Citrus Sinensis ID: 023629

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MENFSHQSATACPDQMNYWAANSNFPLTWLQQTPAPHVNSSASTSNSNSNSIDHHFHELPYSWSNINPMTQEVAEDRATAVSKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAMEVSKTLTIPTEVDEVTVECELFQAAEARAETEAGSSINKVKGDTLIKASVSCDDQPELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDACDHQESVSLSRRLKQALHLALSRMSSSSSMASNCRIRSKRQRLFLPYHN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccEEEEccEEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccc
ccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccHHccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEccccc
menfshqsatacpdqmnywaansnfpltwlqqtpaphvnssastsnsnsnsidhhfhelpyswsninpmtQEVAEDRATAVSKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAMEVSKtltiptevdEVTVECELFQAAEARAEteagssinkvkGDTLIKasvscddqpELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNkdacdhqesvSLSRRLKQALHLALSrmsssssmasncrirskrqrlflpyhn
MENFSHQSATACPDQMNYWAANSNFPLTWLQQTPAPHVNSSASTSNSNSNSIDHHFHELPYSWSNINPMTQEVAEDRATAVskshsqaekrrrdriNAQLAtlrklipksekMDKAALLGSAIEHVKDLKLKAMEVSKtltiptevdevTVECELFQAAEaraeteagssinkvkgdTLIKAsvscddqpeLYKEIIRVLKGLGLTTvradissvggrIKSILVLCNKDACDHQESVSLSRRLKQALHLAlsrmsssssmasncrirskrqrlflpyhn
MENFSHQSATACPDQMNYWAANSNFPLTWLQQTPAPHVnssastsnsnsnsIDHHFHELPYSWSNINPMTQEVAEDRATAVSKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAMEVSKTLTIPTEVDEVTVECELFQAAEARAETEAGSSINKVKGDTLIKASVSCDDQPELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDACDHQESVSLSRRLKQALHlalsrmsssssmasNCRIRSKRQRLFLPYHN
**************QMNYWAANSNFPLTWLQ***************************LPYSW*****************************************************ALLGSAIEHVKDLKLKAMEVSKTLTIPTEVDEVTVECELFQAAE*************VKGDTLIKASVSCDDQPELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDACDH**********************************************
********************************************************************************************RDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDL************************************************TLIKASVSCDDQPELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDAC*****VSLSRRLKQALH************************L******
**********ACPDQMNYWAANSNFPLTWLQQTP****************SIDHHFHELPYSWSNINPMTQEVA*******************DRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAMEVSKTLTIPTEVDEVTVECELFQAAEA********SINKVKGDTLIKASVSCDDQPELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDACDHQESVSLSRRLKQALH*****************IRSKRQRLFLPYHN
*********TAC*******AANSNFPLTWLQQ***************************PYSWS************************EKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAMEVSKTLTIPTEVDEVTVECE********************KGDTLIKASVSCDDQPELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDACDHQESVSLSRRLKQALHLALSRMS************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENFSHQSATACPDQMNYWAANSNFPLTWLQQTPAPHVNSSASTSNSNSNSIDHHFHELPYSWSNINPMTQEVAEDRATAVSKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAMEVSKTLTIPTEVDEVTVECELFQAAEARAETEAGSSINKVKGDTLIKASVSCDDQPELYKEIIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDACDHQESVSLSRRLKQALHLALSRMSSSSSMASNCRIRSKRQRLFLPYHN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q9XEF0254 Transcription factor bHLH yes no 0.677 0.744 0.485 2e-38
Q9LS08344 Transcription factor AIG1 no no 0.498 0.404 0.432 4e-26
Q9S7Y1368 Transcription factor bHLH no no 0.544 0.413 0.416 2e-24
Q9LET0230 Putative transcription fa no no 0.591 0.717 0.361 2e-21
O80674253 Transcription factor bHLH no no 0.620 0.683 0.343 5e-17
P0CB25256 Transcription factor bHLH no no 0.433 0.472 0.317 4e-12
Q39204623 Transcription factor MYC2 no no 0.247 0.110 0.4 2e-08
Q8GZ38399 Transcription factor UNE1 no no 0.229 0.160 0.411 6e-08
Q9ZPY8566 Transcription factor ABA- no no 0.247 0.121 0.410 1e-07
Q9LPW3450 Transcription factor SCRE no no 0.465 0.288 0.291 1e-07
>sp|Q9XEF0|BH051_ARATH Transcription factor bHLH51 OS=Arabidopsis thaliana GN=BHLH51 PE=2 SV=1 Back     alignment and function desciption
 Score =  159 bits (403), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 134/206 (65%), Gaps = 17/206 (8%)

Query: 76  DRATAVSKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAME 135
           ++A ++S+SH  AEKRRRDRIN+ L  LRKL+P S+K+DKAALL + IE VK+LK KA E
Sbjct: 58  EKAESLSRSHRLAEKRRRDRINSHLTALRKLVPNSDKLDKAALLATVIEQVKELKQKAAE 117

Query: 136 VSKTLTIPTEVDEVTVECELFQAAEARAETEAGSSINKVKGDTLIKASVSCDDQPELYKE 195
                 +PTE DEVTV+ E     E+   T             + KAS  C+DQPE   E
Sbjct: 118 SPIFQDLPTEADEVTVQPETISDFESNTNT------------IIFKASFCCEDQPEAISE 165

Query: 196 IIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDA-CDHQESVSLS-RRLKQALHLALSR 253
           IIRVL  L L T++A+I SVGGR++   +L  KD+ C+   +++ S + LKQ+L  AL+R
Sbjct: 166 IIRVLTKLQLETIQAEIISVGGRMRINFIL--KDSNCNETTNIAASAKALKQSLCSALNR 223

Query: 254 MSSSSSMASN-CRIRSKRQRLFLPYH 278
           ++SSS+  S+ CRIRSKRQR FL  H
Sbjct: 224 ITSSSTTTSSVCRIRSKRQRWFLSSH 249

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LS08|BH032_ARATH Transcription factor AIG1 OS=Arabidopsis thaliana GN=BHLH32 PE=1 SV=1 Back     alignment and function description
>sp|Q9S7Y1|BH030_ARATH Transcription factor bHLH30 OS=Arabidopsis thaliana GN=BHLH30 PE=1 SV=1 Back     alignment and function description
>sp|Q9LET0|BH107_ARATH Putative transcription factor bHLH107 OS=Arabidopsis thaliana GN=BHLH107 PE=2 SV=1 Back     alignment and function description
>sp|O80674|BH106_ARATH Transcription factor bHLH106 OS=Arabidopsis thaliana GN=BHLH106 PE=2 SV=1 Back     alignment and function description
>sp|P0CB25|BH131_ARATH Transcription factor bHLH131 OS=Arabidopsis thaliana GN=BHLH131 PE=2 SV=1 Back     alignment and function description
>sp|Q39204|RAP1_ARATH Transcription factor MYC2 OS=Arabidopsis thaliana GN=RAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q8GZ38|UNE10_ARATH Transcription factor UNE10 OS=Arabidopsis thaliana GN=UNE10 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPY8|AIB_ARATH Transcription factor ABA-INDUCIBLE bHLH-TYPE OS=Arabidopsis thaliana GN=AIB PE=2 SV=2 Back     alignment and function description
>sp|Q9LPW3|SCRM2_ARATH Transcription factor SCREAM2 OS=Arabidopsis thaliana GN=SCRM2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
224098710259 predicted protein [Populus trichocarpa] 0.842 0.907 0.609 8e-69
224112459259 predicted protein [Populus trichocarpa] 0.770 0.830 0.630 1e-63
356568194261 PREDICTED: transcription factor bHLH51-l 0.770 0.823 0.580 8e-63
359486390252 PREDICTED: transcription factor bHLH51-l 0.795 0.880 0.567 2e-62
297736583297 unnamed protein product [Vitis vinifera] 0.795 0.747 0.567 3e-62
357461291260 Transcription factor bHLH51 [Medicago tr 0.853 0.915 0.549 6e-62
217073676262 unknown [Medicago truncatula] 0.853 0.908 0.549 1e-61
356551418264 PREDICTED: transcription factor bHLH51 [ 0.749 0.791 0.598 2e-61
388508698262 unknown [Medicago truncatula] 0.853 0.908 0.545 1e-60
388519171234 unknown [Lotus japonicus] 0.827 0.987 0.510 2e-59
>gi|224098710|ref|XP_002311240.1| predicted protein [Populus trichocarpa] gi|222851060|gb|EEE88607.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  266 bits (680), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 153/251 (60%), Positives = 185/251 (73%), Gaps = 16/251 (6%)

Query: 29  WLQQTPAPHVNSSASTSNSN-SNSIDHHFHELPYSWSNINPMTQEVAEDRATAVSKSHSQ 87
           W+Q + A +  S      S+ S S +   +  P SWS   P+ QE +E++A + SKSHSQ
Sbjct: 18  WVQTSAAVYDESFLVPCPSHASASANFQVNGFP-SWSI--PI-QEASENKAASNSKSHSQ 73

Query: 88  AEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAMEVSKTLTIPTEVD 147
           AEKRRRDRINAQL  LRKLIPKSEKMDKAALLGSAI+HVKDLK KA E+S+T TIPTEVD
Sbjct: 74  AEKRRRDRINAQLGILRKLIPKSEKMDKAALLGSAIDHVKDLKQKATEISRTFTIPTEVD 133

Query: 148 EVTVECELFQAAEARAETEAGSSINKVKGDTLIKASVSCDDQPELYKEIIRVLKGLGLTT 207
           EVTV+C++ QA          SS NK K  T I+ASV CDD+PEL+ E+IRVL+GL LT 
Sbjct: 134 EVTVDCDVSQATNP-------SSTNKDKDSTFIRASVCCDDRPELFSELIRVLRGLRLTI 186

Query: 208 VRADISSVGGRIKSILVLCNKDACDHQESVSLSRRLKQALHLALSRMSSSSSMASNCRIR 267
           VRADI+SVGGR+KSILVLCNK  C  +  VS+S  +KQ+L+L LSR+ +SSS+ SN RIR
Sbjct: 187 VRADIASVGGRVKSILVLCNK--CSKEGGVSIS-TIKQSLNLVLSRI-ASSSVPSNYRIR 242

Query: 268 SKRQRLFLPYH 278
           SKRQR FLP H
Sbjct: 243 SKRQRFFLPSH 253

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224112459|ref|XP_002316199.1| predicted protein [Populus trichocarpa] gi|222865239|gb|EEF02370.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356568194|ref|XP_003552298.1| PREDICTED: transcription factor bHLH51-like [Glycine max] Back     alignment and taxonomy information
>gi|359486390|ref|XP_002272668.2| PREDICTED: transcription factor bHLH51-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736583|emb|CBI25454.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357461291|ref|XP_003600927.1| Transcription factor bHLH51 [Medicago truncatula] gi|355489975|gb|AES71178.1| Transcription factor bHLH51 [Medicago truncatula] Back     alignment and taxonomy information
>gi|217073676|gb|ACJ85198.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356551418|ref|XP_003544072.1| PREDICTED: transcription factor bHLH51 [Glycine max] Back     alignment and taxonomy information
>gi|388508698|gb|AFK42415.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388519171|gb|AFK47647.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2065086254 AT2G40200 "AT2G40200" [Arabido 0.677 0.744 0.451 2.4e-35
UNIPROTKB|Q7F7Z2258 Os01g0159800 "ESTs C26093(C116 0.727 0.786 0.4 4.1e-33
TAIR|locus:2085964344 BHLH32 "AT3G25710" [Arabidopsi 0.526 0.427 0.424 7.1e-29
TAIR|locus:2012393368 AT1G68810 "AT1G68810" [Arabido 0.548 0.415 0.416 2.4e-28
UNIPROTKB|Q75IR0271 OSJNBb0099P06.13 "Putative unc 0.666 0.686 0.380 2.8e-27
UNIPROTKB|Q9FTQ1267 P0665D10.21 "DNA binding prote 0.498 0.520 0.437 5.7e-27
UNIPROTKB|Q6ZJC8223 OJ1666_A04.16 "Os08g0477900 pr 0.569 0.713 0.390 3.3e-24
UNIPROTKB|Q6ESL3363 OJ1294_G06.8 "DNA binding prot 0.555 0.426 0.378 1.1e-23
TAIR|locus:2063203253 AT2G41130 "AT2G41130" [Arabido 0.681 0.750 0.327 1.6e-22
UNIPROTKB|Q6ZA99345 P0431A03.9 "Os08g0432800 prote 0.598 0.484 0.36 3.4e-22
TAIR|locus:2065086 AT2G40200 "AT2G40200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 382 (139.5 bits), Expect = 2.4e-35, P = 2.4e-35
 Identities = 93/206 (45%), Positives = 123/206 (59%)

Query:    76 DRATAVSKSHSQAEKRRRDRINAQLATLRKLIPKSEKMDKAALLGSAIEHVKDLKLKAME 135
             ++A ++S+SH  AEKRRRDRIN+ L  LRKL+P S+K+DKAALL + IE VK+LK KA E
Sbjct:    58 EKAESLSRSHRLAEKRRRDRINSHLTALRKLVPNSDKLDKAALLATVIEQVKELKQKAAE 117

Query:   136 VSKTLTIPTEVDEVTVECELFQAAEARAETEAGSSINKVKGDTLIKASVSCDDQPELYKE 195
                   +PTE DEVTV+ E     E+   T             + KAS  C+DQPE   E
Sbjct:   118 SPIFQDLPTEADEVTVQPETISDFESNTNT------------IIFKASFCCEDQPEAISE 165

Query:   196 IIRVLKGLGLTTVRADISSVGGRIKSILVLCNKDA-CDHQESVSLSRR-LKQALHXXXXX 253
             IIRVL  L L T++A+I SVGGR++   +L  KD+ C+   +++ S + LKQ+L      
Sbjct:   166 IIRVLTKLQLETIQAEIISVGGRMRINFIL--KDSNCNETTNIAASAKALKQSLCSALNR 223

Query:   254 XXXXXXXXXN-CRIRSKRQRLFLPYH 278
                      + CRIRSKRQR FL  H
Sbjct:   224 ITSSSTTTSSVCRIRSKRQRWFLSSH 249
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
UNIPROTKB|Q7F7Z2 Os01g0159800 "ESTs C26093(C11622)" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2085964 BHLH32 "AT3G25710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012393 AT1G68810 "AT1G68810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q75IR0 OSJNBb0099P06.13 "Putative uncharacterized protein OSJNBb0099P06.13" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9FTQ1 P0665D10.21 "DNA binding protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZJC8 OJ1666_A04.16 "Os08g0477900 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ESL3 OJ1294_G06.8 "DNA binding protein-like" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2063203 AT2G41130 "AT2G41130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZA99 P0431A03.9 "Os08g0432800 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 5e-11
smart0035353 smart00353, HLH, helix loop helix domain 5e-10
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 1e-09
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 3e-04
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 0.001
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information 
 Score = 56.7 bits (138), Expect = 5e-11
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 2/50 (4%)

Query: 83  KSHSQAEKRRRDRINAQLATLRKLIP--KSEKMDKAALLGSAIEHVKDLK 130
           K+H++ E+RRRDRIN     LR+L+P   ++K+ KA +L  AIE++K L+
Sbjct: 3   KAHNERERRRRDRINDAFEELRELLPTPPNKKLSKAEILRLAIEYIKHLQ 52

Length = 52
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information
>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG1318411 consensus Helix loop helix transcription factor EB 99.6
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.42
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.42
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.42
smart0035353 HLH helix loop helix domain. 99.36
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.3
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.29
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.07
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.05
KOG1319229 consensus bHLHZip transcription factor BIGMAX [Tra 99.03
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 98.98
KOG4304250 consensus Transcriptional repressors of the hairy/ 98.82
PRK05007884 PII uridylyl-transferase; Provisional 98.63
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 98.6
KOG3561 803 consensus Aryl-hydrocarbon receptor nuclear transl 98.57
PRK01759854 glnD PII uridylyl-transferase; Provisional 98.57
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 98.57
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 98.55
PRK00275895 glnD PII uridylyl-transferase; Provisional 98.53
PRK04374869 PII uridylyl-transferase; Provisional 98.47
PRK03059856 PII uridylyl-transferase; Provisional 98.25
PRK05092931 PII uridylyl-transferase; Provisional 98.23
PRK03381774 PII uridylyl-transferase; Provisional 98.23
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 98.13
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 98.12
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 98.1
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 98.09
KOG0561 373 consensus bHLH transcription factor [Transcription 98.08
PRK01759854 glnD PII uridylyl-transferase; Provisional 98.06
PRK05007884 PII uridylyl-transferase; Provisional 97.99
KOG2483232 consensus Upstream transcription factor 2/L-myc-2 97.88
KOG2588 953 consensus Predicted DNA-binding protein [Transcrip 97.87
PRK03381774 PII uridylyl-transferase; Provisional 97.75
PRK00275895 glnD PII uridylyl-transferase; Provisional 97.73
PLN0321793 transcription factor ATBS1; Provisional 97.7
PRK05092931 PII uridylyl-transferase; Provisional 97.68
KOG4029228 consensus Transcription factor HAND2/Transcription 97.67
PRK03059856 PII uridylyl-transferase; Provisional 97.63
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 97.55
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 97.55
PRK04374869 PII uridylyl-transferase; Provisional 97.42
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 97.35
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.35
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.34
KOG3960284 consensus Myogenic helix-loop-helix transcription 97.29
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.14
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.13
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 97.11
PRK0019490 hypothetical protein; Validated 96.97
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 96.85
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 96.83
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 96.73
KOG3910632 consensus Helix loop helix transcription factor [T 96.49
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 96.37
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.37
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 95.63
PRK11589190 gcvR glycine cleavage system transcriptional repre 95.26
KOG4447173 consensus Transcription factor TWIST [Transcriptio 95.13
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 95.09
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 94.96
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 94.93
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 94.87
PRK04435147 hypothetical protein; Provisional 94.66
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 94.65
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 94.17
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 94.16
PRK07334403 threonine dehydratase; Provisional 93.96
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 93.95
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 93.95
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 93.86
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 93.82
PRK08577136 hypothetical protein; Provisional 93.78
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 93.74
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 93.74
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 93.45
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 93.15
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 93.1
cd0211660 ACT ACT domains are commonly involved in specifica 93.06
KOG3560 712 consensus Aryl-hydrocarbon receptor [Transcription 93.0
COG383090 ACT domain-containing protein [Signal transduction 92.06
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 91.98
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 91.65
PRK11589190 gcvR glycine cleavage system transcriptional repre 91.64
KOG3558 768 consensus Hypoxia-inducible factor 1/Neuronal PAS 91.63
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 91.51
PRK00227693 glnD PII uridylyl-transferase; Provisional 91.46
KOG3559 598 consensus Transcriptional regulator SIM1 [Transcri 91.27
PRK00227693 glnD PII uridylyl-transferase; Provisional 91.09
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 90.35
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 90.07
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 89.45
COG4492150 PheB ACT domain-containing protein [General functi 89.21
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 89.21
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 89.12
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 89.06
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 88.97
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 88.83
KOG3898254 consensus Transcription factor NeuroD and related 88.76
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 88.75
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 88.36
KOG4395285 consensus Transcription factor Atonal, contains HT 88.3
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 87.81
CHL00100174 ilvH acetohydroxyacid synthase small subunit 87.16
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 85.91
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 85.74
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 85.57
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 84.39
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 83.92
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 83.66
PRK11899279 prephenate dehydratase; Provisional 81.51
COG2716176 GcvR Glycine cleavage system regulatory protein [A 80.88
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 80.79
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information 
Probab=99.60  E-value=4.5e-15  Score=140.89  Aligned_cols=128  Identities=20%  Similarity=0.279  Sum_probs=89.8

Q ss_pred             CCcccccCCCCC---CccccccCcCCCCCcccCCC--CC-CCCCCCCCCCCCCCCCCcCCCCCCCCCcccCCCCCCccch
Q 023629            1 MENFSHQSATAC---PDQMNYWAANSNFPLTWLQQ--TP-APHVNSSASTSNSNSNSIDHHFHELPYSWSNINPMTQEVA   74 (279)
Q Consensus         1 me~~~~~~~~~~---~~~m~~~~~~~~~~~~~~~q--~~-~p~~~~~s~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   74 (279)
                      |+.+|+......   +.+|.+..+.+++..++|++  +. +|-..   -++.+++.......++.+        ....++
T Consensus       158 ~~~~~~~~~v~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~---~~~~s~~s~~~~~~rt~~--------~~~~~~  226 (411)
T KOG1318|consen  158 LSASFPAQSVGSPAGNGQTANTLTSSGASLNVYPSEGQFNVPMTG---HDSASCPSQLSIGPRTHP--------KTDATA  226 (411)
T ss_pred             cccccCccccCCCCcCCcccceeeccchhcccccccCCCCCCCCc---cccccCccccCCCCCCCC--------Ccccch
Confidence            456666653222   23566777777777777753  12 22221   112233333333444444        455677


Q ss_pred             hhhhhhhhccccHHHHHHHHHHHHHHHHHHhcCCCCC----cCchhhHHHHHHHHHHHHHHHHHHHhhh
Q 023629           75 EDRATAVSKSHSQAEKRRRDRINAQLATLRKLIPKSE----KMDKAALLGSAIEHVKDLKLKAMEVSKT  139 (279)
Q Consensus        75 ~~~~~~~~~~h~~~Er~RR~~in~~~~~L~~lvP~~~----k~dkasil~~ai~yik~L~~~~~~l~~~  139 (279)
                      ..|.+++|.+||++|||||++||++|++|..|||+++    +..|++||..+++||++||+..++..+.
T Consensus       227 ~~rdr~Krd~HNeVERRRR~nIN~~IkeLg~liP~~~~~~~~~nKgtILk~s~dYIr~Lqq~~q~~~E~  295 (411)
T KOG1318|consen  227 LERDRRKRDNHNEVERRRRENINDRIKELGQLIPKCNSEDMKSNKGTILKASCDYIRELQQTLQRAREL  295 (411)
T ss_pred             hHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHhCCCCCcchhhcccchhhHHHHHHHHHHHHHHHHHHHH
Confidence            8899999999999999999999999999999999764    6679999999999999999988865443

>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>KOG4304 consensus Transcriptional repressors of the hairy/E(spl) family (contains HLH) [Transcription] Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>KOG3561 consensus Aryl-hydrocarbon receptor nuclear translocator [Transcription] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>KOG0561 consensus bHLH transcription factor [Transcription] Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG2483 consensus Upstream transcription factor 2/L-myc-2 protein [Transcription] Back     alignment and domain information
>KOG2588 consensus Predicted DNA-binding protein [Transcription] Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG4029 consensus Transcription factor HAND2/Transcription factor TAL1/TAL2/LYL1 [Transcription] Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>KOG3960 consensus Myogenic helix-loop-helix transcription factor [Transcription] Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>KOG3910 consensus Helix loop helix transcription factor [Transcription] Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>KOG4447 consensus Transcription factor TWIST [Transcription] Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>KOG3560 consensus Aryl-hydrocarbon receptor [Transcription] Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>KOG3558 consensus Hypoxia-inducible factor 1/Neuronal PAS domain protein NPAS1 [Signal transduction mechanisms; Transcription] Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>KOG3559 consensus Transcriptional regulator SIM1 [Transcription] Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>KOG3898 consensus Transcription factor NeuroD and related HTH proteins [Transcription] Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>KOG4395 consensus Transcription factor Atonal, contains HTH domain [Transcription] Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
4f3l_B 387 Crystal Structure Of The Heterodimeric Clock:bmal1 4e-05
4h10_A73 Intermolecular Recognition Revealed By The Complex 1e-04
>pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 50/91 (54%), Gaps = 4/91 (4%)
Query: 75  EDRATAVSKSHSQAEKRRRDRINAQLATLRKLIPK----SEKMDKAALLGSAIEHVKDLK 130
           + R     ++HSQ EKRRRD++N+ +  L  L+P     S K+DK  +L  A++H+K L+
Sbjct: 7   QGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLR 66
Query: 131 LKAMEVSKTLTIPTEVDEVTVECELFQAAEA 161
                 ++    PT + +  ++  + +AA+ 
Sbjct: 67  GATNPYTEANYKPTFLSDDELKHLILRAADG 97
>pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex Structure Of Human Clock-bmal1 Basic Helix-loop-helix Domains With E-box Dna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 6e-11
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 3e-10
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 6e-10
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 2e-09
1hlo_A80 Protein (transcription factor MAX); transcriptiona 3e-09
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 4e-08
1a0a_A63 BHLH, protein (phosphate system positive regulator 6e-08
4f3l_A 361 Mclock, circadian locomoter output cycles protein 3e-07
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 Back     alignment and structure
 Score = 56.6 bits (137), Expect = 6e-11
 Identities = 17/48 (35%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 84  SHSQAEKRRRDRINAQLATLRKLIPKSE-KMDKAALLGSAIEHVKDLK 130
           +H+  EKR R  IN ++  L+ L+  +E K++K+A+L  AI++++ L+
Sbjct: 9   AHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQ 56
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Length = 65 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Length = 63 Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.66
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.66
4ati_A118 MITF, microphthalmia-associated transcription fact 99.6
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.6
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.58
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.56
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.55
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.53
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 99.49
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 99.45
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 99.42
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 99.19
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 99.18
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.08
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.99
4ath_A83 MITF, microphthalmia-associated transcription fact 98.86
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.71
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 98.17
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 97.6
1u8s_A192 Glycine cleavage system transcriptional repressor, 97.13
2nyi_A195 Unknown protein; protein structure initiative, PSI 97.03
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.0
2nyi_A195 Unknown protein; protein structure initiative, PSI 96.84
1u8s_A192 Glycine cleavage system transcriptional repressor, 96.6
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 94.53
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 94.27
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 94.06
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 94.05
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 93.48
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 92.91
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 92.78
2pc6_A165 Probable acetolactate synthase isozyme III (small; 91.81
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 90.51
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 89.72
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 88.14
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
Probab=99.66  E-value=9.3e-17  Score=120.64  Aligned_cols=63  Identities=25%  Similarity=0.392  Sum_probs=58.2

Q ss_pred             hhhhhccccHHHHHHHHHHHHHHHHHHhcCCCC-CcCchhhHHHHHHHHHHHHHHHHHHHhhhc
Q 023629           78 ATAVSKSHSQAEKRRRDRINAQLATLRKLIPKS-EKMDKAALLGSAIEHVKDLKLKAMEVSKTL  140 (279)
Q Consensus        78 ~~~~~~~h~~~Er~RR~~in~~~~~L~~lvP~~-~k~dkasil~~ai~yik~L~~~~~~l~~~~  140 (279)
                      ...++.+|+.+||+||++||++|.+|++|||.. .|+||++||.+||+||++|+.+++.|+.+.
T Consensus         3 ~~~rr~~H~~~ErrRR~~in~~f~~L~~lvP~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~   66 (82)
T 1am9_A            3 RGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQEN   66 (82)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHhhhhHHHHHHHHHHHHHHHHHHhccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345778999999999999999999999999986 899999999999999999999999998754
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 7e-10
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 8e-10
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 3e-09
d1nlwa_79 a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T 1e-08
d1mdya_68 a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus muscul 1e-08
d1nkpa_88 a.38.1.1 (A:) Myc proto-oncogene protein {Human (H 2e-08
d1uklc_61 a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId 4e-08
d1am9a_80 a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI 9e-08
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Usf B/HLH domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.7 bits (124), Expect = 7e-10
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 83  KSHSQAEKRRRDRINAQLATLRKLIP------KSEKMDKAALLGSAIEHVKDLK 130
             H++ E+RRRD+IN  +  L K+IP            K  +L  A +++++L+
Sbjct: 7   AQHNEVERRRRDKINNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQELR 60
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 68 Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.57
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.53
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.48
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.47
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 97.68
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 97.56
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 97.19
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 96.12
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 95.38
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 95.06
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 93.01
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 92.06
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 90.16
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 90.0
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 88.85
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 88.33
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 88.08
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: SREBP-1a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.57  E-value=1.3e-15  Score=111.95  Aligned_cols=62  Identities=26%  Similarity=0.402  Sum_probs=56.2

Q ss_pred             hhhhccccHHHHHHHHHHHHHHHHHHhcCCCC-CcCchhhHHHHHHHHHHHHHHHHHHHhhhc
Q 023629           79 TAVSKSHSQAEKRRRDRINAQLATLRKLIPKS-EKMDKAALLGSAIEHVKDLKLKAMEVSKTL  140 (279)
Q Consensus        79 ~~~~~~h~~~Er~RR~~in~~~~~L~~lvP~~-~k~dkasil~~ai~yik~L~~~~~~l~~~~  140 (279)
                      ..++.+|+.+||+||++||+.|.+|++|||.. .|++|++||..||+||++|+.+++.|..+.
T Consensus         4 ~~kR~~H~~~Er~RR~~in~~~~~L~~llP~~~~k~~K~~iL~~a~~yI~~L~~~~~~L~~e~   66 (80)
T d1am9a_           4 GEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQEN   66 (80)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34567899999999999999999999999974 599999999999999999999999987643
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure