTTTGGGHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHHhcCchhhhhhHHHHHHHHHHHcChHHHHHHHHHHHHHhCccchhhhhhHHHHHHHHHHHHHHhcc
Confidence            99999999999887765555444444444577888999999999999887655443333332  2333445566555544


Q ss_pred             hHHH
Q 023407          229 RVSL  232 (282)
Q Consensus       229 R~eL  232 (282)
                      -..-
T Consensus       215 ~~~A  218 (290)
T d1qqea_         215 AVAA  218 (290)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            4433
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oo2a1 a.8.11.1 (A:1-75) Hypothetical protein AF1782 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure