Citrus Sinensis ID: 023590
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 280 | ||||||
| 359484644 | 304 | PREDICTED: uncharacterized protein LOC10 | 0.689 | 0.634 | 0.771 | 6e-85 | |
| 297738903 | 438 | unnamed protein product [Vitis vinifera] | 0.635 | 0.406 | 0.811 | 5e-83 | |
| 449464344 | 305 | PREDICTED: uncharacterized protein LOC10 | 0.692 | 0.636 | 0.746 | 5e-83 | |
| 363807700 | 309 | uncharacterized protein LOC100818950 [Gl | 0.703 | 0.637 | 0.727 | 5e-80 | |
| 357477907 | 312 | E3 ubiquitin-protein ligase MARCH3 [Medi | 0.707 | 0.634 | 0.740 | 1e-79 | |
| 388520119 | 307 | unknown [Lotus japonicus] | 0.692 | 0.631 | 0.729 | 2e-79 | |
| 363806756 | 300 | uncharacterized protein LOC100782178 [Gl | 0.885 | 0.826 | 0.570 | 2e-79 | |
| 224091379 | 310 | predicted protein [Populus trichocarpa] | 0.660 | 0.596 | 0.755 | 6e-76 | |
| 255576972 | 318 | protein binding protein, putative [Ricin | 0.717 | 0.632 | 0.695 | 2e-74 | |
| 224114355 | 308 | predicted protein [Populus trichocarpa] | 0.685 | 0.623 | 0.684 | 1e-73 |
| >gi|359484644|ref|XP_002281763.2| PREDICTED: uncharacterized protein LOC100254401 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 320 bits (819), Expect = 6e-85, Method: Compositional matrix adjust.
Identities = 155/201 (77%), Positives = 170/201 (84%), Gaps = 8/201 (3%)
Query: 1 MKGDLQLEQFSERNPSDADPLLGSQEVSDAPVVSSPSSSSSSEIKDEDIENGSLPCCRIC 60
MKG++QLE ERNP D+DPLL +Q + S+ SSSEI EDIE GS+PCCRIC
Sbjct: 1 MKGEVQLEPSGERNPRDSDPLLENQ--------ADSSTGSSSEINSEDIEAGSVPCCRIC 52
Query: 61 LENDGEPDDELISPCMCKGTQQFVHRACLDHWRSVKEGFAFSHCTTCKAQFHLRVELFED 120
LE DGEPDDELISPCMCKGTQQFVHR+CLDHWRSVKEGFAFSHCTTCKAQ+HL+V LFED
Sbjct: 53 LECDGEPDDELISPCMCKGTQQFVHRSCLDHWRSVKEGFAFSHCTTCKAQYHLQVALFED 112
Query: 121 NSWRKIKFRLFVARDVFFVFLAVQTIIAAMGGFAYLMDKDGAFRNSFSDGWDRILSKHPI 180
NSWRKIKFRLFVARDVF VFLAVQT+I AMGGFAY+MDKDGAFRNSFSDGWDRILS+HPI
Sbjct: 113 NSWRKIKFRLFVARDVFLVFLAVQTVIGAMGGFAYIMDKDGAFRNSFSDGWDRILSRHPI 172
Query: 181 PFYYCIELLLWVGSLGLFPCI 201
PFYYCI +L + LG F I
Sbjct: 173 PFYYCIGVLAFFVLLGFFGLI 193
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297738903|emb|CBI28148.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449464344|ref|XP_004149889.1| PREDICTED: uncharacterized protein LOC101220313 [Cucumis sativus] gi|449533550|ref|XP_004173737.1| PREDICTED: uncharacterized LOC101220313 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363807700|ref|NP_001241911.1| uncharacterized protein LOC100818950 [Glycine max] gi|255641889|gb|ACU21213.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357477907|ref|XP_003609239.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula] gi|355510294|gb|AES91436.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388520119|gb|AFK48121.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|363806756|ref|NP_001242276.1| uncharacterized protein LOC100782178 [Glycine max] gi|255641332|gb|ACU20943.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224091379|ref|XP_002309239.1| predicted protein [Populus trichocarpa] gi|222855215|gb|EEE92762.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255576972|ref|XP_002529371.1| protein binding protein, putative [Ricinus communis] gi|223531191|gb|EEF33038.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224114355|ref|XP_002332377.1| predicted protein [Populus trichocarpa] gi|222832201|gb|EEE70678.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 280 | ||||||
| TAIR|locus:2197434 | 321 | AT1G11020 [Arabidopsis thalian | 0.807 | 0.704 | 0.610 | 6.3e-69 | |
| TAIR|locus:2008056 | 250 | AT1G50440 [Arabidopsis thalian | 0.503 | 0.564 | 0.470 | 1.3e-29 | |
| UNIPROTKB|B9EJE7 | 138 | MARCH3 "Membrane-associated ri | 0.228 | 0.463 | 0.375 | 1.2e-08 | |
| WB|WBGene00008433 | 206 | D2089.2 [Caenorhabditis elegan | 0.228 | 0.310 | 0.4 | 1.3e-08 | |
| UNIPROTKB|D6RGC4 | 545 | MARCH1 "E3 ubiquitin-protein l | 0.539 | 0.277 | 0.283 | 2.7e-08 | |
| UNIPROTKB|F1NAM1 | 185 | MARCH3 "Uncharacterized protei | 0.185 | 0.281 | 0.421 | 6.2e-08 | |
| UNIPROTKB|F1MM17 | 272 | MARCH1 "Uncharacterized protei | 0.353 | 0.363 | 0.326 | 1.2e-07 | |
| UNIPROTKB|Q8TCQ1 | 289 | MARCH1 "E3 ubiquitin-protein l | 0.353 | 0.342 | 0.317 | 3.3e-07 | |
| UNIPROTKB|E1C485 | 688 | MARCH7 "Uncharacterized protei | 0.264 | 0.107 | 0.358 | 3.3e-07 | |
| UNIPROTKB|F1NSN9 | 235 | MARCH1 "Uncharacterized protei | 0.310 | 0.370 | 0.326 | 3.6e-07 |
| TAIR|locus:2197434 AT1G11020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 699 (251.1 bits), Expect = 6.3e-69, P = 6.3e-69
Identities = 146/239 (61%), Positives = 167/239 (69%)
Query: 1 MKGDLQLEQFSERNPSDADPLLGSQEVSDAXXXXXXXXXX--XXEIK-DEDIEN--GSLP 55
M+G++QL+ + SD+ PLLG S + EIK +ED+EN S P
Sbjct: 2 MQGEVQLQPPDSQKLSDSAPLLGDHTNSSSASPSAASVVAGNSDEIKAEEDLENDASSAP 61
Query: 56 CCRICLENDGEP-DDELISPCMCKGTQQFVHRACLDHWRSVKEGFAFSHCTTCKAQFHLR 114
CCRICLE+D E DELISPCMCKGTQQFVHR+CLDHWRSVKEGFAFSHCTTCKAQFHLR
Sbjct: 62 CCRICLEDDSELLGDELISPCMCKGTQQFVHRSCLDHWRSVKEGFAFSHCTTCKAQFHLR 121
Query: 115 VELFEDN-SWR-KIKFRLFVARDVFFVFLAVQTIIAAMGGFAYLMDKDGAFRNSFSDGWD 172
VE FEDN SWR K KFRLFVARDV VFLAVQT+IA M GFAY+MDKDG FRNSF+D WD
Sbjct: 122 VEPFEDNNSWRRKAKFRLFVARDVLLVFLAVQTVIAVMAGFAYMMDKDGEFRNSFNDDWD 181
Query: 173 RILSKHPIPFYYCIELLLW---VGSLGLF-PCIYGSMLCPGYRFCCHFCHSWYSL-WFP 226
RILSKHPIPFYYCI ++ + G LG+ C + P C + C+ W L FP
Sbjct: 182 RILSKHPIPFYYCIGVISFFVLTGFLGIILHCSALNGNDPRMAGCQNCCYGWGVLDCFP 240
|
|
| TAIR|locus:2008056 AT1G50440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B9EJE7 MARCH3 "Membrane-associated ring finger (C3HC4) 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00008433 D2089.2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RGC4 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAM1 MARCH3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MM17 MARCH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TCQ1 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C485 MARCH7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NSN9 MARCH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 280 | |||
| smart00744 | 49 | smart00744, RINGv, The RING-variant domain is a C4 | 3e-13 | |
| pfam12906 | 47 | pfam12906, RINGv, RING-variant domain | 1e-09 | |
| COG5183 | 1175 | COG5183, SSM4, Protein involved in mRNA turnover a | 1e-08 |
| >gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
Score = 62.3 bits (152), Expect = 3e-13
Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)
Query: 56 CCRICLENDGEPDDELISPCMCKGTQQFVHRACLDHWRSVKEGFAFSHCTTCK 108
CRIC + + D L+SPC CKG+ ++VH+ CL+ W + C CK
Sbjct: 1 ICRICHDEG-DEGDPLVSPCRCKGSLKYVHQECLERWINESGN---KTCEICK 49
|
Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49 |
| >gnl|CDD|221845 pfam12906, RINGv, RING-variant domain | Back alignment and domain information |
|---|
| >gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 99.78 | |
| PHA02862 | 156 | 5L protein; Provisional | 99.78 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 99.68 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 99.66 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 99.62 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 99.57 | |
| KOG1609 | 323 | consensus Protein involved in mRNA turnover and st | 99.39 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 96.86 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.23 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 95.89 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 95.7 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.55 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 94.91 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 94.82 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 93.64 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 93.33 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 93.15 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 93.15 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 92.87 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 92.82 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 91.99 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.8 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.3 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 88.68 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 88.51 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 87.76 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 87.27 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 85.72 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 85.37 |
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
Probab=99.78 E-value=2.6e-19 Score=154.89 Aligned_cols=74 Identities=23% Similarity=0.580 Sum_probs=63.3
Q ss_pred cCCCCCCcceEeccCCCCCCCccccccccCCCCcccchhhHHHHHHhhcCccccccccccceeeeeeeeeccccccccce
Q 023590 49 IENGSLPCCRICLENDGEPDDELISPCMCKGTQQFVHRACLDHWRSVKEGFAFSHCTTCKAQFHLRVELFEDNSWRKIKF 128 (280)
Q Consensus 49 ~~~~~~~~CRIC~~~~~e~~~~LIsPC~CkGSlkyVH~~CL~~Wi~~s~~~~~~~CElCk~~y~~~~~~~~~~~W~~l~~ 128 (280)
+++...+.||||++++ +++.+||+|+||++|||++||++|+..++ ...||+|+++|.++...+++++|.--+.
T Consensus 3 ~~s~~~~~CRIC~~~~----~~~~~PC~CkGs~k~VH~sCL~rWi~~s~---~~~CeiC~~~Y~i~~~~kpl~~W~~~~~ 75 (162)
T PHA02825 3 DVSLMDKCCWICKDEY----DVVTNYCNCKNENKIVHKECLEEWINTSK---NKSCKICNGPYNIKKNYKKCTKWRCSFR 75 (162)
T ss_pred CcCCCCCeeEecCCCC----CCccCCcccCCCchHHHHHHHHHHHhcCC---CCcccccCCeEEEEEecCCCccccccCc
Confidence 4567788999999753 24679999999999999999999999875 5799999999999988899999976554
Q ss_pred e
Q 023590 129 R 129 (280)
Q Consensus 129 ~ 129 (280)
.
T Consensus 76 d 76 (162)
T PHA02825 76 D 76 (162)
T ss_pred c
Confidence 4
|
|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 280 | ||||
| 2d8s_A | 80 | Solution Structure Of The Ring Domain Of The Human | 2e-04 |
| >pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 280 | |||
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 1e-18 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 5e-16 |
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
Score = 77.3 bits (190), Expect = 1e-18
Identities = 31/89 (34%), Positives = 44/89 (49%), Gaps = 11/89 (12%)
Query: 34 SSPSSSSSSEIKDEDIENGSLPCCRICLENDGEPDDELISPCMCKGTQQFVHRACLDHWR 93
SS SS +S +DI CRIC +G+ + LI+PC C G+ FVH+ACL W
Sbjct: 2 SSGSSGTSITPSSQDI-------CRICHC-EGDDESPLITPCHCTGSLHFVHQACLQQWI 53
Query: 94 SVKEGFAFSHCTTCKAQFHLRVELFEDNS 122
+ C CK +F + +L +S
Sbjct: 54 KSSDT---RCCELCKYEFIMETKLSGPSS 79
|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 99.72 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.64 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 97.7 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.55 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.53 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.51 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.49 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 97.46 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.29 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 97.27 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.15 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.15 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.07 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 96.98 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 96.94 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 96.9 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 96.83 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 96.8 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 96.75 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 96.59 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 96.49 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 96.44 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 96.38 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 96.31 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 96.31 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 96.29 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 96.21 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 95.99 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 95.73 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 95.68 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 95.62 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 95.47 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 95.46 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 95.35 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 95.3 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.09 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 95.06 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 95.03 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 94.65 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 94.6 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 94.59 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 94.48 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 94.46 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 93.93 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 93.8 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 93.71 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 93.56 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 93.15 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 92.91 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 92.87 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 91.9 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 91.47 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 91.22 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 91.2 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 91.07 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 90.34 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 88.8 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 88.71 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 88.64 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 87.95 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 87.74 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 86.92 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 85.36 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 83.77 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 81.38 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 80.95 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 80.9 |
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
Probab=99.72 E-value=1.4e-18 Score=126.73 Aligned_cols=57 Identities=32% Similarity=0.790 Sum_probs=49.6
Q ss_pred CCCCcceEeccCCCCCCCccccccccCCCCcccchhhHHHHHHhhcCccccccccccceeeee
Q 023590 52 GSLPCCRICLENDGEPDDELISPCMCKGTQQFVHRACLDHWRSVKEGFAFSHCTTCKAQFHLR 114 (280)
Q Consensus 52 ~~~~~CRIC~~~~~e~~~~LIsPC~CkGSlkyVH~~CL~~Wi~~s~~~~~~~CElCk~~y~~~ 114 (280)
.+.+.||||+++. ++++++||+|+||+++||+.||++|+..++ ...||+|+++|+++
T Consensus 4 ~~~~~CrIC~~~~---~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~---~~~C~~C~~~~~~r 60 (60)
T 1vyx_A 4 EDVPVCWICNEEL---GNERFRACGCTGELENVHRSCLSTWLTISR---NTACQICGVVYNTR 60 (60)
T ss_dssp CSCCEETTTTEEC---SCCCCCSCCCSSGGGSCCHHHHHHHHHHHT---CSBCTTTCCBCCCC
T ss_pred CCCCEeEEeecCC---CCceecCcCCCCchhhhHHHHHHHHHHhCC---CCccCCCCCeeecC
Confidence 4567999999753 457999999999999999999999999875 37999999999874
|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 280 | ||||
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 1e-06 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 1e-04 |
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: Variant RING domain domain: IE1B protein (ORF K3), N-terminal domain species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]
Score = 42.9 bits (100), Expect = 1e-06
Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 6/66 (9%)
Query: 49 IENGSLPCCRICLENDGEPDDELISPCMCKGTQQFVHRACLDHWRSVKEGFAFSHCTTCK 108
+E+ +P C IC E E +E C C G + VHR+CL W ++ + C C
Sbjct: 1 MEDEDVPVCWICNE---ELGNERFRACGCTGELENVHRSCLSTWLTI---SRNTACQICG 54
Query: 109 AQFHLR 114
++ R
Sbjct: 55 VVYNTR 60
|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 280 | |||
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.43 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 97.44 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 97.35 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.25 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.16 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.1 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.08 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 96.56 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.04 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 95.35 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 94.92 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 91.48 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 89.66 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 88.97 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 87.34 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 85.79 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 85.69 |
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: Variant RING domain domain: IE1B protein (ORF K3), N-terminal domain species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]
Probab=99.43 E-value=1.7e-14 Score=102.26 Aligned_cols=57 Identities=32% Similarity=0.790 Sum_probs=49.2
Q ss_pred CCCCcceEeccCCCCCCCccccccccCCCCcccchhhHHHHHHhhcCccccccccccceeeee
Q 023590 52 GSLPCCRICLENDGEPDDELISPCMCKGTQQFVHRACLDHWRSVKEGFAFSHCTTCKAQFHLR 114 (280)
Q Consensus 52 ~~~~~CRIC~~~~~e~~~~LIsPC~CkGSlkyVH~~CL~~Wi~~s~~~~~~~CElCk~~y~~~ 114 (280)
.+.++|+||+++. +++++.||.|+|+.+++|+.||++|++.++ ..+|++|+++|+++
T Consensus 4 ed~~~C~IC~~~~---~~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~---~~~CP~Cr~~~~~k 60 (60)
T d1vyxa_ 4 EDVPVCWICNEEL---GNERFRACGCTGELENVHRSCLSTWLTISR---NTACQICGVVYNTR 60 (60)
T ss_dssp CSCCEETTTTEEC---SCCCCCSCCCSSGGGSCCHHHHHHHHHHHT---CSBCTTTCCBCCCC
T ss_pred CCCCCCccCCccC---CCceeEecccCCCCCEEcHHHHHHHHhhCC---CCCCcccCCeeecC
Confidence 4567899999753 467899999999999999999999998875 36899999999864
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|