Citrus Sinensis ID: 023462

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MMSSLSLHNNSSISKAAASSSISTSTKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKYAAREKSKELAELSKIARKSGFQPLSNETSKLHGVTSPPNLQQQGSKNSPVGQPHVLLNANLTKGIMALDEFKHGFPSDGLSTASYKWWGGRSSDGNDGIHKDESEIDEEDKQAEAKADKESATQATGNEKSGNGETESNVDPQGSGLLTAARKRTVEEGREALKLGVYKKYCVKQLDRKERVLLHRIFKSSLPKEWL
ccccccccccccccccccccccccccccccHHHHHHHccccHHHHHHHHcccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHcccccHHHHHHHHHHHHcccccccc
ccccccccccccccccHHHccccccEEEEcHHHHHHHHcccHHHHHHHccccHHHHHHHHHHcccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHHHHHEEEcccccccccccccHHHHHHHHHHHcccccHHcc
mmsslslhnnssiskaaasssiststkslsfddiskyfslplsdaaNHLGVCVSVLKKICrdngldrwpyrkflsgksIEDIKKYAAREKSKELAELSKIARksgfqplsnetsklhgvtsppnlqqqgsknspvgqphvllnanltkgimaldefkhgfpsdglstasykwwggrssdgndgihkdeseiDEEDKQAEAKAdkesatqatgneksgngetesnvdpqgsgllTAARKRTVEEGREALKLGVYKKYCVKQLDRKERVLLHRIFksslpkewl
MMSSLSLHNNSSISKAAASSSISTSTKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKicrdngldrwpyrkflsgksiedIKKYAAREKSKELAELSKIARKSGFQPLSNETSKLHGVTSPPNLQQQGSKNSPVGQPHVLLNANLTKGIMALDEFKHGFPSDGLSTASYKWWGGRSSDGNDGIHKDESEIDEEDKQAEAkadkesatqatgneksgngetesnvdpqgsgllTAARKRTVEEgrealklgvykkycvkqldrkervllhrifksslpkewl
MMsslslhnnssiskaaasssiststksLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKYAAREKSKELAELSKIARKSGFQPLSNETSKLHGVTSPPNLQQQGSKNSPVGQPHVLLNANLTKGIMALDEFKHGFPSDGLSTASYKWWGGRSSDGNDGIHKDESEIDEEDKQAEAKADKESATQATGNEKSGNGETESNVDPQGSGLLTAARKRTVEEGREALKLGVYKKYCVKQLDRKERVLLHRIFKSSLPKEWL
******************************FDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIK*******************************************************HVLLNANLTKGIMALDEFKHGFPSDGLSTASYKWWG***********************************************************************EALKLGVYKKYCVKQLDRKERVLLHRIFK********
*******************************DDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPY***********************************************************************************************************************************************************************************LGVYKKYCVKQLDRKERVLLHRIFKSSLPKEWL
****************************LSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKYAAREKSKELAELSKIARKSGFQPLSNETS********************VGQPHVLLNANLTKGIMALDEFKHGFPSDGLSTASYKWWGGRSSDGNDGIHKDE***************************************QGSGLLTAARKRTVEEGREALKLGVYKKYCVKQLDRKERVLLHRIFKSSLPKEWL
***********************TSTKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKYAAREKSKELAELSKIARKS******************************************TKGIMALDEFKHGFPSDGLSTAS**W********************************************************GSGLLTAARKRTVEEGREALKLGVYKKYCVKQLDRKERVLLHRIFKSSLPK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMSSLSLHNNSSISKAAASSSISTSTKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKYAAREKSKELAELSKIARKSGFQPLSNETSKLHGVTSPPNLQQQGSKNSPVGQPHVLLNANLTKGIMALDEFKHGFPSDGLSTASYKWWGGRSSDGNDGIHKDESEIDEEDKQAEAKADKESATQATGNEKSGNGETESNVDPQGSGLLTAARKRTVEEGREALKLGVYKKYCVKQLDRKERVLLHRIFKSSLPKEWL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q0JC27 936 Protein NLP2 OS=Oryza sat no no 0.180 0.054 0.549 2e-09
Q9SFW8808 Protein NLP5 OS=Arabidops no no 0.283 0.099 0.337 3e-08
Q9LE38844 Protein NLP4 OS=Arabidops no no 0.205 0.068 0.423 5e-08
O81791370 Protein RKD5 OS=Arabidops no no 0.265 0.202 0.394 6e-08
Q10S83942 Protein NLP1 OS=Oryza sat no no 0.166 0.049 0.489 8e-08
Q9M1B0 894 Protein NLP9 OS=Arabidops no no 0.180 0.057 0.490 9e-08
Q84TH9 959 Protein NLP7 OS=Arabidops no no 0.166 0.049 0.489 9e-08
Q9M9U9269 Protein RKD1 OS=Arabidops no no 0.244 0.256 0.436 1e-07
Q9SVF1767 Protein NLP3 OS=Arabidops no no 0.166 0.061 0.468 2e-07
Q9CA66298 Protein RKD2 OS=Arabidops no no 0.294 0.278 0.298 2e-07
>sp|Q0JC27|NLP2_ORYSJ Protein NLP2 OS=Oryza sativa subsp. japonica GN=NLP2 PE=2 SV=2 Back     alignment and function desciption
 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 36/51 (70%)

Query: 23  STSTKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKF 73
           ST+ K++S D + KYFS  L DAA  LGVC + LK+ICR +G+ RWP RK 
Sbjct: 562 STAEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKI 612
Probable transcription factor.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q9SFW8|NLP5_ARATH Protein NLP5 OS=Arabidopsis thaliana GN=NLP5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LE38|NLP4_ARATH Protein NLP4 OS=Arabidopsis thaliana GN=NLP4 PE=2 SV=1 Back     alignment and function description
>sp|O81791|RKD5_ARATH Protein RKD5 OS=Arabidopsis thaliana GN=RKD5 PE=3 SV=1 Back     alignment and function description
>sp|Q10S83|NLP1_ORYSJ Protein NLP1 OS=Oryza sativa subsp. japonica GN=NLP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1B0|NLP9_ARATH Protein NLP9 OS=Arabidopsis thaliana GN=NLP9 PE=2 SV=1 Back     alignment and function description
>sp|Q84TH9|NLP7_ARATH Protein NLP7 OS=Arabidopsis thaliana GN=NLP7 PE=1 SV=2 Back     alignment and function description
>sp|Q9M9U9|RKD1_ARATH Protein RKD1 OS=Arabidopsis thaliana GN=RKD1 PE=3 SV=1 Back     alignment and function description
>sp|Q9SVF1|NLP3_ARATH Protein NLP3 OS=Arabidopsis thaliana GN=NLP3 PE=2 SV=1 Back     alignment and function description
>sp|Q9CA66|RKD2_ARATH Protein RKD2 OS=Arabidopsis thaliana GN=RKD2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
224062696274 predicted protein [Populus trichocarpa] 0.890 0.916 0.606 1e-81
118489510274 unknown [Populus trichocarpa x Populus d 0.890 0.916 0.606 1e-81
302143542291 unnamed protein product [Vitis vinifera] 0.936 0.907 0.543 2e-73
147810074302 hypothetical protein VITISV_007604 [Viti 0.751 0.701 0.423 1e-40
326497187343 predicted protein [Hordeum vulgare subsp 0.897 0.737 0.367 2e-33
13486839310 unknown protein [Oryza sativa Japonica G 0.868 0.790 0.356 2e-32
115435634315 Os01g0246500 [Oryza sativa Japonica Grou 0.868 0.777 0.356 2e-32
242051433289 hypothetical protein SORBIDRAFT_03g00026 0.851 0.830 0.360 2e-30
226504986284 uncharacterized protein LOC100272390 [Ze 0.858 0.852 0.364 5e-30
351722156182 uncharacterized protein LOC100305825 [Gl 0.606 0.939 0.425 1e-29
>gi|224062696|ref|XP_002300875.1| predicted protein [Populus trichocarpa] gi|222842601|gb|EEE80148.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  309 bits (791), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/259 (60%), Positives = 192/259 (74%), Gaps = 8/259 (3%)

Query: 26  TKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKY 85
           +K  S++ ISK+FSLPLSDAAN+LGVCVSVLKKICRDNGLDRWPYRK+L+GKSIEDI++Y
Sbjct: 12  SKPPSWEAISKHFSLPLSDAANNLGVCVSVLKKICRDNGLDRWPYRKYLAGKSIEDIRRY 71

Query: 86  AAREKSKELAELSKIARKSGFQPLSNETSKLHGVTSPPNLQQQGSKNSPVGQPHVLLNAN 145
           AAREK K +A+L+K A KSG Q  +NE SK H       LQQQG+K+  VG+ H+ L   
Sbjct: 72  AAREKIKAIADLAKAANKSGIQQQNNENSKPH------KLQQQGTKDVLVGRQHITLTPG 125

Query: 146 LTKGIMALDEFKHGFPSDGLSTASYKWWGGRSSDGNDGIHKDESEIDEED-KQAEAKADK 204
           L KG+M LDEFK+GFPSDGLSTA+ KWWG   SD      +   E DE+D +Q+E K D 
Sbjct: 126 LAKGLMGLDEFKYGFPSDGLSTATNKWWGSSLSDTQRATDRAGIETDEDDGRQSEEKVDA 185

Query: 205 ESATQATGNEKSGNGETESN-VDPQGSGLLTAARKRTVEEGREALKLGVYKKYCVKQLDR 263
            ++      EK  NG+ ESN +DPQG+GLLT+ RKR  EEGREALKLGVY+ Y V +L R
Sbjct: 186 GTSVVIVDEEKGENGKMESNEIDPQGTGLLTSVRKRAAEEGREALKLGVYRTYGVNKLGR 245

Query: 264 KERVLLHRIFKSSLPKEWL 282
           K+R LL RIF SSLPK+W+
Sbjct: 246 KQRALLLRIFGSSLPKQWI 264

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118489510|gb|ABK96557.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|302143542|emb|CBI22103.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147810074|emb|CAN71458.1| hypothetical protein VITISV_007604 [Vitis vinifera] Back     alignment and taxonomy information
>gi|326497187|dbj|BAK02178.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|13486839|dbj|BAB40070.1| unknown protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115435634|ref|NP_001042575.1| Os01g0246500 [Oryza sativa Japonica Group] gi|113532106|dbj|BAF04489.1| Os01g0246500 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242051433|ref|XP_002454862.1| hypothetical protein SORBIDRAFT_03g000260 [Sorghum bicolor] gi|241926837|gb|EER99981.1| hypothetical protein SORBIDRAFT_03g000260 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|226504986|ref|NP_001140342.1| uncharacterized protein LOC100272390 [Zea mays] gi|194699070|gb|ACF83619.1| unknown [Zea mays] gi|323388667|gb|ADX60138.1| RWP-RK transcription factor [Zea mays] gi|414875547|tpg|DAA52678.1| TPA: hypothetical protein ZEAMMB73_231209 [Zea mays] Back     alignment and taxonomy information
>gi|351722156|ref|NP_001237234.1| uncharacterized protein LOC100305825 [Glycine max] gi|255626711|gb|ACU13700.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2009145136 AT1G06500 "AT1G06500" [Arabido 0.280 0.580 0.365 5.6e-22
DICTYBASE|DDB_G0274295 548 DDB_G0274295 "RWP-RK domain-co 0.258 0.133 0.391 1.4e-09
TAIR|locus:2127908370 RKD5 "RWP-RK domain-containing 0.319 0.243 0.378 4.3e-08
TAIR|locus:2168412256 RKD4 "RWP-RK domain-containing 0.361 0.398 0.339 1e-07
TAIR|locus:2030397844 AT1G20640 [Arabidopsis thalian 0.556 0.186 0.301 2.8e-07
TAIR|locus:2134941 959 NLP7 "NIN like protein 7" [Ara 0.468 0.137 0.322 1.6e-06
TAIR|locus:2059692909 AT2G17150 [Arabidopsis thalian 0.723 0.224 0.263 2.6e-06
TAIR|locus:2035000269 RKD1 "RWP-RK domain containing 0.265 0.278 0.368 2.7e-06
TAIR|locus:2019175298 RKD2 "RWP-RK domain containing 0.265 0.251 0.316 8e-06
TAIR|locus:2121738767 AT4G38340 [Arabidopsis thalian 0.361 0.132 0.324 1.3e-05
TAIR|locus:2009145 AT1G06500 "AT1G06500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 139 (54.0 bits), Expect = 5.6e-22, Sum P(2) = 5.6e-22
 Identities = 30/82 (36%), Positives = 52/82 (63%)

Query:   201 KADKESATQATGNEKSGNGETESNVDPQGSGLLTAARKRTVEEGREALKLGVYKKYCVKQ 260
             +A+K    +  G E + NG   +  + Q S  L A RKR  EEGREA++LG+++ +  K+
Sbjct:    53 RAEK-GGREDGGGENTENGHVAACDETQNS--LVAIRKRIAEEGREAVELGLHQGFGSKR 109

Query:   261 LDRKERVLLHRIFKSSLPKEWL 282
               ++++ LL +IF S++PK+W+
Sbjct:   110 PGKRDQALLFQIFNSAMPKDWV 131
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
DICTYBASE|DDB_G0274295 DDB_G0274295 "RWP-RK domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2127908 RKD5 "RWP-RK domain-containing 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168412 RKD4 "RWP-RK domain-containing 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030397 AT1G20640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134941 NLP7 "NIN like protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059692 AT2G17150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035000 RKD1 "RWP-RK domain containing 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019175 RKD2 "RWP-RK domain containing 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121738 AT4G38340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00020554
hypothetical protein (275 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
pfam0204252 pfam02042, RWP-RK, RWP-RK domain 4e-21
>gnl|CDD|190197 pfam02042, RWP-RK, RWP-RK domain Back     alignment and domain information 
 Score = 83.8 bits (208), Expect = 4e-21
 Identities = 28/48 (58%), Positives = 38/48 (79%)

Query: 25 STKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRK 72
          +TK L+ +D+SKYF LP+ DAA  LGV ++VLK+ICR  G+ RWP+RK
Sbjct: 1  ATKELTLEDLSKYFHLPIKDAAKELGVGLTVLKRICRQLGIPRWPHRK 48

This domain is named RWP-RK after a conserved motif at the C terminus of the presumed domain. The domain is found in algal minus dominance proteins as well as plant proteins involved in nitrogen-controlled development. Length = 52

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
PF0204252 RWP-RK: RWP-RK domain; InterPro: IPR003035 This do 99.93
PF0141877 HTH_6: Helix-turn-helix domain, rpiR family; Inter 96.15
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 95.3
TIGR0176449 excise DNA binding domain, excisionase family. An 95.1
cd0476467 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding dom 94.97
cd0476368 HTH_MlrA-like Helix-Turn-Helix DNA binding domain 94.68
cd0110468 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain 94.57
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 94.27
PF1272851 HTH_17: Helix-turn-helix domain 94.1
cd0476249 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain 94.08
PF1341169 MerR_1: MerR HTH family regulatory protein; PDB: 2 93.77
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 93.74
PRK11302284 DNA-binding transcriptional regulator HexR; Provis 93.69
COG2207127 AraC AraC-type DNA-binding domain-containing prote 93.56
PRK15482285 transcriptional regulator MurR; Provisional 93.56
PRK0043095 fis global DNA-binding transcriptional dual regula 93.17
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 92.6
PF02001106 DUF134: Protein of unknown function DUF134; InterP 92.54
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 92.51
PRK10219107 DNA-binding transcriptional regulator SoxS; Provis 92.49
PRK11557278 putative DNA-binding transcriptional regulator; Pr 92.34
COG1737281 RpiR Transcriptional regulators [Transcription] 92.17
PRK11337292 DNA-binding transcriptional repressor RpiR; Provis 92.11
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 91.91
cd0476599 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding dom 91.46
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 91.42
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 91.26
PRK15115444 response regulator GlrR; Provisional 91.19
PRK11608326 pspF phage shock protein operon transcriptional ac 91.15
PRK11511127 DNA-binding transcriptional activator MarA; Provis 91.1
PRK0190577 DNA-binding protein Fis; Provisional 90.78
PRK13413200 mpi multiple promoter invertase; Provisional 89.82
PF01710119 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Tr 89.79
PF0138155 HTH_3: Helix-turn-helix; InterPro: IPR001387 This 89.78
PRK05022509 anaerobic nitric oxide reductase transcription reg 89.72
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 89.59
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 89.54
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 89.46
TIGR0307058 couple_hipB transcriptional regulator, y4mF family 89.41
PRK09393322 ftrA transcriptional activator FtrA; Provisional 89.41
PRK13182175 racA polar chromosome segregation protein; Reviewe 89.06
PF0016542 HTH_AraC: Bacterial regulatory helix-turn-helix pr 89.02
cd0110588 HTH_GlnR-like Helix-Turn-Helix DNA binding domain 89.02
smart0042270 HTH_MERR helix_turn_helix, mercury resistance. 88.85
cd0477496 HTH_YfmP Helix-Turn-Helix DNA binding domain of th 88.66
PRK12515189 RNA polymerase sigma factor; Provisional 88.56
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 88.54
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 88.47
PRK13502282 transcriptional activator RhaR; Provisional 88.43
PRK09685302 DNA-binding transcriptional activator FeaR; Provis 88.39
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 88.36
PF1351852 HTH_28: Helix-turn-helix domain 88.26
PF1111276 PyocinActivator: Pyocin activator protein PrtN 87.82
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 87.54
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 87.37
cd0476691 HTH_HspR Helix-Turn-Helix DNA binding domain of th 87.35
cd04773108 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding 87.25
PRK09978274 DNA-binding transcriptional regulator GadX; Provis 87.1
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 87.01
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 86.73
smart00351125 PAX Paired Box domain. 86.61
COG134299 Predicted DNA-binding proteins [General function p 86.3
cd0476896 HTH_BmrR-like Helix-Turn-Helix DNA binding domain 86.05
PF1284464 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_ 86.03
TIGR02989159 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodop 86.03
cd04775102 HTH_Cfa-like Helix-Turn-Helix DNA binding domain o 85.99
smart0049753 IENR1 Intron encoded nuclease repeat motif. Repeat 85.88
COG1522154 Lrp Transcriptional regulators [Transcription] 85.86
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 85.83
PRK15043243 transcriptional regulator MirA; Provisional 85.67
COG1595182 RpoE DNA-directed RNA polymerase specialized sigma 85.63
PRK00118104 putative DNA-binding protein; Validated 85.59
TIGR01817534 nifA Nif-specific regulatory protein. This model r 85.16
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 85.15
TIGR02297287 HpaA 4-hydroxyphenylacetate catabolism regulatory 84.77
PF1356064 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_ 84.69
cd01282112 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding dom 84.43
cd04789102 HTH_Cfa Helix-Turn-Helix DNA binding domain of the 84.41
PF0745337 NUMOD1: NUMOD1 domain; InterPro: IPR010896 This he 84.37
PRK14101638 bifunctional glucokinase/RpiR family transcription 83.7
cd0127998 HTH_HspR-like Helix-Turn-Helix DNA binding domain 83.65
PRK13503278 transcriptional activator RhaS; Provisional 83.48
cd00131128 PAX Paired Box domain 83.26
KOG0251491 consensus Clathrin assembly protein AP180 and rela 83.17
PHA0197667 helix-turn-helix protein 82.99
PRK09645173 RNA polymerase sigma factor SigL; Provisional 82.92
PF03374111 ANT: Phage antirepressor protein KilAC domain; Int 82.67
PRK09413121 IS2 repressor TnpA; Reviewed 82.64
PRK10572290 DNA-binding transcriptional regulator AraC; Provis 82.47
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 82.37
PRK15429686 formate hydrogenlyase transcriptional activator Fh 82.33
PRK13500312 transcriptional activator RhaR; Provisional 82.26
COG147668 Predicted transcriptional regulators [Transcriptio 82.21
TIGR02999183 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 f 82.08
PRK12533216 RNA polymerase sigma factor; Provisional 81.96
PRK12529178 RNA polymerase sigma factor; Provisional 81.92
PRK09642160 RNA polymerase sigma factor SigW; Reviewed 81.87
PRK0972688 antitoxin HipB; Provisional 81.71
PRK09649185 RNA polymerase sigma factor SigC; Reviewed 81.7
cd00592100 HTH_MerR-like Helix-Turn-Helix DNA binding domain 81.69
PRK04217110 hypothetical protein; Provisional 81.66
PHA0054282 putative Cro-like protein 81.37
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 81.17
cd01106103 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain 81.02
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 80.73
PF0368376 UPF0175: Uncharacterised protein family (UPF0175); 80.53
PRK12511182 RNA polymerase sigma factor; Provisional 80.36
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 80.31
PF1283381 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_ 80.28
PRK15418318 transcriptional regulator LsrR; Provisional 80.22
PRK09641187 RNA polymerase sigma factor SigW; Provisional 80.13
PRK09637181 RNA polymerase sigma factor SigZ; Provisional 80.12
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 80.1
>PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain Back     alignment and domain information 
Probab=99.93  E-value=1.1e-26  Score=168.92  Aligned_cols=51  Identities=55%  Similarity=1.013  Sum_probs=49.4

Q ss_pred             CCCcCHHHHHhhcCCcHHHHHHHhCCChHHHHHHHHHcCCCCCCcchhhhh
Q 023462           26 TKSLSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSG   76 (282)
Q Consensus        26 ~~~iTledL~~yF~lPi~EAAr~LGVs~T~LKR~CR~lGI~RWPyRKlkSL   76 (282)
                      +.+||++||++|||||++|||++||||.|+|||+||++||.||||||++|+
T Consensus         2 ~~~lt~~~L~~~fhlp~~eAA~~Lgv~~T~LKr~CR~~GI~RWP~Rkl~Sl   52 (52)
T PF02042_consen    2 TKSLTLEDLSQYFHLPIKEAAKELGVSVTTLKRRCRRLGIPRWPYRKLKSL   52 (52)
T ss_pred             CCccCHHHHHHHhCCCHHHHHHHhCCCHHHHHHHHHHcCCCCCCchhhccC
Confidence            578999999999999999999999999999999999999999999999986

The domain is found in algal minus dominance proteins as well as plant proteins involved in nitrogen-controlled development [].
>PF01418 HTH_6: Helix-turn-helix domain, rpiR family; InterPro: IPR000281 This domain contains a helix-turn-helix motif [] Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>cd04764 HTH_MlrA-like_sg1 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>cd04763 HTH_MlrA-like Helix-Turn-Helix DNA binding domain of MlrA-like transcription regulators Back     alignment and domain information
>cd01104 HTH_MlrA-CarA Helix-Turn-Helix DNA binding domain of the transcription regulators MlrA and CarA Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>PF12728 HTH_17: Helix-turn-helix domain Back     alignment and domain information
>cd04762 HTH_MerR-trunc Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins Back     alignment and domain information
>PF13411 MerR_1: MerR HTH family regulatory protein; PDB: 2JML_A 3GP4_A 3GPV_B Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] Back     alignment and domain information
>PRK15482 transcriptional regulator MurR; Provisional Back     alignment and domain information
>PRK00430 fis global DNA-binding transcriptional dual regulator Fis; Provisional Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PF02001 DUF134: Protein of unknown function DUF134; InterPro: IPR002852 The bacterial and archaeal proteins in this family have no known function Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional Back     alignment and domain information
>PRK11557 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>cd04765 HTH_MlrA-like_sg2 Helix-Turn-Helix DNA binding domain of putative MlrA-like transcription regulators Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK11511 DNA-binding transcriptional activator MarA; Provisional Back     alignment and domain information
>PRK01905 DNA-binding protein Fis; Provisional Back     alignment and domain information
>PRK13413 mpi multiple promoter invertase; Provisional Back     alignment and domain information
>PF01710 HTH_Tnp_IS630: Transposase; InterPro: IPR002622 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF01381 HTH_3: Helix-turn-helix; InterPro: IPR001387 This is large family of DNA binding helix-turn helix proteins that include a bacterial plasmid copy control protein, bacterial methylases, various bacteriophage transcription control proteins and a vegetative specific protein from Dictyostelium discoideum (Slime mould) Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR03070 couple_hipB transcriptional regulator, y4mF family Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>PRK13182 racA polar chromosome segregation protein; Reviewed Back     alignment and domain information
>PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A Back     alignment and domain information
>cd01105 HTH_GlnR-like Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators Back     alignment and domain information
>smart00422 HTH_MERR helix_turn_helix, mercury resistance Back     alignment and domain information
>cd04774 HTH_YfmP Helix-Turn-Helix DNA binding domain of the YfmP transcription regulator Back     alignment and domain information
>PRK12515 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF11112 PyocinActivator: Pyocin activator protein PrtN Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator Back     alignment and domain information
>cd04773 HTH_TioE_rpt2 Second Helix-Turn-Helix DNA binding domain of the regulatory protein TioE Back     alignment and domain information
>PRK09978 DNA-binding transcriptional regulator GadX; Provisional Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>COG1342 Predicted DNA-binding proteins [General function prediction only] Back     alignment and domain information
>cd04768 HTH_BmrR-like Helix-Turn-Helix DNA binding domain of BmrR-like transcription regulators Back     alignment and domain information
>PF12844 HTH_19: Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B Back     alignment and domain information
>TIGR02989 Sig-70_gvs1 RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family Back     alignment and domain information
>cd04775 HTH_Cfa-like Helix-Turn-Helix DNA binding domain of Cfa-like transcription regulators Back     alignment and domain information
>smart00497 IENR1 Intron encoded nuclease repeat motif Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK15043 transcriptional regulator MirA; Provisional Back     alignment and domain information
>COG1595 RpoE DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription] Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA Back     alignment and domain information
>PF13560 HTH_31: Helix-turn-helix domain; PDB: 3F51_C 3F52_A 3PXP_A 2OFY_A Back     alignment and domain information
>cd01282 HTH_MerR-like_sg3 Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily Back     alignment and domain information
>cd04789 HTH_Cfa Helix-Turn-Helix DNA binding domain of the Cfa transcription regulator Back     alignment and domain information
>PF07453 NUMOD1: NUMOD1 domain; InterPro: IPR010896 This helix-turn-helix-containing DNA-binding domain is found associated in homing nucleases [] Back     alignment and domain information
>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>cd01279 HTH_HspR-like Helix-Turn-Helix DNA binding domain of HspR-like transcription regulators Back     alignment and domain information
>PRK13503 transcriptional activator RhaS; Provisional Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>KOG0251 consensus Clathrin assembly protein AP180 and related proteins, contain ENTH domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA01976 helix-turn-helix protein Back     alignment and domain information
>PRK09645 RNA polymerase sigma factor SigL; Provisional Back     alignment and domain information
>PF03374 ANT: Phage antirepressor protein KilAC domain; InterPro: IPR005039 This entry is represented by Bacteriophage P1, Ant1 C-terminal domain, which represents the processed Ant2 chain Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information
>COG1476 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR02999 Sig-70_X6 RNA polymerase sigma factor, TIGR02999 family Back     alignment and domain information
>PRK12533 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK12529 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PRK09642 RNA polymerase sigma factor SigW; Reviewed Back     alignment and domain information
>PRK09726 antitoxin HipB; Provisional Back     alignment and domain information
>PRK09649 RNA polymerase sigma factor SigC; Reviewed Back     alignment and domain information
>cd00592 HTH_MerR-like Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PHA00542 putative Cro-like protein Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>cd01106 HTH_TipAL-Mta Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF03683 UPF0175: Uncharacterised protein family (UPF0175); InterPro: IPR005368 This entry contains small proteins of unknown function Back     alignment and domain information
>PRK12511 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF12833 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>PRK09641 RNA polymerase sigma factor SigW; Provisional Back     alignment and domain information
>PRK09637 RNA polymerase sigma factor SigZ; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
2o3f_A111 Putative HTH-type transcriptional regulator YBBH; 96.06
3e7l_A63 Transcriptional regulator (NTRC family); sigma43 a 95.98
1g2h_A61 Transcriptional regulatory protein TYRR homolog; p 95.36
3iwf_A107 Transcription regulator RPIR family; transcription 95.29
2k9s_A107 Arabinose operon regulatory protein; activator, ar 95.27
1umq_A81 Photosynthetic apparatus regulatory protein; DNA-b 95.1
1bl0_A129 Protein (multiple antibiotic resistance protein), 94.97
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 94.68
3mn2_A108 Probable ARAC family transcriptional regulator; st 94.52
1ntc_A91 Protein (nitrogen regulation protein (NTRC)); heli 94.37
1eto_A98 FIS, factor for inversion stimulation; transcripti 94.35
3mkl_A120 HTH-type transcriptional regulator GADX; PSI2, MCS 94.18
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 94.16
3oou_A108 LIN2118 protein; protein structure initiative, PSI 94.02
3lsg_A103 Two-component response regulator YESN; structural 93.84
3oio_A113 Transcriptional regulator (ARAC-type DNA-binding c 93.79
1j9i_A68 GPNU1 DBD;, terminase small subunit; DNA binding d 92.49
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 91.95
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 91.11
2jml_A81 DNA binding domain/transcriptional regulator; anti 90.79
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 90.78
2xi8_A66 Putative transcription regulator; HTH DNA-binding 90.51
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 89.42
2r1j_L68 Repressor protein C2; protein-DNA complex, helix-t 89.38
1zug_A71 Phage 434 CRO protein; gene regulating protein, tr 89.28
1r69_A69 Repressor protein CI; gene regulating protein; 2.0 88.81
3gbg_A276 TCP pilus virulence regulatory protein; cupin, hel 88.71
3omt_A73 Uncharacterized protein; structural genomics, PSI- 88.66
2wiu_B88 HTH-type transcriptional regulator HIPB; transfera 88.46
2b5a_A77 C.BCLI; helix-turn-helix motif, gene regulation; 1 88.38
3b7h_A78 Prophage LP1 protein 11; structural genomics, PSI2 88.38
1d5y_A292 ROB transcription factor; protein-DNA complex, DNA 88.11
2k9q_A77 Uncharacterized protein; all helix, helix-turn-hel 87.99
1adr_A76 P22 C2 repressor; transcription regulation; NMR {E 87.95
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 87.94
3fmy_A73 HTH-type transcriptional regulator MQSA (YGIT/B302 87.91
1y7y_A74 C.AHDI; helix-turn-helix, DNA-binding protein, tra 87.84
3bs3_A76 Putative DNA-binding protein; XRE-family, structur 87.82
2ef8_A84 C.ECOT38IS, putative transcription factor; helix-t 87.73
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 87.54
3bd1_A79 CRO protein; transcription factor, helix-turn-heli 87.33
2cw1_A65 SN4M; lambda CRO fold, de novo protein; NMR {Synth 87.09
2a6c_A83 Helix-turn-helix motif; putative transcriptional r 86.36
2kpj_A94 SOS-response transcriptional repressor, LEXA; NESG 85.95
3qq6_A78 HTH-type transcriptional regulator SINR; helix-tur 85.93
2ewt_A71 BLDD, putative DNA-binding protein; the DNA-bindin 85.9
1x57_A91 Endothelial differentiation-related factor 1; HMBF 85.39
3op9_A114 PLI0006 protein; structural genomics, PSI-2, prote 85.27
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 85.2
2ict_A94 Antitoxin HIGA; helix-turn-helix, structural genom 85.19
3s8q_A82 R-M controller protein; protein-DNA complex, helix 85.12
3f6w_A83 XRE-family like protein; helix-turn-helix, DNA bin 85.12
2hin_A71 GP39, repressor protein; transcription factor, dim 85.0
3kz3_A80 Repressor protein CI; five helix bundle, DNA-bindi 84.86
3t76_A88 VANU, transcriptional regulator vanug; structural 84.73
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 84.47
2ppx_A99 AGR_C_3184P, uncharacterized protein ATU1735; HTH- 84.47
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 84.45
1y6u_A70 XIS, excisionase from transposon TN916; structure, 84.3
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 84.17
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 83.95
1b0n_A111 Protein (SINR protein); transcription regulator, a 83.79
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 83.33
3mzy_A164 RNA polymerase sigma-H factor; PSI, MCSG, structur 83.09
1lmb_392 Protein (lambda repressor); protein-DNA complex, d 83.06
3eus_A86 DNA-binding protein; structural genomics, PSI2,MCS 83.06
2pij_A67 Prophage PFL 6 CRO; transcription factor, helix-tu 82.97
2vz4_A108 Tipal, HTH-type transcriptional activator TIPA; tr 82.91
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 82.83
2l49_A99 C protein; P2 bacteriophage, P2 C, direct repeats, 82.5
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 82.19
1rzs_A61 Antirepressor, regulatory protein CRO; helix-turn- 82.17
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 81.94
1z4h_A66 TORI, TOR inhibition protein; winged helix, revers 81.84
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 81.81
1u78_A141 TC3 transposase, transposable element TC3 transpos 81.73
3trb_A104 Virulence-associated protein I; mobIle and extrach 81.72
3mlf_A111 Transcriptional regulator; structural genomics, he 81.4
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 81.15
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 80.89
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 80.64
1or7_A194 Sigma-24, RNA polymerase sigma-E factor; regulatio 80.59
1r8d_A109 Transcription activator MTAN; protein-DNA complex, 80.24
1jhg_A101 Trp operon repressor; complex (regulatory protein- 80.18
1qbj_A81 Protein (double-stranded RNA specific adenosine D 80.05
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 Back     alignment and structure
Probab=96.06  E-value=0.0035  Score=49.24  Aligned_cols=35  Identities=9%  Similarity=0.202  Sum_probs=30.7

Q ss_pred             hhcCCcHHHHHHHhCCChHHHHHHHHHcCCCCCCc
Q 023462           36 KYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPY   70 (282)
Q Consensus        36 ~yF~lPi~EAAr~LGVs~T~LKR~CR~lGI~RWPy   70 (282)
                      ...++++.|.|++.|||.+++-|.||++|..-|+-
T Consensus        36 ~~~~~si~elA~~~~vS~aTv~Rf~kklG~~gf~e   70 (111)
T 2o3f_A           36 XAIESTVNEISALANSSDAAVIRLCXSLGLKGFQD   70 (111)
T ss_dssp             HHHTCCHHHHHHHTTCCHHHHHHHHHHTTCSSHHH
T ss_pred             HHHhcCHHHHHHHHCCCHHHHHHHHHHcCCCCHHH
Confidence            33589999999999999999999999999876553
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A Back     alignment and structure
>1g2h_A Transcriptional regulatory protein TYRR homolog; protein structure, , DNA-binding domain, helix- turn-helix motif; NMR {Haemophilus influenzae} SCOP: a.4.1.12 Back     alignment and structure
>3iwf_A Transcription regulator RPIR family; transcriptional, N-terminal, PSI, MCSG, structural genomics, midwest center structural genomics; 1.40A {Staphylococcus epidermidis} Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>1ntc_A Protein (nitrogen regulation protein (NTRC)); helix-turn-helix, FIS, four-helix bundle, transcription regulation; NMR {Salmonella typhimurium} SCOP: a.4.1.12 Back     alignment and structure
>1eto_A FIS, factor for inversion stimulation; transcriptional activation region, DNA-binding protein, transcription activator; 1.90A {Escherichia coli} SCOP: a.4.1.12 PDB: 1etq_A 1ety_A 1fia_A 3fis_A 3iv5_A* 3jr9_A* 3jra_A* 3jrb_A* 3jrc_A* 3jrd_A* 3jre_A* 3jrf_A* 3jrg_A* 3jrh_A* 3jri_A* 1f36_A 1etv_A 1etk_A 1etx_A 1fip_A ... Back     alignment and structure
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} Back     alignment and structure
>1j9i_A GPNU1 DBD;, terminase small subunit; DNA binding domain, homodimer, viral assembly, winged helix-turn-helix, viral protein; NMR {Enterobacteria phage lambda} SCOP: a.6.1.5 Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2jml_A DNA binding domain/transcriptional regulator; anti-repressor, MERR, carotenogenesis; HET: DNA; NMR {Myxococcus xanthus} Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>2xi8_A Putative transcription regulator; HTH DNA-binding motif; HET: GOL; 1.21A {Enterococcus faecalis} PDB: 2gzu_A 1utx_A* 2xj3_A 2xiu_A Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>2r1j_L Repressor protein C2; protein-DNA complex, helix-turn-helix, DNA-binding, transcription, transcription regulation; 1.53A {Enterobacteria phage P22} SCOP: a.35.1.2 PDB: 3jxb_C 3jxc_L 3jxd_L Back     alignment and structure
>1zug_A Phage 434 CRO protein; gene regulating protein, transcription regulation; NMR {Phage 434} SCOP: a.35.1.2 PDB: 2cro_A 3cro_L* Back     alignment and structure
>1r69_A Repressor protein CI; gene regulating protein; 2.00A {Phage 434} SCOP: a.35.1.2 PDB: 1pra_A 1per_L 1rpe_L* 2or1_L* 1r63_A 2r63_A 1sq8_A Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3omt_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>2wiu_B HTH-type transcriptional regulator HIPB; transferase transcription complex, serine kinase, DNA-bindin mercury derivative, repressor; 2.35A {Escherichia coli} PDB: 3dnv_B* 3dnw_B* 3hzi_B* Back     alignment and structure
>2b5a_A C.BCLI; helix-turn-helix motif, gene regulation; 1.54A {Bacillus caldolyticus} SCOP: a.35.1.3 Back     alignment and structure
>3b7h_A Prophage LP1 protein 11; structural genomics, PSI2, MCSG, protein structure initiative, midwest center for structural genomics; 2.00A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1d5y_A ROB transcription factor; protein-DNA complex, DNA, transcription/DNA complex; HET: DNA; 2.70A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 d.60.1.2 Back     alignment and structure
>2k9q_A Uncharacterized protein; all helix, helix-turn-helix, plasmid, structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1adr_A P22 C2 repressor; transcription regulation; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3fmy_A HTH-type transcriptional regulator MQSA (YGIT/B3021); helix-turn-helix, DNA-binding, transcription regulation, DNA binding protein; HET: MEQ; 1.40A {Escherichia coli k-12} Back     alignment and structure
>1y7y_A C.AHDI; helix-turn-helix, DNA-binding protein, transcriptional regulator, transcription regulator; 1.69A {Aeromonas hydrophila} SCOP: a.35.1.3 Back     alignment and structure
>3bs3_A Putative DNA-binding protein; XRE-family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.65A {Bacteroides fragilis} Back     alignment and structure
>2ef8_A C.ECOT38IS, putative transcription factor; helix-turn-helix, DNA binding protein, transcription regulator; HET: CME; 1.95A {Enterobacteria phage P2} Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3bd1_A CRO protein; transcription factor, helix-turn-helix, prophage, structural evolution, transcription; 1.40A {Xylella fastidiosa} Back     alignment and structure
>2cw1_A SN4M; lambda CRO fold, de novo protein; NMR {Synthetic} SCOP: k.46.1.1 Back     alignment and structure
>2a6c_A Helix-turn-helix motif; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: CIT; 1.90A {Nitrosomonas europaea} SCOP: a.35.1.13 Back     alignment and structure
>2kpj_A SOS-response transcriptional repressor, LEXA; NESG, GFT, structural genomics, PSI-2, protein structure initiative; NMR {Eubacterium rectale atcc 33656} Back     alignment and structure
>3qq6_A HTH-type transcriptional regulator SINR; helix-turn-helix motif, biofilm, repressor, SINI; 1.90A {Bacillus subtilis} Back     alignment and structure
>2ewt_A BLDD, putative DNA-binding protein; the DNA-binding domain of BLDD; 1.81A {Streptomyces coelicolor} Back     alignment and structure
>1x57_A Endothelial differentiation-related factor 1; HMBF1alpha, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.35.1.12 Back     alignment and structure
>3op9_A PLI0006 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, transcription regulat; HET: MSE; 1.90A {Listeria innocua} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>2ict_A Antitoxin HIGA; helix-turn-helix, structural genomics, PSI-2, protein struct initiative, northeast structural genomics consortium, NESG; 1.63A {Escherichia coli} SCOP: a.35.1.3 PDB: 2icp_A Back     alignment and structure
>3s8q_A R-M controller protein; protein-DNA complex, helix-turn-helix; HET: DNA; 2.10A {Enterobacter SP} SCOP: a.35.1.0 PDB: 3clc_A* 3ufd_A* Back     alignment and structure
>3f6w_A XRE-family like protein; helix-turn-helix, DNA binding protein, xenobiotic response E family of transcriptional regulators; HET: MSE BTB; 1.85A {Pseudomonas syringae PV} Back     alignment and structure
>2hin_A GP39, repressor protein; transcription factor, dimer interface, helix-turn-helix; 1.05A {Enterobacteria phage N15} PDB: 3qws_A Back     alignment and structure
>3kz3_A Repressor protein CI; five helix bundle, DNA-binding, transcription, transcription regulation; 1.64A {Enterobacteria phage lambda} Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>2ppx_A AGR_C_3184P, uncharacterized protein ATU1735; HTH-motif, XRE-family, structural genomics, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: a.35.1.3 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>1y6u_A XIS, excisionase from transposon TN916; structure, DNA architectural protein, tyrosine recombinase, winged-helix protein; NMR {Enterococcus faecalis} Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>1b0n_A Protein (SINR protein); transcription regulator, antagonist, sporulation; 1.90A {Bacillus subtilis} SCOP: a.34.1.1 a.35.1.3 PDB: 2yal_A Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>3mzy_A RNA polymerase sigma-H factor; PSI, MCSG, structural genomics, midwest center for structura genomics, protein structure initiative; 2.50A {Fusobacterium nucleatum subsp} Back     alignment and structure
>1lmb_3 Protein (lambda repressor); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 1.80A {Enterobacteria phage lambda} SCOP: a.35.1.2 PDB: 1lrp_A 1rio_A 1lli_A* Back     alignment and structure
>3eus_A DNA-binding protein; structural genomics, PSI2,MCSG, protein structure initiative, midwest center for structural genomic binding; 1.80A {Silicibacter pomeroyi} Back     alignment and structure
>2pij_A Prophage PFL 6 CRO; transcription factor, helix-turn-helix, structural evolution, transcription; 1.70A {Pseudomonas fluorescens} Back     alignment and structure
>2vz4_A Tipal, HTH-type transcriptional activator TIPA; transcription, resistance, antibiotic; 2.90A {Streptomyces lividans} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2l49_A C protein; P2 bacteriophage, P2 C, direct repeats, DNA-binding protein, binding protein; NMR {Enterobacteria phage P2} PDB: 2xcj_A Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>1rzs_A Antirepressor, regulatory protein CRO; helix-turn-helix, DNA-binding protein, structural evolution, transcription; NMR {Enterobacteria phage P22} SCOP: a.35.1.2 Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>1z4h_A TORI, TOR inhibition protein; winged helix, reverse turn, protein binding, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>3trb_A Virulence-associated protein I; mobIle and extrachromosomal element functions, DNA binding P; 2.00A {Coxiella burnetii} Back     alignment and structure
>3mlf_A Transcriptional regulator; structural genomics, helix-turn-helix XRE-family like protei transcription regulator, PSI-2; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} SCOP: a.4.13.2 a.177.1.1 PDB: 2h27_A Back     alignment and structure
>1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1g2ha_61 Transcriptional regulator TyrR, C-terminal domain 96.52
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 95.42
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 95.16
d1ntca_91 DNA-binding domain of NTRC {Salmonella typhimurium 94.3
d1etxa_89 FIS protein {Escherichia coli [TaxId: 562]} 94.15
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 92.43
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 92.03
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 91.86
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 89.37
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 89.1
d2ppxa162 Uncharacterized protein Atu1735 {Agrobacterium tum 88.79
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 88.48
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 88.29
d2icta187 Antitoxin HigA {Escherichia coli [TaxId: 562]} 86.59
d1b0na268 SinR repressor, DNA-binding domain {Bacillus subti 86.31
d2auwa167 Hypothetical protein NE0471 C-terminal domain {Nit 86.07
d2b5aa177 Regulatory protein C.BclI {Bacillus caldolyticus [ 85.28
d1r69a_63 434 C1 repressor, DNA-binding domain {Bacteriophag 84.55
d2a6ca169 HTH-motif protein NE1354 {Nitrosomonas europaea [T 83.62
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.6
d1gdta143 gamma,delta resolvase (C-terminal domain) {Escheri 83.22
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 82.59
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 81.84
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 81.35
d2croa_65 cro 434 {Bacteriophage 434 [TaxId: 10712]} 81.29
d1xsva_106 Hypothetical protein SAV1236 {Staphylococcus aureu 81.11
d1y7ya169 Restriction-modification controller protein C.AhdI 80.9
d1y9qa179 Probable transcriptional regulator VC1968, N-termi 80.74
d1i3ja_96 DNA-binding domain of intron endonuclease I-TevI { 80.58
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 80.5
d1s7oa_106 Hypothetical protein SPy1201 {Streptococcus pyogen 80.41
d1hlva166 DNA-binding domain of centromere binding protein B 80.3
d1yioa170 Response regulatory protein StyR, C-terminal domai 80.14
d1utxa_66 Putative transcription regulator CylR2 {Enterococc 80.05
>d1g2ha_ a.4.1.12 (A:) Transcriptional regulator TyrR, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: FIS-like
domain: Transcriptional regulator TyrR, C-terminal domain
species: Haemophilus influenzae [TaxId: 727]

Probab=96.52  E-value=0.0013  Score=45.91  Aligned_cols=33  Identities=18%  Similarity=0.354  Sum_probs=28.4

Q ss_pred             HHHhhcCCcHHHHHHHhCCChHHHHHHHHHcCCCC
Q 023462           33 DISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDR   67 (282)
Q Consensus        33 dL~~yF~lPi~EAAr~LGVs~T~LKR~CR~lGI~R   67 (282)
                      .|..| + .+.+||+.|||+.++|-|..++|||.|
T Consensus        29 aL~~~-g-n~~~aA~~Lgisr~tL~rKlkk~gi~k   61 (61)
T d1g2ha_          29 FYAEY-P-STRKLAQRLGVSHTAIANKLKQYGIGK   61 (61)
T ss_dssp             HHHHS-C-SHHHHHHHTTSCTHHHHHHHHTTTCCC
T ss_pred             HHHHC-C-CHHHHHHHHCCCHHHHHHHHHHhCCCC
Confidence            34454 5 688999999999999999999999975
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ntca_ a.4.1.12 (A:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ppxa1 a.35.1.3 (A:30-91) Uncharacterized protein Atu1735 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0na2 a.35.1.3 (A:1-68) SinR repressor, DNA-binding domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2auwa1 a.35.1.10 (A:88-154) Hypothetical protein NE0471 C-terminal domain {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2b5aa1 a.35.1.3 (A:1-77) Regulatory protein C.BclI {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1r69a_ a.35.1.2 (A:) 434 C1 repressor, DNA-binding domain {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d2a6ca1 a.35.1.13 (A:1-69) HTH-motif protein NE1354 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gdta1 a.4.1.2 (A:141-183) gamma,delta resolvase (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} Back     information, alignment and structure
>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]} Back     information, alignment and structure
>d1y7ya1 a.35.1.3 (A:5-73) Restriction-modification controller protein C.AhdI {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1y9qa1 a.35.1.8 (A:4-82) Probable transcriptional regulator VC1968, N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1i3ja_ d.285.1.1 (A:) DNA-binding domain of intron endonuclease I-TevI {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s7oa_ a.4.13.3 (A:) Hypothetical protein SPy1201 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1utxa_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure