Citrus Sinensis ID: 023740

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLLA
cccccccccHHHHHHHHHHHHHHccccHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcc
cccccccccHHHHHHHHHHHHccccccHHHHHccccHHHHHHccccccHHHHHHccEEcccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEcccEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEc
mgnqkqkwTAEEEEALLAGVAkhgpgkwknilrdpqfapsltqrsnidlkdkwrnlsvsnaqqgskdkirgpklkttvvaplsntpnsapaasltrnvssgavmndtstsaldgkngpkyNAMIFEAISTlkdangsdiSAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKirketsigvktptpkqkdarlrpprnsalmTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSrgeivlla
mgnqkqkwTAEEEEALLAGVAKHGPGKWKNILrdpqfapsltqrsnidlkdkwrnLSVSnaqqgskdkirgpkLKTTVVAplsntpnsapaasltrnvssgavMNDTstsaldgkngpKYNAMIFEAISTLKDANGSDISAIANFIeerqeappnFRRLLSSRLRrlvsqgklekvrncykirketsigvktptpkqkdarlrpprnsalmtsrEIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYErcsrgeivlla
MGNQKQKWTaeeeeallaGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFrrllssrlrrlVSQGKLEKVRNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLLA
*******************V*****GKWKNIL***************************************************************************************YNAMIFEAISTLKDANGSDISAIANFI*****************LRRLVSQGKLEKVRNCYKIR************************************ASITAAYRIAEAENKSFLAAE***************DAMLQLVKEIYERCSRGEIVL**
***QKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQGS**********************************************LDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKV*************************************************************************KMAEDTDAMLQLVKEIYERCSRGEIVLLA
**********EEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSV*********KIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIRKETSIGVK**************RNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLLA
*******WTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNA******************************************************NGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIR*******************************EIVEE******YRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLLA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSNAQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTSTSALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query278 2.2.26 [Sep-21-2011]
F4I7L1296 Telomere repeat-binding f yes no 0.989 0.929 0.538 1e-73
F4IEY4287 Telomere repeat-binding f no no 0.996 0.965 0.493 1e-69
Q8VWK4300 Telomere repeat-binding f no no 0.654 0.606 0.435 8e-35
Q9FJW5299 Telomere repeat-binding f no no 0.618 0.575 0.401 4e-27
Q9M2X3295 Telomere repeat-binding f no no 0.636 0.6 0.410 5e-26
P23444246 Histone H1 OS=Zea mays PE N/A no 0.241 0.272 0.492 2e-12
P27806238 Histone H1 OS=Triticum ae N/A no 0.241 0.281 0.449 9e-11
P26569273 Histone H1.2 OS=Arabidops no no 0.241 0.245 0.485 6e-10
P08283265 Histone H1 OS=Pisum sativ N/A no 0.233 0.245 0.484 9e-07
P26568274 Histone H1.1 OS=Arabidops no no 0.241 0.244 0.514 2e-06
>sp|F4I7L1|TRB4_ARATH Telomere repeat-binding factor 4 OS=Arabidopsis thaliana GN=At1g17520 PE=2 SV=2 Back     alignment and function desciption
 Score =  276 bits (706), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/297 (53%), Positives = 208/297 (70%), Gaps = 22/297 (7%)

Query: 1   MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSN 60
           MGNQK KWTAEEEEALLAGV KHGPGKWKNILRDP+ A  L+ RSNIDLKDKWRNLSV+ 
Sbjct: 1   MGNQKLKWTAEEEEALLAGVRKHGPGKWKNILRDPELAEQLSSRSNIDLKDKWRNLSVAP 60

Query: 61  AQQGSKDKIRGPKLK-----------TTVVAPLSNTPNSAPAASLTRNVSSGAVMNDTST 109
             QGSKDKIR PK+K             +V P +++ +S+P A+L R+ SS   ++D+  
Sbjct: 61  GIQGSKDKIRTPKIKAAAFHLAAAAAAAIVTP-THSGHSSPVATLPRSGSSDLSIDDSFN 119

Query: 110 SALDGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVS 169
              D KN P+Y+ MIFEA+S L DANGSD+SAI NFIE+RQE PPNFRR+LSSRLRRL +
Sbjct: 120 IVADPKNAPRYDGMIFEALSNLTDANGSDVSAIFNFIEQRQEVPPNFRRMLSSRLRRLAA 179

Query: 170 QGKLEKV------RNCYKIRKETSIGVKTPT---PKQKDARLRPPRNSALMTSREIVEEA 220
           QGKLEKV      +N YK+  + S+  +TP    PK+ + + R   NS   +  + + EA
Sbjct: 180 QGKLEKVSHLKSTQNFYKMN-DNSLVQRTPHVARPKESNTKSRQQTNSQGPSISQQIVEA 238

Query: 221 SITAAYRIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLL 277
           SITAAY++ E ENK  ++  A +E ER+ K+AE+ D ML + +E++E CS+G+I+ L
Sbjct: 239 SITAAYKLVEVENKLDVSKGAAEEIERLMKLAEEADEMLVIAREMHEECSQGKIMYL 295
Binds preferentially double-stranded telomeric repeats.
Arabidopsis thaliana (taxid: 3702)
>sp|F4IEY4|TRB5_ARATH Telomere repeat-binding factor 5 OS=Arabidopsis thaliana GN=At1g72740 PE=2 SV=1 Back     alignment and function description
>sp|Q8VWK4|TRB1_ARATH Telomere repeat-binding factor 1 OS=Arabidopsis thaliana GN=TRB1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJW5|TRB2_ARATH Telomere repeat-binding factor 2 OS=Arabidopsis thaliana GN=TRB2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2X3|TRB3_ARATH Telomere repeat-binding factor 3 OS=Arabidopsis thaliana GN=TRB3 PE=1 SV=1 Back     alignment and function description
>sp|P23444|H1_MAIZE Histone H1 OS=Zea mays PE=2 SV=2 Back     alignment and function description
>sp|P27806|H1_WHEAT Histone H1 OS=Triticum aestivum PE=2 SV=2 Back     alignment and function description
>sp|P26569|H12_ARATH Histone H1.2 OS=Arabidopsis thaliana GN=At2g30620 PE=1 SV=1 Back     alignment and function description
>sp|P08283|H1_PEA Histone H1 OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P26568|H11_ARATH Histone H1.1 OS=Arabidopsis thaliana GN=At1g06760 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
449458153279 PREDICTED: telomere repeat-binding facto 0.989 0.985 0.663 4e-98
307135862279 MYB transcription factor [Cucumis melo s 0.989 0.985 0.663 5e-98
255560719349 transcription factor, putative [Ricinus 0.974 0.776 0.708 2e-96
356522138285 PREDICTED: uncharacterized protein LOC78 0.992 0.968 0.595 2e-87
351722098281 MYB transcription factor MYB107 [Glycine 0.985 0.975 0.603 7e-87
255648160281 unknown [Glycine max] 0.985 0.975 0.603 7e-86
224122558279 single myb histone [Populus trichocarpa] 0.971 0.967 0.607 2e-81
110931744275 MYB transcription factor MYB91 [Glycine 0.956 0.967 0.581 6e-81
255546151283 DNA binding protein, putative [Ricinus c 1.0 0.982 0.586 2e-79
224087971275 single myb histone [Populus trichocarpa] 0.978 0.989 0.587 3e-76
>gi|449458153|ref|XP_004146812.1| PREDICTED: telomere repeat-binding factor 5-like [Cucumis sativus] gi|449476637|ref|XP_004154792.1| PREDICTED: telomere repeat-binding factor 5-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  363 bits (932), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 224/282 (79%), Gaps = 7/282 (2%)

Query: 1   MGNQKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSN 60
           MGNQKQKWT+EEE+ALLAGV KHGPGKWKNIL+DP FAPSLT RSNIDLKDKWRNLSVS 
Sbjct: 1   MGNQKQKWTSEEEDALLAGVNKHGPGKWKNILKDPDFAPSLTHRSNIDLKDKWRNLSVST 60

Query: 61  AQQGSKDKIRGPKLKTTVVAPLSNTPNSAPAASLTRNVSSGAVMNDT-STSALDGKNGPK 119
           A QGSK+K R       +VA +SN   SAPA     N S+ A  +DT + S  DGKN P+
Sbjct: 61  ASQGSKEKSRAAPKAKAIVAAISNNQTSAPAKP---NASADAAGDDTPNNSTQDGKNVPR 117

Query: 120 YNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRNC 179
           Y +MIFEA+ST+KD+NG DI  I NFIE+R E P NFRR LSS+LRRLVSQGKLEKV+NC
Sbjct: 118 YYSMIFEALSTIKDSNGCDIGTIVNFIEQRHEVPQNFRRQLSSKLRRLVSQGKLEKVQNC 177

Query: 180 YKIRKETSIGVKTPTPKQKDARLRPPR---NSALMTSREIVEEASITAAYRIAEAENKSF 236
           Y+++K+ S+ VKTPTPKQKD R R  +      +M S E VE+A+  AAY++A+AENKSF
Sbjct: 178 YRVKKDNSLAVKTPTPKQKDVRQRISQYNTTGGVMPSAETVEDAAKAAAYKVADAENKSF 237

Query: 237 LAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLLA 278
           LAAEA KEAER++KMAEDTD+MLQ++KE+YE+CSRGEI+LLA
Sbjct: 238 LAAEAVKEAERIAKMAEDTDSMLQIIKEMYEKCSRGEIILLA 279

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|307135862|gb|ADN33730.1| MYB transcription factor [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|255560719|ref|XP_002521373.1| transcription factor, putative [Ricinus communis] gi|223539451|gb|EEF41041.1| transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356522138|ref|XP_003529706.1| PREDICTED: uncharacterized protein LOC780537 [Glycine max] Back     alignment and taxonomy information
>gi|351722098|ref|NP_001237744.1| MYB transcription factor MYB107 [Glycine max] gi|110931702|gb|ABH02850.1| MYB transcription factor MYB107 [Glycine max] Back     alignment and taxonomy information
>gi|255648160|gb|ACU24534.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224122558|ref|XP_002330511.1| single myb histone [Populus trichocarpa] gi|222872445|gb|EEF09576.1| single myb histone [Populus trichocarpa] Back     alignment and taxonomy information
>gi|110931744|gb|ABH02871.1| MYB transcription factor MYB91 [Glycine max] Back     alignment and taxonomy information
>gi|255546151|ref|XP_002514135.1| DNA binding protein, putative [Ricinus communis] gi|223546591|gb|EEF48089.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224087971|ref|XP_002308277.1| single myb histone [Populus trichocarpa] gi|222854253|gb|EEE91800.1| single myb histone [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query278
TAIR|locus:2030275287 AT1G72740 [Arabidopsis thalian 0.982 0.951 0.421 3e-53
TAIR|locus:2007878296 AT1G17520 [Arabidopsis thalian 0.913 0.858 0.440 1.4e-48
TAIR|locus:2031095300 TRB1 "telomere repeat binding 0.953 0.883 0.339 4.9e-30
TAIR|locus:2158611299 TRB2 "AT5G67580" [Arabidopsis 0.888 0.826 0.319 1.8e-23
TAIR|locus:2097325295 TRB3 "telomere repeat binding 0.906 0.854 0.305 3e-21
TAIR|locus:2020193197 AT1G54260 [Arabidopsis thalian 0.528 0.746 0.352 1.6e-13
TAIR|locus:2020183229 AT1G54240 [Arabidopsis thalian 0.676 0.820 0.298 9.1e-13
TAIR|locus:2033118274 AT1G06760 [Arabidopsis thalian 0.651 0.660 0.287 1.8e-07
TAIR|locus:2064332273 AT2G30620 [Arabidopsis thalian 0.485 0.494 0.296 7.3e-07
TAIR|locus:2020118232 AT1G54230 [Arabidopsis thalian 0.179 0.215 0.392 7.9e-07
TAIR|locus:2030275 AT1G72740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 551 (199.0 bits), Expect = 3.0e-53, P = 3.0e-53
 Identities = 123/292 (42%), Positives = 168/292 (57%)

Query:     1 MGNQKQKWTXXXXXXXXXGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNLSVSN 60
             MGNQK KWT         G+ KHGPGKWKNILRDP+FA  L  RSNIDLKDKWRNLSV  
Sbjct:     1 MGNQKLKWTAEEEEALLAGIRKHGPGKWKNILRDPEFADQLIHRSNIDLKDKWRNLSVPP 60

Query:    61 AQQGSKDKIRGPKLKTTVVAPLSNTPNSA----PAASLT----RNVSSGAVMNDTSTSAL 112
               Q   +K R  K+K     P ++  ++     P  ++     R      ++ D +T   
Sbjct:    61 GTQSLTNKARPAKVKEEGDTPAADANDAVTIPRPIPTIPPPPGRRTLPSELIPDENT--- 117

Query:   113 DGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFXXXXXXXXXXXVSQGK 172
               KN P+Y+ +IFEA+S L D NGSD+S+I +FIE R E PPNF            +Q K
Sbjct:   118 --KNAPRYDGVIFEALSALADGNGSDVSSIYHFIEPRHEVPPNFRRILSTRLRRLAAQSK 175

Query:   173 LEKV------RNCYKIRKETSIGVKTPTPKQKDARLRPPRNSALMTSREIVEEASITAAY 226
             LEKV      +N YKI   +   +  P PK+   +LR   N     S++++EEA+ITAA 
Sbjct:   176 LEKVSTFKSIQNFYKIPDPSGTKIGVPKPKETHTKLRQANNQTSADSQQMIEEAAITAAC 235

Query:   227 RIAEAENKSFLAAEAFKEAERVSKMAEDTDAMLQLVKEIYERCSRGEIVLLA 278
             ++ EAENK  +A  A +E E+++K+AE+   +L +  E++E CS GE +LLA
Sbjct:   236 KVVEAENKIDVAKLAAEEFEKMTKIAEENRKLLVIATEMHELCSCGETMLLA 287
GO:0000786 "nucleosome" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA;IDA
GO:0006334 "nucleosome assembly" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
TAIR|locus:2007878 AT1G17520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031095 TRB1 "telomere repeat binding factor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158611 TRB2 "AT5G67580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097325 TRB3 "telomere repeat binding factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020193 AT1G54260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020183 AT1G54240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033118 AT1G06760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064332 AT2G30620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020118 AT1G54230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
F4I7L1TRB4_ARATHNo assigned EC number0.53870.98920.9290yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
SMH903
single myb histone (279 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 1e-19
smart0052666 smart00526, H15, Domain in histone families 1 and 4e-18
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 4e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 4e-09
cd0007388 cd00073, H15, linker histone 1 and histone 5 domai 7e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-08
pfam0053877 pfam00538, Linker_histone, linker histone H1 and H 8e-07
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information 
 Score = 79.5 bits (197), Expect = 1e-19
 Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 3/51 (5%)

Query: 6  QKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNL 56
          +KWT EE+EAL+ GV K+G G W  IL+D  F   +  R+++DLKDKWRNL
Sbjct: 1  RKWTDEEDEALVEGVEKYGVGNWAKILKDYFF---VNNRTSVDLKDKWRNL 48

Human telomere repeat binding factors, TRF1 and TRF2, function as part of the 6 component shelterin complex. TRF2 binds DNA and recruits RAP1 (via binding to the RAP1 protein c-terminal (RCT)) and TIN2 in the protection of telomeres from DNA repair machinery. Metazoan shelterin consists of 3 DNA binding proteins (TRF2, TRF1, and POT1) and 3 recruited proteins that bind to one or more of these DNA-binding proteins (RAP1, TIN2, TPP1). Schizosaccharomyces pombe TAZ1 is an orthlog and binds RAP1. Human TRF1 and TRF2 bind double-stranded DNA. hTRF2 consists of a basic N-terminus, a TRF homology domain, the RAP1 binding motif (RBM), the TIN2 binding motif (TBM) and a myb-like DNA binding domain, SANT, named after 'SWI3, ADA2, N-CoR and TFIIIB', several factors that share this domain. Tandem copies of the domain bind telomeric DNA tandem repeats as part of the capping complex. The single myb-like domain of TRF-type proteins is similar to the tandem myb_like domains found in yeast RAP1. Length = 50
>gnl|CDD|197772 smart00526, H15, Domain in histone families 1 and 5 Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238028 cd00073, H15, linker histone 1 and histone 5 domains; the basic subunit of chromatin is the nucleosome, consisting of an octamer of core histones, two full turns of DNA, a linker histone (H1 or H5) and a variable length of linker DNA; H1/H5 are chromatin-associated proteins that bind to the exterior of nucleosomes and dramatically stabilize the highly condensed states of chromatin fibers; stabilization of higher order folding occurs through electrostatic neutralization of the linker DNA segments, through a highly positively charged carboxy- terminal domain known as the AKP helix (Ala, Lys, Pro); thought to be involved in specific protein-protein and protein-DNA interactions and play a role in suppressing core histone tail domain acetylation in the chromatin fiber Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215982 pfam00538, Linker_histone, linker histone H1 and H5 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 278
cd0007388 H15 linker histone 1 and histone 5 domains; the ba 99.84
PF0053877 Linker_histone: linker histone H1 and H5 family; I 99.84
smart0052666 H15 Domain in histone families 1 and 5. 99.84
KOG4012243 consensus Histone H1 [Chromatin structure and dyna 99.49
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.34
PLN03212249 Transcription repressor MYB5; Provisional 99.08
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.06
PLN03091 459 hypothetical protein; Provisional 98.99
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.96
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.93
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.9
PLN03212249 Transcription repressor MYB5; Provisional 98.61
PLN03091 459 hypothetical protein; Provisional 98.5
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.05
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.02
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.81
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.66
KOG0051607 consensus RNA polymerase I termination factor, Myb 97.62
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.27
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.14
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 96.53
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.3
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 95.9
KOG1279506 consensus Chromatin remodeling factor subunit and 95.88
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.56
COG5147512 REB1 Myb superfamily proteins, including transcrip 95.51
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.93
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 94.8
PF08074173 CHDCT2: CHDCT2 (NUC038) domain; InterPro: IPR01295 94.74
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 94.63
COG5147 512 REB1 Myb superfamily proteins, including transcrip 94.25
PF1026480 Stork_head: Winged helix Storkhead-box1 domain; In 93.29
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 93.08
PF0025096 Fork_head: Fork head domain; InterPro: IPR001766 T 92.91
PF1433892 Mrr_N: Mrr N-terminal domain 92.43
cd0005978 FH Forkhead (FH), also known as a "winged helix". 92.3
KOG2656445 consensus DNA methyltransferase 1-associated prote 90.91
KOG03841373 consensus Chromodomain-helicase DNA-binding protei 90.41
smart0033989 FH FORKHEAD. FORKHEAD, also known as a "winged hel 90.02
KOG0051607 consensus RNA polymerase I termination factor, Myb 89.68
KOG4282345 consensus Transcription factor GT-2 and related pr 89.58
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 86.36
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 82.82
>cd00073 H15 linker histone 1 and histone 5 domains; the basic subunit of chromatin is the nucleosome, consisting of an octamer of core histones, two full turns of DNA, a linker histone (H1 or H5) and a variable length of linker DNA; H1/H5 are chromatin-associated proteins that bind to the exterior of nucleosomes and dramatically stabilize the highly condensed states of chromatin fibers; stabilization of higher order folding occurs through electrostatic neutralization of the linker DNA segments, through a highly positively charged carboxy- terminal domain known as the AKP helix (Ala, Lys, Pro); thought to be involved in specific protein-protein and protein-DNA interactions and play a role in suppressing core histone tail domain acetylation in the chromatin fiber Back     alignment and domain information 
Probab=99.84  E-value=8.4e-21  Score=148.74  Aligned_cols=71  Identities=37%  Similarity=0.653  Sum_probs=67.1

Q ss_pred             CCCCCHHHHHHHHHHhcCcCCCCCHHHHHHHHHHhcCCC-cchHHHHHHHHHhhhhcCceeeec-----cccccCCC
Q 023740          115 KNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAP-PNFRRLLSSRLRRLVSQGKLEKVR-----NCYKIRKE  185 (278)
Q Consensus       115 ~~hp~y~~MI~EAI~~Lker~GSS~~AI~kyIe~~y~v~-~n~~~~L~~~LKrlV~sGkLvkvK-----~sykl~~~  185 (278)
                      .+||+|.+||+|||.+|+|++|||+++|++||+++|.+. ++|+.+|+.+|+++|++|.|++++     |+|+|++.
T Consensus         2 ~~hP~y~~MI~eAI~~l~er~GsS~~aI~kyI~~~y~~~~~~~~~~l~~aLkk~v~~G~l~~~kG~g~~gsfkl~~~   78 (88)
T cd00073           2 PSHPPYSEMVTEAIKALKERKGSSLQAIKKYIEAKYKVDDENFNKLLKLALKKGVAKGKLVQVKGTGASGSFKLSKK   78 (88)
T ss_pred             CCCCCHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHCCcchHHHHHHHHHHHHHHHHCCCeEeecCCCCccceEeCCC
Confidence            579999999999999999999999999999999999765 899999999999999999999999     89999743

>PF00538 Linker_histone: linker histone H1 and H5 family; InterPro: IPR005818 Histone proteins have central roles in both chromatin organisation (as structural units of the nucleosome) and gene regulation (as dynamic components that have a direct impact on DNA transcription and replication) Back     alignment and domain information
>smart00526 H15 Domain in histone families 1 and 5 Back     alignment and domain information
>KOG4012 consensus Histone H1 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF08074 CHDCT2: CHDCT2 (NUC038) domain; InterPro: IPR012957 The CHDCT2 C-terminal domain is found in PHD/RING fingers and chromo domain-associated CHD-like helicases [] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF10264 Stork_head: Winged helix Storkhead-box1 domain; InterPro: IPR019391 In humans the Storkhead-box protein controls polyploidization of extravillus trophoblast and is implicated in pre-eclampsia [] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF00250 Fork_head: Fork head domain; InterPro: IPR001766 The fork head protein of Drosophila melanogaster, a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [] Back     alignment and domain information
>PF14338 Mrr_N: Mrr N-terminal domain Back     alignment and domain information
>cd00059 FH Forkhead (FH), also known as a "winged helix" Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>smart00339 FH FORKHEAD Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query278
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-20
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 3e-20
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-19
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-18
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 5e-18
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-16
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 7e-16
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 1e-14
1hst_A90 Histone H5; chromosomal protein; 2.60A {Gallus gal 3e-12
1uhm_A78 Histone H1, histone HHO1P; winged helix-turn-helix 2e-10
1ghc_A75 GH1; chromosomal protein; NMR {Gallus gallus} SCOP 1e-09
1uss_A88 Histone H1; DNA binding protein, linker histone, D 1e-09
1ust_A93 Histone H1; DNA binding protein, linker histone, D 4e-09
2rqp_A88 Heterochromatin protein 1-binding protein 3; histo 5e-09
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-07
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-06
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-06
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-05
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 3e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 3e-06
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 6e-06
2lso_A83 Histone H1X; structural genomics, northeast struct 7e-06
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-05
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-05
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 2e-05
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 7e-05
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-04
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 3e-04
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 8e-04
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
 Score = 82.0 bits (203), Expect = 1e-20
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 4  QKQKWTAEEEEALLAGVAKHGPGKWKNILRDPQFAPSLTQRSNIDLKDKWRNL 56
          +KQKWT EE E + AGV K+G G W  I ++  F      R+ + +KD+WR +
Sbjct: 1  KKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPF----VNRTAVMIKDRWRTM 49
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1hst_A Histone H5; chromosomal protein; 2.60A {Gallus gallus} SCOP: a.4.5.13 Length = 90 Back     alignment and structure
>1uhm_A Histone H1, histone HHO1P; winged helix-turn-helix, linker histone, riken structural genomics/proteomics initiative, RSGI; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 Length = 78 Back     alignment and structure
>1ghc_A GH1; chromosomal protein; NMR {Gallus gallus} SCOP: a.4.5.13 Length = 75 Back     alignment and structure
>1uss_A Histone H1; DNA binding protein, linker histone, DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 PDB: 1yqa_A Length = 88 Back     alignment and structure
>2rqp_A Heterochromatin protein 1-binding protein 3; histone H1, alternative splicing, chromosomal protein, DNA-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 62 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2lso_A Histone H1X; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, nuclear protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Length = 211 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
1hst_A90 Histone H5; chromosomal protein; 2.60A {Gallus gal 99.88
1uss_A88 Histone H1; DNA binding protein, linker histone, D 99.88
1uhm_A78 Histone H1, histone HHO1P; winged helix-turn-helix 99.87
1ust_A93 Histone H1; DNA binding protein, linker histone, D 99.85
2rqp_A88 Heterochromatin protein 1-binding protein 3; histo 99.84
1ghc_A75 GH1; chromosomal protein; NMR {Gallus gallus} SCOP 99.79
2lso_A83 Histone H1X; structural genomics, northeast struct 99.61
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.75
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.74
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.71
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.7
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.7
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.69
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.63
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.59
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.52
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.5
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.48
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.44
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.4
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.37
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.27
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.26
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.25
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.25
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.24
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.22
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.21
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.21
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.18
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.13
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.12
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.09
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.07
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.05
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.02
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.02
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.01
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.99
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.53
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.77
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.7
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.43
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.35
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.08
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.96
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.89
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.89
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.77
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 97.4
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.28
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.26
2crg_A70 Metastasis associated protein MTA3; transcription 97.14
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.08
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 96.87
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.87
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 96.61
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.39
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.03
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 94.89
2c6y_A111 Forkhead box protein K2; transcription regulation, 94.74
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 94.42
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 93.14
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.83
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 93.49
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 93.41
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 93.32
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.27
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 92.9
2hdc_A97 Protein (transcription factor); structure, dyanami 92.78
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 91.8
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 91.66
3bpy_A85 FORK head domain, forkhead transcription factor FO 91.16
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 89.71
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 86.57
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 83.45
>1hst_A Histone H5; chromosomal protein; 2.60A {Gallus gallus} SCOP: a.4.5.13 Back     alignment and structure
Probab=99.88  E-value=6.8e-23  Score=160.87  Aligned_cols=74  Identities=24%  Similarity=0.429  Sum_probs=67.2

Q ss_pred             CCCCCCCHHHHHHHHHHhcCcCCCCCHHHHHHHHHHhcCCCcchHHHHHHHHHhhhhcCceeeecc-----ccccCCCC
Q 023740          113 DGKNGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVRN-----CYKIRKET  186 (278)
Q Consensus       113 ~~~~hp~y~~MI~EAI~~Lker~GSS~~AI~kyIe~~y~v~~n~~~~L~~~LKrlV~sGkLvkvK~-----sykl~~~~  186 (278)
                      .+.+||+|.+||+|||.+|+||+|||++||++||+++|+++++|+.+|+.+|++||++|.|+|++|     +|||++..
T Consensus         3 ~~~~hP~y~~MI~eAI~~lker~GsS~~AI~KyI~~~y~~~~~~~~~l~~aLk~~v~~G~l~q~Kg~GasGsfkl~~~~   81 (90)
T 1hst_A            3 RSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLAKSD   81 (90)
T ss_dssp             ---CCCCHHHHHHHHHHTCCCSSCEEHHHHHHHHHHHSCCCTTHHHHHHHHHHHHHHTTSEEEECCSSCCCEEEECC--
T ss_pred             CCCCCCCHHHHHHHHHHHhccCCCCCHHHHHHHHHHHccCchhHHHHHHHHHHHHHHcCCeeeecCCCccceeecCCCc
Confidence            356899999999999999999999999999999999999977899999999999999999999998     99998654
>1uss_A Histone H1; DNA binding protein, linker histone, DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 PDB: 1yqa_A Back     alignment and structure
>1uhm_A Histone H1, histone HHO1P; winged helix-turn-helix, linker histone, riken structural genomics/proteomics initiative, RSGI; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 Back     alignment and structure
>2rqp_A Heterochromatin protein 1-binding protein 3; histone H1, alternative splicing, chromosomal protein, DNA-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1ghc_A GH1; chromosomal protein; NMR {Gallus gallus} SCOP: a.4.5.13 Back     alignment and structure
>2lso_A Histone H1X; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, nuclear protein; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} SCOP: a.4.5.14 PDB: 3co6_C* Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} Back     alignment and structure
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 278
d1hsta_74 a.4.5.13 (A:) Histone H5, globular domain {Chicken 1e-15
d1ghca_75 a.4.5.13 (A:) Histone H1, globular domain {Chicken 8e-15
d1usta_92 a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's 2e-14
d1ussa_88 a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's 7e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-11
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 9e-10
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-09
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-09
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-06
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 5e-05
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-04
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-04
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 0.002
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 0.003
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 0.004
>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Linker histone H1/H5
domain: Histone H5, globular domain
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score = 67.8 bits (166), Expect = 1e-15
 Identities = 17/61 (27%), Positives = 29/61 (47%)

Query: 117 GPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKV 176
            P Y+ MI  AI   K   GS   +I  +I+   +   N    +   +RRL++ G L++ 
Sbjct: 2   HPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQT 61

Query: 177 R 177
           +
Sbjct: 62  K 62
>d1ghca_ a.4.5.13 (A:) Histone H1, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1usta_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 88 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query278
d1hsta_74 Histone H5, globular domain {Chicken (Gallus gallu 99.88
d1ussa_88 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 99.86
d1usta_92 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 99.85
d1ghca_75 Histone H1, globular domain {Chicken (Gallus gallu 99.82
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.72
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.71
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.66
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.42
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.28
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.19
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.19
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.09
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.08
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 99.0
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.82
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.73
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.44
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.78
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.17
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.05
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 96.87
d2fnaa173 Hypothetical protein SSO1545, C-terminal domain {S 95.93
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.17
d2a07f182 Forkhead box protein P2, FOXP2 {Human (Homo sapien 94.54
d2c6ya198 Interleukin enhancer binding factor {Human (Homo s 93.55
d1d5va_94 Adipocyte-transcription factor FREAC-11 (s12, fkh- 92.1
d2hdca_97 Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} 92.09
d3bpya185 Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} 91.98
d1kq8a_75 HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norv 91.17
>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Linker histone H1/H5
domain: Histone H5, globular domain
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.88  E-value=1.5e-23  Score=157.13  Aligned_cols=68  Identities=25%  Similarity=0.451  Sum_probs=65.9

Q ss_pred             CCCCHHHHHHHHHHhcCcCCCCCHHHHHHHHHHhcCCCcchHHHHHHHHHhhhhcCceeeec-----cccccC
Q 023740          116 NGPKYNAMIFEAISTLKDANGSDISAIANFIEERQEAPPNFRRLLSSRLRRLVSQGKLEKVR-----NCYKIR  183 (278)
Q Consensus       116 ~hp~y~~MI~EAI~~Lker~GSS~~AI~kyIe~~y~v~~n~~~~L~~~LKrlV~sGkLvkvK-----~sykl~  183 (278)
                      +||+|.+||+|||.+|+||+|||++||++||+++|.++.+|+.+|+.+|+++|++|.|+|+|     |+|||+
T Consensus         1 sHP~y~~MI~eAI~al~er~GsS~~AI~kyI~~~y~~~~~~~~~l~~aLk~~v~~G~l~q~kg~GasGsfkl~   73 (74)
T d1hsta_           1 SHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLKQTKGVGASGSFRLA   73 (74)
T ss_dssp             CCCCHHHHHHHHHHTCCCSSCEEHHHHHHHHHHHSCCCTTHHHHHHHHHHHHHHTTSEEEECCSSCCCEEEEC
T ss_pred             CCCCHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHCCCchhHHHHHHHHHHHHHHcCcEEeeccCCCcceeecC
Confidence            69999999999999999999999999999999999999999999999999999999999999     499996
>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1usta_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ghca_ a.4.5.13 (A:) Histone H1, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fnaa1 a.4.5.11 (A:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure