Citrus Sinensis ID: 023682


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MLRPNKRGRETEDFSRQQKLQISLNSNICQDEADRSASILNPNPVSTGLRLSYDDDERNSSVTSASGSMTAAPPIILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVNLLKSNLQQAISQGADQGKEGFGDSEVDDAASYINTNNYLTVPSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS
ccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHcccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHcccccccccccccEEEEEEc
ccccccccccHHHHHHccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccccccccccccccccccccccHHHHcccccEEEEEEccccEEEccHHHHHHccccccHcccccEEEEEcc
mlrpnkrgretedfSRQQKLQISLNsnicqdeadrsasilnpnpvstglrlsydddernssvtsasgsmtaappiILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVNLLKSNLQQAISQGadqgkegfgdsevddaasyintnnyltvpsgpgksisrnHQMICRACKAKEAsvllmpcrhlclckdcdvlvavcpvcqfvknasVLVHLS
mlrpnkrgretedfsrqqkLQISLNSNICQDEADrsasilnpnpvstglrlsyDDDERNSSVtsasgsmtaappiILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVNLLKSNLQQAISQGADQGKEGFGDSEVDDAASYINTNNYLTVPSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS
MLRPNKRGRETEDFSRQQKLQISLNSNICQDEADRSASILNPNPVSTGLRLSYDDDERNSSVTSASGSMTAAPPIILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVNLLKSNLQQAISQGADQGKEGFGDSEVDDAASYINTNNYLTVPSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS
**************************************************************************IILSLADNV*********EFDQYIKVQEEYLAKGVQ*********FL******************************RIKQMAAEAQNWHYRAKYNESVVNLLKS**************************SYINTNNYLTV*********RNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVH**
****NKR*****************************************************************************TELDRQKEEFDQYIKVQEEYLAKG*****Q*HMASFLSAIEKGLAKKLQEK*M*IENMNRKNRELIERIKQMAAEAQN**********************************************N*********************ICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS
*****************QKLQISLNSNICQDEADRSASILNPNPVSTGLRLSYDD*************MTAAPPIILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVNLLKSNLQQAISQGADQGKEGFGDSEVDDAASYINTNNYLTVPSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS
*******************LQISLNSN*CQ****RSAS**********************************PPIILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVNLLKSNLQQAISQGADQ*************************************QMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRPNKRGRETEDFSRQQKLQISLNSNICQDEADRSASILNPNPVSTGLRLSYDDDERNSSVTSASGSMTAAPPIILSLxxxxxxxxxxxxxxxxxxxxxQEEYLAKGVQDMKQRHMASFLSAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQNWHYRAKYNESVVNLLKSNLQQAISQGADQGKEGFGDSEVDDAASYINTNNYLTVPSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
Q13489604 Baculoviral IAP repeat-co yes no 0.172 0.079 0.395 3e-05
O08863600 Baculoviral IAP repeat-co yes no 0.175 0.081 0.367 7e-05
O62640358 Putative inhibitor of apo no no 0.172 0.134 0.395 8e-05
Q13490618 Baculoviral IAP repeat-co no no 0.172 0.077 0.375 9e-05
A1E2V0604 Baculoviral IAP repeat-co yes no 0.172 0.079 0.375 9e-05
Q90660611 Inhibitor of apoptosis pr yes no 0.172 0.078 0.375 0.0002
A9ULZ2345 Baculoviral IAP repeat-co N/A no 0.412 0.333 0.230 0.0004
Q62210612 Baculoviral IAP repeat-co no no 0.172 0.078 0.333 0.0006
Q8JHV9401 Baculoviral IAP repeat-co N/A no 0.175 0.122 0.346 0.0007
>sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 Back     alignment and function desciption
 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%)

Query: 232 CRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS 279
           C+ C  KE S++ +PC HL +CKDC   +  CP+C+     +V   LS
Sbjct: 557 CKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS 604




Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and regulates both canonical and non-canonical NF-kappa-B signaling by acting in opposite directions: acts as a positive regulator of the canonical pathway and suppresses constitutive activation of non-canonical NF-kappa-B signaling. The target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, TRAF1, and BCL10. Acts as an important regulator of innate immune signaling via regulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs) and RIG-I like receptors (RLRs), collectively referred to as pattern recognition receptors (PRRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 Back     alignment and function description
>sp|O62640|PIAP_PIG Putative inhibitor of apoptosis OS=Sus scrofa GN=PIAP PE=2 SV=1 Back     alignment and function description
>sp|Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens GN=BIRC2 PE=1 SV=2 Back     alignment and function description
>sp|A1E2V0|BIRC3_CANFA Baculoviral IAP repeat-containing protein 3 OS=Canis familiaris GN=BIRC3 PE=2 SV=1 Back     alignment and function description
>sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus GN=ITA PE=2 SV=1 Back     alignment and function description
>sp|A9ULZ2|BIR7B_XENLA Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis GN=birc7-b PE=2 SV=2 Back     alignment and function description
>sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1 Back     alignment and function description
>sp|Q8JHV9|BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis GN=birc7-a PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
224107815339 predicted protein [Populus trichocarpa] 1.0 0.823 0.757 1e-125
147822224346 hypothetical protein VITISV_032504 [Viti 0.992 0.800 0.696 1e-116
356502299337 PREDICTED: uncharacterized protein LOC10 0.996 0.824 0.699 1e-115
356497708337 PREDICTED: uncharacterized protein LOC10 0.996 0.824 0.696 1e-114
297739068335 unnamed protein product [Vitis vinifera] 0.946 0.788 0.691 1e-112
255568840310 ATP binding protein, putative [Ricinus c 0.856 0.770 0.816 1e-111
449450452305 PREDICTED: uncharacterized protein LOC10 0.853 0.780 0.786 1e-105
449500320305 PREDICTED: uncharacterized LOC101209865 0.853 0.780 0.782 1e-104
225457007334 PREDICTED: uncharacterized protein LOC10 0.985 0.823 0.653 1e-101
147841524360 hypothetical protein VITISV_003762 [Viti 0.985 0.763 0.653 1e-101
>gi|224107815|ref|XP_002314611.1| predicted protein [Populus trichocarpa] gi|222863651|gb|EEF00782.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/284 (75%), Positives = 245/284 (86%), Gaps = 5/284 (1%)

Query: 1   MLRPNKRGRETEDFSRQQKLQISLNSNICQDEADRSASILNPNPVSTGLRLSYDDDERNS 60
           +LR NKRGRE EDF RQQKLQISLN NICQDEADRSASI NPNPVSTGLRLSYDDDE NS
Sbjct: 56  ILRANKRGREAEDFGRQQKLQISLNYNICQDEADRSASIPNPNPVSTGLRLSYDDDEHNS 115

Query: 61  SVTSASGSMTAAPPIILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASF 120
           S+TSASGSM+AAP IILSL DN+RTELDRQ +EFDQYIK+QEE+LAKGV+D+KQRH +S 
Sbjct: 116 SITSASGSMSAAPSIILSLGDNIRTELDRQNDEFDQYIKIQEEHLAKGVRDLKQRHFSSL 175

Query: 121 LSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVNLLKSN 180
           L+A+EKG++KKLQEKD EIEN+NRKN+ELIERI+Q+AAEAQNWHYRAKYNESVVN+LKSN
Sbjct: 176 LAAMEKGVSKKLQEKDREIENINRKNKELIERIRQVAAEAQNWHYRAKYNESVVNVLKSN 235

Query: 181 LQQAISQGADQGKEGFGDSEVDDAASYINTNNYLTVPSGPGKSISRNHQ-----MICRAC 235
           LQQAISQGADQGKEGFGD+E+DDAASYI  NNYL     P K +  N+Q     + CRAC
Sbjct: 236 LQQAISQGADQGKEGFGDNEIDDAASYIEPNNYLNFSGDPAKPLPWNYQGLKEHVTCRAC 295

Query: 236 KAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS 279
           K +E S+LLMPCRHLCLCK+CD L+ VCPVC+ +K  S  V LS
Sbjct: 296 KTREVSMLLMPCRHLCLCKECDALINVCPVCRLIKTNSFQVFLS 339




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147822224|emb|CAN63942.1| hypothetical protein VITISV_032504 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356502299|ref|XP_003519957.1| PREDICTED: uncharacterized protein LOC100790534 [Glycine max] Back     alignment and taxonomy information
>gi|356497708|ref|XP_003517701.1| PREDICTED: uncharacterized protein LOC100791550 isoform 1 [Glycine max] gi|356497710|ref|XP_003517702.1| PREDICTED: uncharacterized protein LOC100791550 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|297739068|emb|CBI28557.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568840|ref|XP_002525391.1| ATP binding protein, putative [Ricinus communis] gi|223535354|gb|EEF37029.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449450452|ref|XP_004142976.1| PREDICTED: uncharacterized protein LOC101209865 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449500320|ref|XP_004161065.1| PREDICTED: uncharacterized LOC101209865 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225457007|ref|XP_002282390.1| PREDICTED: uncharacterized protein LOC100262147 [Vitis vinifera] gi|297733767|emb|CBI15014.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147841524|emb|CAN75320.1| hypothetical protein VITISV_003762 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
TAIR|locus:2019983339 AT1G10650 [Arabidopsis thalian 0.971 0.799 0.597 8e-85
TAIR|locus:2036596340 AT1G60610 [Arabidopsis thalian 0.946 0.776 0.576 1.4e-78
TAIR|locus:2825812325 SBP1 "S-ribonuclease binding p 0.792 0.68 0.388 7e-38
TAIR|locus:2129336314 AT4G17680 [Arabidopsis thalian 0.749 0.665 0.351 1e-29
TAIR|locus:2035564312 AT1G32740 "AT1G32740" [Arabido 0.777 0.695 0.327 1.3e-29
TAIR|locus:2133990304 RING [Arabidopsis thaliana (ta 0.892 0.819 0.315 3.5e-27
TAIR|locus:2207385358 BRG2 "BOI-related gene 2" [Ara 0.788 0.614 0.319 1.5e-26
TAIR|locus:2171042300 AT5G47050 [Arabidopsis thalian 0.774 0.72 0.321 3.2e-26
TAIR|locus:2089225335 BRG3 "BOI-related gene 3" [Ara 0.899 0.749 0.289 5.9e-25
TAIR|locus:2153227294 BRG1 "BOI-related gene 1" [Ara 0.767 0.727 0.330 8.7e-24
TAIR|locus:2019983 AT1G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 849 (303.9 bits), Expect = 8.0e-85, P = 8.0e-85
 Identities = 174/291 (59%), Positives = 216/291 (74%)

Query:     1 MLRPNKRGRETEDFS-----RQQKLQISLNSNICQDEADRSASILNPNPVSTGLRLSYDD 55
             M+RPNKRGRE E  S     +QQKLQ+SLN N   +       +   N VSTGLRLSYDD
Sbjct:    57 MIRPNKRGREAESISNNIQRQQQKLQMSLNYNY--NNTSVREEVPKENLVSTGLRLSYDD 114

Query:    56 DERNSSVTSASGSMTAAPPIILSLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQR 115
             DE NSSVTSASGS+ AA PI  SL D++R +L RQK+EFDQ+IK+Q   +AKGV+DMKQR
Sbjct:   115 DEHNSSVTSASGSILAASPIFQSLDDSLRIDLHRQKDEFDQFIKIQAAQMAKGVRDMKQR 174

Query:   116 HMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQNWHYRAKYNESVVN 175
             H+ASFL+ +EKG++KKLQEKD EI +MN+KN+EL+ERIKQ+A EAQNWHYRAKYNESVVN
Sbjct:   175 HIASFLTTLEKGVSKKLQEKDHEINDMNKKNKELVERIKQVAMEAQNWHYRAKYNESVVN 234

Query:   176 LLKSNLQQAISQG------ADQGKEGFGDSEVDDAAS-YINTNNYLTVPSGPGKSISRNH 228
             +LK+NLQQA+S        ADQGKEGFGDSE+DDAAS YI+ NN          ++  + 
Sbjct:   235 VLKANLQQAMSHNNSVIAAADQGKEGFGDSEIDDAASSYIDPNN------NNNNNMGIHQ 288

Query:   229 QMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS 279
             +M C+ C  KE SVL++PCRHL LCK+CDV   +CPVC+ +K++ V V  S
Sbjct:   289 RMRCKMCNVKEVSVLIVPCRHLSLCKECDVFTKICPVCKSLKSSCVQVFFS 339




GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2036596 AT1G60610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825812 SBP1 "S-ribonuclease binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129336 AT4G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035564 AT1G32740 "AT1G32740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133990 RING [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207385 BRG2 "BOI-related gene 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171042 AT5G47050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089225 BRG3 "BOI-related gene 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153227 BRG1 "BOI-related gene 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_X5306
hypothetical protein (339 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 4e-09
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
 Score = 51.2 bits (123), Expect = 4e-09
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 229 QMICRACKAKEASVLLMPCRHLCLCKDCD---VLVAVCPVCQ 267
             +C  C  +  +V+ +PC HLCLC++C         CP+C+
Sbjct: 2   DDLCVICLERPRNVVFLPCGHLCLCEECAKRLRSKKKCPICR 43


Length = 49

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.3
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.1
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.03
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.92
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.84
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.26
PF1463444 zf-RING_5: zinc-RING finger domain 97.79
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 97.74
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.71
PHA02929238 N1R/p28-like protein; Provisional 97.68
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.63
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 97.51
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.44
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.44
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.39
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.33
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.25
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.19
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.13
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.12
PHA02926242 zinc finger-like protein; Provisional 96.75
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 96.68
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 96.58
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 96.58
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.34
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.32
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.13
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.09
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.99
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.8
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 95.64
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.44
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 94.41
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 94.23
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 93.73
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 93.54
KOG2113394 consensus Predicted RNA binding protein, contains 93.1
PF04641260 Rtf2: Rtf2 RING-finger 93.03
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 92.83
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 92.6
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 91.2
KOG3039303 consensus Uncharacterized conserved protein [Funct 91.17
COG5152259 Uncharacterized conserved protein, contains RING a 91.12
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 90.41
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.91
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 89.25
KOG0825 1134 consensus PHD Zn-finger protein [General function 89.13
KOG3002 299 consensus Zn finger protein [General function pred 88.54
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 88.15
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 87.65
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 86.16
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 85.75
KOG1103 561 consensus Predicted coiled-coil protein [Function 84.87
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 84.55
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 84.55
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 84.46
PF00038312 Filament: Intermediate filament protein; InterPro: 83.66
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 82.83
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 82.76
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 82.69
KOG0288 459 consensus WD40 repeat protein TipD [General functi 82.66
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 82.5
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 82.28
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 81.44
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 80.56
PF13935139 Ead_Ea22: Ead/Ea22-like protein 80.54
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=3e-37  Score=275.11  Aligned_cols=186  Identities=41%  Similarity=0.759  Sum_probs=162.4

Q ss_pred             HHHHHHhhHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 023682           82 NVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDMEIENMNRKNRELIERIKQMAAEAQ  161 (279)
Q Consensus        82 ~l~~~l~~q~~EiD~~i~~q~e~lr~~l~e~r~rh~~~ll~ave~~~~~rLreKe~Eie~~~kk~~eLeErl~ql~~E~q  161 (279)
                      ++++++++|..|||+|+..|+++|++.+.+.+++|++.++.++|..+.++||+|++||++++++|++|+++++++.+|++
T Consensus        15 ~~~~~~~~q~~~id~f~~~~~~~l~~~~~~~~~~~~~~~l~~~e~~~~~~l~~k~~ei~~~~~~~~~l~~~~~~~~~e~~   94 (207)
T KOG1100|consen   15 DLASDIQRQSDEIDRFLKIQGEQLRRELEENRQRELRNLLKAVEEALVKKLREKDEEIERIGNLNWELEERVKSLYVEAQ   94 (207)
T ss_pred             cceeecccccchhhHHHHhhHHHHHHHHHHhChHHHHHHHHHHHHHHHHHhhcchhHHHhcccccceehhhhhhhhhhHH
Confidence            68888999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhHHHHHHHHHHHHHHHhcC----c--ccccCCCCCCCccchhh-hhccccCCCCCCCCCccccccccccccc
Q 023682          162 NWHYRAKYNESVVNLLKSNLQQAISQG----A--DQGKEGFGDSEVDDAAS-YINTNNYLTVPSGPGKSISRNHQMICRA  234 (279)
Q Consensus       162 aWq~~A~~nea~a~~Lr~~Lqq~~~~~----~--~~~~eg~g~se~dDa~s-~c~~~~~~~l~~~~~~~~~~~~~~~C~i  234 (279)
                      .|+.+|++|++++++|+.+|+|++.+.    .  ..+..+.|+.+++|+.| +.++..           ..+.....|+.
T Consensus        95 ~w~~~a~~ne~~~~~l~~nl~q~~~~~~~~~~~~~~~~~~~g~~~~~~~~s~~~~~~~-----------~~~~~~~~Cr~  163 (207)
T KOG1100|consen   95 IWRDRAQTNEATVNSLRTNLDQVLAQCPASAPAEERGQKSCGDREADDGKSSYVDPSV-----------DNFKRMRSCRK  163 (207)
T ss_pred             HHHHHHHhChHHHHHHHHHHHHHHHhcccccCchhhhccccCccccccccccccchhh-----------hhhhcccccee
Confidence            999999999999999999999999884    1  11223355556666665 322221           11222233999


Q ss_pred             ccccccceEEecCCCcccchhhHhcCCCCCCCcccccceEEEee
Q 023682          235 CKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHL  278 (279)
Q Consensus       235 C~~~~~~v~llPC~HlclC~~C~~~l~~CPvCr~~i~~~v~v~~  278 (279)
                      |++++++|+|+||+|+|+|..|...+..||+|+.+++.+++||+
T Consensus       164 C~~~~~~VlllPCrHl~lC~~C~~~~~~CPiC~~~~~s~~~v~~  207 (207)
T KOG1100|consen  164 CGEREATVLLLPCRHLCLCGICDESLRICPICRSPKTSSVEVNF  207 (207)
T ss_pred             cCcCCceEEeecccceEecccccccCccCCCCcChhhceeeccC
Confidence            99999999999999999999999889999999999999999986



>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13935 Ead_Ea22: Ead/Ea22-like protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 5e-06
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 9e-06
2ea5_A68 Solution Structure Of The Ring Domain Of The Human 5e-04
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 5e-06, Method: Composition-based stats. Identities = 19/48 (39%), Positives = 28/48 (58%) Query: 232 CRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS 279 C+ C KE S++ +PC HL +CKDC + CP+C+ +V LS Sbjct: 27 CKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS 74
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|2EA5|A Chain A, Solution Structure Of The Ring Domain Of The Human Cell Growth Regulator With Ring Finger Domain 1 Protein Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 4e-15
2ea5_A68 Cell growth regulator with ring finger domain prot 2e-10
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 7e-10
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 4e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 7e-05
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
 Score = 73.5 bits (178), Expect = 4e-15
 Identities = 36/203 (17%), Positives = 86/203 (42%), Gaps = 11/203 (5%)

Query: 78  SLADNVRTELDRQKEEFDQYIKVQEEYLAKGVQDMKQRHMASFLSAIEKGLAKKLQEKDM 137
           ++ D V   L+ + E+ ++  + Q E +A     + +++  +    +   L   + +  +
Sbjct: 153 TVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVL--PILDNLL 210

Query: 138 EIENMNRKNRELIERIKQMAAEAQNWHYRAKYN-ESVVNLLKSNLQQAISQGADQGKEGF 196
           +   +N++  ++I++  Q+  +A+           +  N+ K++L++  S          
Sbjct: 211 KANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNSLKEIDSTLYKN----- 265

Query: 197 GDSEVDDAASYINTNNYLTVPSGPGKSISRNHQMICRACKAKEASVLLMPCRHLCLCKDC 256
                 D          ++  S   +      +  C+ C  KE SV+ +PC HL +C++C
Sbjct: 266 ---LFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQEC 322

Query: 257 DVLVAVCPVCQFVKNASVLVHLS 279
              +  CP+C+ +   +V   LS
Sbjct: 323 APSLRKCPICRGIIKGTVRTFLS 345


>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
2ea5_A68 Cell growth regulator with ring finger domain prot 99.46
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.4
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.38
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.36
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.35
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.32
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.06
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.5
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.45
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.43
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.4
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.39
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.38
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.36
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.28
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.27
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 98.26
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.24
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.23
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.22
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.22
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.22
2ect_A78 Ring finger protein 126; metal binding protein, st 98.21
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.2
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.18
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.17
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.14
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.14
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.11
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.11
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.02
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.01
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.99
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.96
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.94
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.87
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.87
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.86
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.86
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.84
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.82
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.81
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.8
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.75
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.73
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.62
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.59
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.52
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.47
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.47
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.47
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.26
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.21
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.01
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.99
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.96
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.95
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.9
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.43
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.28
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.02
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 95.81
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.45
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.99
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 93.92
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 93.33
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.64
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 91.28
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 88.75
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 86.3
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 86.2
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 85.88
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 84.63
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 83.69
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 82.52
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 81.23
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 81.13
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 81.01
1dip_A78 Delta-sleep-inducing peptide immunoreactive peptid 80.18
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.46  E-value=3.5e-14  Score=104.39  Aligned_cols=52  Identities=29%  Similarity=0.735  Sum_probs=48.9

Q ss_pred             cccccccccccccceEEecCCCcccchhhHhcCCCCCCCcccccceEEEeeC
Q 023682          228 HQMICRACKAKEASVLLMPCRHLCLCKDCDVLVAVCPVCQFVKNASVLVHLS  279 (279)
Q Consensus       228 ~~~~C~iC~~~~~~v~llPC~HlclC~~C~~~l~~CPvCr~~i~~~v~v~~S  279 (279)
                      +...|+||++++++++|+||||+++|..|...+..||+||.+|...++||.+
T Consensus        14 ~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~~   65 (68)
T 2ea5_A           14 NSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSGP   65 (68)
T ss_dssp             CSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCSS
T ss_pred             CCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeecC
Confidence            4568999999999999999999999999999999999999999999999863



>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.49
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.32
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.21
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.12
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.1
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.0
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.93
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.84
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.66
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.53
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.32
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.2
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.18
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.13
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.93
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.33
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.68
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.49  E-value=2e-08  Score=73.87  Aligned_cols=46  Identities=26%  Similarity=0.744  Sum_probs=39.4

Q ss_pred             cccccccccccceEEecCCCcccchhhHhc-----CCCCCCCcccccceEEE
Q 023682          230 MICRACKAKEASVLLMPCRHLCLCKDCDVL-----VAVCPVCQFVKNASVLV  276 (279)
Q Consensus       230 ~~C~iC~~~~~~v~llPC~HlclC~~C~~~-----l~~CPvCr~~i~~~v~v  276 (279)
                      ..|.||++...+.+++||||. +|..|...     ...||+||..+...-.|
T Consensus        24 ~~C~IC~~~~~~~~~~~CgH~-fC~~Ci~~wl~~~~~~CP~Cr~~i~~~~~i   74 (79)
T d1fbva4          24 QLCKICAENDKDVKIEPCGHL-MCTSCLTSWQESEGQGCPFCRCEIKGTEPI   74 (79)
T ss_dssp             TBCTTTSSSBCCEECSSSCCE-ECHHHHHHHHHTTCCSCTTTCCCCCCCCCS
T ss_pred             CCCccCCCcCCCeEEeCCCCe-eeHHHHHHHHHHCcCcCCCCCcCccCCcee
Confidence            469999999999999999998 89999743     36799999999876544



>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure