Citrus Sinensis ID: 023800


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDACGMPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLKV
cEEEEHHHHHHHcccEEEEEEEccccEEEEEcccEEEEccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHccccccEEcccEEcccccccHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEcccEEEccccHHHHccccccEEEEccccHHHHHHHcHHHHHHHHHHHHHccccEEEEEccHHHHHHHcccccc
ccEEEEHHHHHHcccEEEEEEEcccEEEEEcccEEEEcccHHHHHccccccccHHHHcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHcccccEEEEccEEEEccHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccHHHcccEEEEcccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccccccEEcccccEEcccEEHHHHHHccccEEEEccccccHHHHcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHcccccc
MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNcrdacgmpgatnlkeSEVLESIVKKQASDGRLYAAICVFLAVALGSwgllkglkdgkvvttrgpgtpMEFVVALVEQLYgkgkadevsgarvmranhgdeftiaefnpvqwtfdnspqilvpiangseeMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLivlpgglggaQAFAKSKKLVNMLKKqkesnrpygaicaspalvlephgllkv
meavitidvlrrsgadVVVASVEKqlrvdachGVKIVADALVSNCRDACGMPgatnlkeseVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGaicaspalvlephgllkv
MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDACGMPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLKV
***VITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDACGMPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVN***********YGAICASPALVL********
MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDACGMPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLKV
MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDACGMPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLKV
MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDACGMPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLKV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDACGMPGATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLKDGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query277 2.2.26 [Sep-21-2011]
Q9MAH3438 Protein DJ-1 homolog B OS yes no 0.996 0.630 0.629 1e-103
Q9FPF0392 Protein DJ-1 homolog A OS no no 0.996 0.704 0.556 2e-87
Q8VY09472 Protein DJ-1 homolog C OS no no 0.989 0.580 0.429 5e-64
Q46948196 Chaperone protein YajL OS N/A no 0.425 0.602 0.458 8e-18
P55880196 Chaperone protein YajL OS yes no 0.425 0.602 0.475 4e-14
Q7TQ35189 Protein DJ-1 OS=Mesocrice N/A no 0.498 0.730 0.337 3e-13
Q5XJ36189 Protein DJ-1 OS=Danio rer yes no 0.397 0.582 0.410 6e-13
O88767189 Protein DJ-1 OS=Rattus no yes no 0.397 0.582 0.414 2e-12
Q5E946189 Protein DJ-1 OS=Bos tauru yes no 0.397 0.582 0.405 2e-12
Q99LX0189 Protein DJ-1 OS=Mus muscu yes no 0.498 0.730 0.331 2e-12
>sp|Q9MAH3|DJ1B_ARATH Protein DJ-1 homolog B OS=Arabidopsis thaliana GN=DJ1B PE=2 SV=1 Back     alignment and function desciption
 Score =  373 bits (958), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/308 (62%), Positives = 228/308 (74%), Gaps = 32/308 (10%)

Query: 1   MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDAC--------GMP 52
            EAV+ IDVLRR GADV VASVE Q+ VDACHG+K+VAD L+S+  D+         G+P
Sbjct: 66  FEAVVMIDVLRRGGADVTVASVENQVGVDACHGIKMVADTLLSDITDSVFDLIMLPGGLP 125

Query: 53  GATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLK-------------- 98
           G   LK  + LE +VKKQ +DGRL AAIC   A+A G+WGLL+G K              
Sbjct: 126 GGETLKNCKPLEKMVKKQDTDGRLNAAICCAPALAFGTWGLLEGKKATCYPVFMEKLAAC 185

Query: 99  ----------DGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIA 148
                     DGK+VT+RGPGT MEF V LVEQL GK KA EVSG  VMR N GDE+TI 
Sbjct: 186 ATAVESRVEIDGKIVTSRGPGTTMEFSVTLVEQLLGKEKAVEVSGPLVMRPNPGDEYTIT 245

Query: 149 EFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVK 208
           E N V W+F+ +PQILVPIA+GSEEMEAV IID+L+RAKANVVVA++ + LE++AS +VK
Sbjct: 246 ELNQVSWSFEGTPQILVPIADGSEEMEAVAIIDVLKRAKANVVVAALGNSLEVVASRKVK 305

Query: 209 LVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALV 268
           LVAD+L+DEA K SYDLIVLPGGLGGA+AFA S+KLVNMLKKQ ESN+PYGAICASPALV
Sbjct: 306 LVADVLLDEAEKNSYDLIVLPGGLGGAEAFASSEKLVNMLKKQAESNKPYGAICASPALV 365

Query: 269 LEPHGLLK 276
            EPHGLLK
Sbjct: 366 FEPHGLLK 373




May be involved in oxidative stress response.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FPF0|DJ1A_ARATH Protein DJ-1 homolog A OS=Arabidopsis thaliana GN=DJ1A PE=1 SV=1 Back     alignment and function description
>sp|Q8VY09|DJ1C_ARATH Protein DJ-1 homolog C OS=Arabidopsis thaliana GN=DJ1C PE=2 SV=1 Back     alignment and function description
>sp|Q46948|YAJL_ECOLI Chaperone protein YajL OS=Escherichia coli (strain K12) GN=yajL PE=1 SV=2 Back     alignment and function description
>sp|P55880|YAJL_SALTY Chaperone protein YajL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yajL PE=3 SV=2 Back     alignment and function description
>sp|Q7TQ35|PARK7_MESAU Protein DJ-1 OS=Mesocricetus auratus GN=PARK7 PE=1 SV=1 Back     alignment and function description
>sp|Q5XJ36|PARK7_DANRE Protein DJ-1 OS=Danio rerio GN=park7 PE=2 SV=1 Back     alignment and function description
>sp|O88767|PARK7_RAT Protein DJ-1 OS=Rattus norvegicus GN=Park7 PE=1 SV=1 Back     alignment and function description
>sp|Q5E946|PARK7_BOVIN Protein DJ-1 OS=Bos taurus GN=PARK7 PE=2 SV=1 Back     alignment and function description
>sp|Q99LX0|PARK7_MOUSE Protein DJ-1 OS=Mus musculus GN=Park7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
224114830 442 predicted protein [Populus trichocarpa] 0.996 0.624 0.695 1e-117
449438931 434 PREDICTED: uncharacterized protein LOC10 0.996 0.635 0.685 1e-113
225461638 478 PREDICTED: uncharacterized protein LOC10 0.992 0.575 0.698 1e-112
302142910 393 unnamed protein product [Vitis vinifera] 0.992 0.699 0.698 1e-112
297853104 437 DJ-1 family protein [Arabidopsis lyrata 0.996 0.631 0.639 1e-102
18404397 438 4-methyl-5(b-hydroxyethyl)-thiazole mono 0.996 0.630 0.629 1e-101
312282985 391 unnamed protein product [Thellungiella h 0.996 0.705 0.616 1e-101
21536528 438 4-methyl-5(b-hydroxyethyl)-thiazole mono 0.996 0.630 0.626 1e-100
147775474 427 hypothetical protein VITISV_008479 [Viti 0.898 0.583 0.652 1e-98
356544078 435 PREDICTED: uncharacterized protein LOC10 0.996 0.634 0.647 2e-98
>gi|224114830|ref|XP_002316868.1| predicted protein [Populus trichocarpa] gi|222859933|gb|EEE97480.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 215/309 (69%), Positives = 244/309 (78%), Gaps = 33/309 (10%)

Query: 1   MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDAC--------GMP 52
           +EAVITIDVLRR GADV VAS+EKQ+RVDA + VK+VAD+L+S C DA         G+P
Sbjct: 66  IEAVITIDVLRRGGADVTVASIEKQIRVDATYDVKLVADSLLSECSDAVFDLITLPGGIP 125

Query: 53  GATNLKESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLK-------------- 98
           GATN K  ++LE +VKKQ  DG+LYAA+C   AVA GSWGLL GLK              
Sbjct: 126 GATNFKNCQLLEKLVKKQVEDGKLYAAVCASPAVAFGSWGLLNGLKATCHPFFMDELKSS 185

Query: 99  -----------DGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTI 147
                      +G VVT+RGPGT MEF VALVE+L+GK KADEVSG  VMR+NHGDE++I
Sbjct: 186 GAITVESRVHEEGNVVTSRGPGTTMEFAVALVEKLFGKEKADEVSGPLVMRSNHGDEYSI 245

Query: 148 AEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQV 207
            E NP+QWTFDN PQ+LVPIANG+EEMEA+IIIDILRRAK NVVVASV D LEILAS +V
Sbjct: 246 KELNPMQWTFDNVPQVLVPIANGTEEMEAIIIIDILRRAKVNVVVASVEDSLEILASRKV 305

Query: 208 KLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPAL 267
           KL ADML+DEAAKLSYDLIVLPGGLGGAQAFAKS+KLVNMLKKQ+ESNRPYGA+CASPAL
Sbjct: 306 KLEADMLLDEAAKLSYDLIVLPGGLGGAQAFAKSEKLVNMLKKQRESNRPYGAMCASPAL 365

Query: 268 VLEPHGLLK 276
           VLEPHGLLK
Sbjct: 366 VLEPHGLLK 374




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449438931|ref|XP_004137241.1| PREDICTED: uncharacterized protein LOC101212934 [Cucumis sativus] gi|449483151|ref|XP_004156507.1| PREDICTED: uncharacterized protein LOC101228984 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225461638|ref|XP_002283063.1| PREDICTED: uncharacterized protein LOC100253735 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142910|emb|CBI20205.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297853104|ref|XP_002894433.1| DJ-1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297340275|gb|EFH70692.1| DJ-1 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18404397|ref|NP_564626.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis [Arabidopsis thaliana] gi|7769869|gb|AAF69547.1|AC008007_22 F12M16.18 [Arabidopsis thaliana] gi|15810459|gb|AAL07117.1| unknown protein [Arabidopsis thaliana] gi|20259561|gb|AAM14123.1| unknown protein [Arabidopsis thaliana] gi|332194795|gb|AEE32916.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282985|dbj|BAJ34358.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|21536528|gb|AAM60860.1| 4-methyl-5(b-hydroxyethyl)-thiazole monophosphate biosynthesis protein, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147775474|emb|CAN62882.1| hypothetical protein VITISV_008479 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356544078|ref|XP_003540482.1| PREDICTED: uncharacterized protein LOC100803116 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
TAIR|locus:2009650438 DJ1B "AT1G53280" [Arabidopsis 0.642 0.406 0.752 5.4e-94
TAIR|locus:2086295392 DJ1A "AT3G14990" [Arabidopsis 0.642 0.454 0.623 6.4e-85
TAIR|locus:2124246472 DJ1C "DJ-1 homolog C" [Arabido 0.664 0.389 0.438 2.9e-60
UNIPROTKB|Q9KPQ8205 VC_2308 "4-methyl-5(B-hydroxye 0.393 0.531 0.467 1.7e-20
TIGR_CMR|VC_2308205 VC_2308 "4-methyl-5(B-hydroxye 0.393 0.531 0.467 1.7e-20
GENEDB_PFALCIPARUM|PFF1335c189 PFF1335c "4-methyl-5(B-hydroxy 0.404 0.592 0.383 2.5e-19
UNIPROTKB|Q46948196 yajL "chaperone, protecting pr 0.425 0.602 0.458 8.3e-19
ZFIN|ZDB-GENE-041010-5189 park7 "parkinson disease (auto 0.397 0.582 0.410 1.3e-15
FB|FBgn0039802205 dj-1beta "dj-1beta" [Drosophil 0.411 0.556 0.382 1.6e-15
UNIPROTKB|Q7TQ35189 PARK7 "Protein DJ-1" [Mesocric 0.397 0.582 0.414 2.6e-15
TAIR|locus:2009650 DJ1B "AT1G53280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 676 (243.0 bits), Expect = 5.4e-94, Sum P(2) = 5.4e-94
 Identities = 134/178 (75%), Positives = 154/178 (86%)

Query:    99 DGKVVTTRGPGTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFD 158
             DGK+VT+RGPGT MEF V LVEQL GK KA EVSG  VMR N GDE+TI E N V W+F+
Sbjct:   196 DGKIVTSRGPGTTMEFSVTLVEQLLGKEKAVEVSGPLVMRPNPGDEYTITELNQVSWSFE 255

Query:   159 NSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEA 218
              +PQILVPIA+GSEEMEAV IID+L+RAKANVVVA++ + LE++AS +VKLVAD+L+DEA
Sbjct:   256 GTPQILVPIADGSEEMEAVAIIDVLKRAKANVVVAALGNSLEVVASRKVKLVADVLLDEA 315

Query:   219 AKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLK 276
              K SYDLIVLPGGLGGA+AFA S+KLVNMLKKQ ESN+PYGAICASPALV EPHGLLK
Sbjct:   316 EKNSYDLIVLPGGLGGAEAFASSEKLVNMLKKQAESNKPYGAICASPALVFEPHGLLK 373


GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0046685 "response to arsenic-containing substance" evidence=RCA
TAIR|locus:2086295 DJ1A "AT3G14990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2124246 DJ1C "DJ-1 homolog C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPQ8 VC_2308 "4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2308 VC_2308 "4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFF1335c PFF1335c "4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q46948 yajL "chaperone, protecting proteins in response to oxidative stress" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-5 park7 "parkinson disease (autosomal recessive, early onset) 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0039802 dj-1beta "dj-1beta" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q7TQ35 PARK7 "Protein DJ-1" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MAH3DJ1B_ARATHNo assigned EC number0.62980.99630.6301yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
cd03135163 cd03135, GATase1_DJ-1, Type 1 glutamine amidotrans 3e-41
TIGR01383179 TIGR01383, not_thiJ, DJ-1 family protein 7e-41
TIGR01383179 TIGR01383, not_thiJ, DJ-1 family protein 1e-36
cd03135163 cd03135, GATase1_DJ-1, Type 1 glutamine amidotrans 1e-31
PRK11574196 PRK11574, PRK11574, oxidative-stress-resistance ch 6e-29
COG0693188 COG0693, ThiJ, Putative intracellular protease/ami 1e-16
PRK11574196 PRK11574, PRK11574, oxidative-stress-resistance ch 2e-14
pfam01965142 pfam01965, DJ-1_PfpI, DJ-1/PfpI family 8e-14
pfam01965142 pfam01965, DJ-1_PfpI, DJ-1/PfpI family 1e-11
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 4e-10
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 1e-09
COG0693188 COG0693, ThiJ, Putative intracellular protease/ami 6e-06
pfam13278164 pfam13278, DUF4066, Putative amidotransferase 4e-05
cd03134165 cd03134, GATase1_PfpI_like, A type 1 glutamine ami 1e-04
TIGR01382166 TIGR01382, PfpI, intracellular protease, PfpI fami 5e-04
cd03134165 cd03134, GATase1_PfpI_like, A type 1 glutamine ami 0.002
cd03140170 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotra 0.003
cd03139183 cd03139, GATase1_PfpI_2, Type 1 glutamine amidotra 0.004
>gnl|CDD|153229 cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
 Score =  139 bits (352), Expect = 3e-41
 Identities = 49/114 (42%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 163 ILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAAKLS 222
           +LV +A+G EE+EAV  +D+LRRA   V  AS+  KL + +S  +K+ AD  + +     
Sbjct: 1   VLVILADGFEEIEAVTPVDVLRRAGIEVTTASLEKKLAVGSSHGIKVKADKTLSDVNLDD 60

Query: 223 YDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLK 276
           YD IV+PGGL GAQ  A ++KL+ +LK+     +   AICA+PA++ +  GLLK
Sbjct: 61  YDAIVIPGGLPGAQNLADNEKLIKLLKEFNAKGKLIAAICAAPAVLAK-AGLLK 113


Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1. DJ-1 is involved in multiple physiological processes including cancer, Parkinson's disease and male fertility. It is unclear how DJ-1 functions in these. DJ-1 has been shown to possess chaperone activity. DJ-1 is preferentially expressed in the testis and moderately in other tissues; it is induced together with genes involved in oxidative stress response. The Drosophila homologue (DJ-1A) plays an essential role in oxidative stress response and neuronal maintenance. Inhibition of DJ-1A function through RNAi, results in the cellular accumulation of reactive oxygen species, organismal hypersensitivity to oxidative stress, and dysfunction and degeneration of dopaminergic and photoreceptor neurons. DJ-1 has lacks enzymatic activity and the catalytic triad of typical GATase1 domains, however it does contain the highly conserved cysteine located at the nucelophile elbow region typical of these domains. This cysteine been proposed to be a site of regulation of DJ-1 activity by oxidation. DJ-1 is a dimeric enzyme. Length = 163

>gnl|CDD|213612 TIGR01383, not_thiJ, DJ-1 family protein Back     alignment and domain information
>gnl|CDD|213612 TIGR01383, not_thiJ, DJ-1 family protein Back     alignment and domain information
>gnl|CDD|153229 cd03135, GATase1_DJ-1, Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>gnl|CDD|183210 PRK11574, PRK11574, oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>gnl|CDD|223765 COG0693, ThiJ, Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|183210 PRK11574, PRK11574, oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>gnl|CDD|216814 pfam01965, DJ-1_PfpI, DJ-1/PfpI family Back     alignment and domain information
>gnl|CDD|216814 pfam01965, DJ-1_PfpI, DJ-1/PfpI family Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|223765 COG0693, ThiJ, Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222020 pfam13278, DUF4066, Putative amidotransferase Back     alignment and domain information
>gnl|CDD|153228 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|233389 TIGR01382, PfpI, intracellular protease, PfpI family Back     alignment and domain information
>gnl|CDD|153228 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|153234 cd03140, GATase1_PfpI_3, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|153233 cd03139, GATase1_PfpI_2, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
KOG2764247 consensus Putative transcriptional regulator DJ-1 99.97
PRK11574196 oxidative-stress-resistance chaperone; Provisional 99.92
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 99.92
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 99.92
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 99.91
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 99.91
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 99.91
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 99.91
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 99.89
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 99.89
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 99.89
COG4977328 Transcriptional regulator containing an amidase do 99.88
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 99.87
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 99.87
PRK11574196 oxidative-stress-resistance chaperone; Provisional 99.87
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 99.87
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 99.85
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 99.85
PRK09393322 ftrA transcriptional activator FtrA; Provisional 99.84
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 99.84
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 99.84
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 99.84
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 99.84
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 99.84
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 99.83
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 99.83
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 99.83
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 99.82
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 99.82
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 99.82
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 99.81
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 99.81
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 99.81
PRK04155287 chaperone protein HchA; Provisional 99.81
PRK09393 322 ftrA transcriptional activator FtrA; Provisional 99.81
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 99.8
PRK11249752 katE hydroperoxidase II; Provisional 99.77
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 99.76
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 99.75
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 99.74
PRK04155287 chaperone protein HchA; Provisional 99.74
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 99.74
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 99.73
COG4977 328 Transcriptional regulator containing an amidase do 99.7
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 99.68
KOG2764 247 consensus Putative transcriptional regulator DJ-1 99.68
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 99.67
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 99.64
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 99.6
PRK03619 219 phosphoribosylformylglycinamidine synthase I; Prov 99.29
PRK01175 261 phosphoribosylformylglycinamidine synthase I; Prov 99.17
PRK11249752 katE hydroperoxidase II; Provisional 99.16
TIGR01737 227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.07
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 99.07
cd01740 238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 98.95
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 98.82
COG0047 231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 98.79
COG3155217 ElbB Uncharacterized protein involved in an early 98.75
PRK13527 200 glutamine amidotransferase subunit PdxT; Provision 98.74
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 98.63
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 98.58
PF13507 259 GATase_5: CobB/CobQ-like glutamine amidotransferas 98.58
cd03130 198 GATase1_CobB Type 1 glutamine amidotransferase (GA 98.43
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 98.41
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 98.35
PRK08250 235 glutamine amidotransferase; Provisional 98.31
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 98.29
PRK13143 200 hisH imidazole glycerol phosphate synthase subunit 98.26
cd01750 194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 98.26
PRK07053 234 glutamine amidotransferase; Provisional 98.2
PLN02832 248 glutamine amidotransferase subunit of pyridoxal 5' 98.16
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 98.12
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 98.08
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 98.03
TIGR01857 1239 FGAM-synthase phosphoribosylformylglycinamidine sy 97.99
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 97.92
PRK13141 205 hisH imidazole glycerol phosphate synthase subunit 97.91
PLN03206 1307 phosphoribosylformylglycinamidine synthase; Provis 97.91
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 97.88
TIGR01735 1310 FGAM_synt phosphoribosylformylglycinamidine syntha 97.88
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 97.87
PRK06490 239 glutamine amidotransferase; Provisional 97.84
PRK05297 1290 phosphoribosylformylglycinamidine synthase; Provis 97.8
PHA03366 1304 FGAM-synthase; Provisional 97.8
PRK06895190 putative anthranilate synthase component II; Provi 97.78
PRK05665 240 amidotransferase; Provisional 97.76
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 97.75
CHL00188 210 hisH imidazole glycerol phosphate synthase subunit 97.72
TIGR01739 1202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 97.7
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 97.69
PRK13146 209 hisH imidazole glycerol phosphate synthase subunit 97.66
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 97.59
TIGR00379 449 cobB cobyrinic acid a,c-diamide synthase. This mod 97.58
cd01748 198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 97.57
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 97.52
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 97.51
PRK09065 237 glutamine amidotransferase; Provisional 97.49
PRK07765 214 para-aminobenzoate synthase component II; Provisio 97.47
COG0311 194 PDX2 Predicted glutamine amidotransferase involved 97.42
COG0118 204 HisH Glutamine amidotransferase [Amino acid transp 97.42
PRK00784 488 cobyric acid synthase; Provisional 97.39
PRK08007187 para-aminobenzoate synthase component II; Provisio 97.38
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 97.31
PRK05670189 anthranilate synthase component II; Provisional 97.27
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 97.27
TIGR01855 196 IMP_synth_hisH imidazole glycerol phosphate syntha 97.26
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 97.24
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 97.24
PRK07567 242 glutamine amidotransferase; Provisional 97.23
PLN02335 222 anthranilate synthase 97.22
PRK06774191 para-aminobenzoate synthase component II; Provisio 97.21
PRK13181 199 hisH imidazole glycerol phosphate synthase subunit 97.17
PRK12564360 carbamoyl phosphate synthase small subunit; Review 97.16
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 97.15
PRK13170 196 hisH imidazole glycerol phosphate synthase subunit 97.08
PRK08857193 para-aminobenzoate synthase component II; Provisio 97.07
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 97.04
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 97.03
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 97.0
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 97.0
PLN02617 538 imidazole glycerol phosphate synthase hisHF 97.0
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 96.99
PRK07649 195 para-aminobenzoate/anthranilate synthase glutamine 96.98
CHL00101190 trpG anthranilate synthase component 2 96.97
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 96.96
PRK05637 208 anthranilate synthase component II; Provisional 96.95
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 96.87
PRK05380 533 pyrG CTP synthetase; Validated 96.87
PF09825 367 BPL_N: Biotin-protein ligase, N terminal; InterPro 96.85
PRK00758184 GMP synthase subunit A; Validated 96.84
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 96.83
PRK13566 720 anthranilate synthase; Provisional 96.81
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 96.77
PRK13896 433 cobyrinic acid a,c-diamide synthase; Provisional 96.75
TIGR01815 717 TrpE-clade3 anthranilate synthase, alpha proteobac 96.7
PRK12838354 carbamoyl phosphate synthase small subunit; Review 96.68
PRK13152 201 hisH imidazole glycerol phosphate synthase subunit 96.68
PRK14004 210 hisH imidazole glycerol phosphate synthase subunit 96.61
PRK13142 192 hisH imidazole glycerol phosphate synthase subunit 96.57
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 96.51
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 96.48
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 96.42
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 96.39
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 96.37
TIGR00337 525 PyrG CTP synthase. CTP synthase is involved in pyr 96.37
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 96.34
PLN02327 557 CTP synthase 96.17
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 96.12
PRK11366 254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 96.12
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 96.08
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 96.01
PRK08250235 glutamine amidotransferase; Provisional 96.0
PLN02347 536 GMP synthetase 95.93
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 95.9
TIGR00313 475 cobQ cobyric acid synthase CobQ. 95.87
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 95.82
COG0504 533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 95.74
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 95.7
cd01746 235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 95.65
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 95.55
cd01747 273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 95.43
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 95.42
KOG3179 245 consensus Predicted glutamine synthetase [Nucleoti 95.28
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 95.28
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 95.02
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 94.78
PRK06186 229 hypothetical protein; Validated 94.68
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 94.58
PRK07053234 glutamine amidotransferase; Provisional 94.39
PF1358738 DJ-1_PfpI_N: N-terminal domain of DJ-1_PfpI family 94.29
COG3442 250 Predicted glutamine amidotransferase [General func 94.25
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 94.2
PRK00074 511 guaA GMP synthase; Reviewed 94.11
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 94.05
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 93.71
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 93.68
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 93.66
KOG3210 226 consensus Imidazoleglycerol-phosphate synthase sub 93.54
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 93.32
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 93.23
COG2071 243 Predicted glutamine amidotransferases [General fun 93.16
COG3155217 ElbB Uncharacterized protein involved in an early 93.09
PRK06490239 glutamine amidotransferase; Provisional 92.86
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 92.81
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 92.58
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 92.28
PRK00784488 cobyric acid synthase; Provisional 92.23
PRK05368 302 homoserine O-succinyltransferase; Provisional 92.12
PRK06895190 putative anthranilate synthase component II; Provi 91.88
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 91.8
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 91.57
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 91.56
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 91.47
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 91.37
PLN02889 918 oxo-acid-lyase/anthranilate synthase 90.96
PHA033661304 FGAM-synthase; Provisional 90.91
TIGR02069 250 cyanophycinase cyanophycinase. This model describe 90.71
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 89.8
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 89.58
PLN02617 538 imidazole glycerol phosphate synthase hisHF 89.49
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 89.31
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 89.2
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 89.13
COG4635175 HemG Flavodoxin [Energy production and conversion 88.61
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 88.32
PRK05665240 amidotransferase; Provisional 88.24
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 88.0
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 87.95
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 87.88
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 87.58
COG4285 253 Uncharacterized conserved protein [Function unknow 86.59
PRK06774191 para-aminobenzoate synthase component II; Provisio 86.56
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 86.49
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 86.2
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 86.09
PRK05670189 anthranilate synthase component II; Provisional 86.0
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 85.47
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 85.3
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 85.24
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 85.24
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 84.79
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 84.7
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 84.54
PRK12564360 carbamoyl phosphate synthase small subunit; Review 84.48
PRK09065237 glutamine amidotransferase; Provisional 84.19
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 82.96
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 82.93
PRK07765214 para-aminobenzoate synthase component II; Provisio 82.69
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 82.3
COG3340224 PepE Peptidase E [Amino acid transport and metabol 81.73
PRK00758184 GMP synthase subunit A; Validated 81.07
PRK02645 305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 80.37
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
Probab=99.97  E-value=3.8e-30  Score=208.57  Aligned_cols=196  Identities=43%  Similarity=0.591  Sum_probs=164.3

Q ss_pred             CchhhHHHHHHhCCCeEEEEeeCCCceeecCCCCEEecCccccccccC--------CCccchhccccChHHHHHHHHHHh
Q 023800            1 MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCRDA--------CGMPGATNLKESEVLESIVKKQAS   72 (277)
Q Consensus         1 ~E~~~~~~~l~~~~~~v~~~s~~~~~~v~~~~g~~v~~d~~~~~~~~~--------gG~~~~~~~~~~~~~~~~l~~~~~   72 (277)
                      +|++.|.++|+|.|++|+++|++++.+++++.|..+.+|..+.|....        ||.++...+.+++.+.+++|+|.+
T Consensus        19 ~E~ivp~dVLrr~Gi~Vt~ag~~~~~~vkcs~~v~~~~d~~l~D~~~~~yDviilPGG~~g~e~L~~~~~v~~lvK~q~~   98 (247)
T KOG2764|consen   19 YEFIVPIDVLRRGGIDVTVAGPNKKEGVKCSRGVHILPDNALFDVVDSKYDVIILPGGLPGAETLSECEKVVDLVKEQAE   98 (247)
T ss_pred             eEEEEeHHHHHhcCceEEEecCCCCcccccccceEecccccchhhccccccEEEecCCchhhhhhhhcHHHHHHHHHHHh
Confidence            589999999999999999999998889999999999999988776432        887889999999999999999999


Q ss_pred             CCCEEEEEchhHHHHHHHcCCCCCCC-------------------------CCCeEcCCCCCCHHHHHHHHHHHhcChhH
Q 023800           73 DGRLYAAICVFLAVALGSWGLLKGLK-------------------------DGKVVTTRGPGTPMEFVVALVEQLYGKGK  127 (277)
Q Consensus        73 ~g~~i~aiC~g~~~~La~aGll~g~~-------------------------dg~~iT~~g~~~~~~~a~~li~~l~g~~~  127 (277)
                      .|++|++||+||.++|+..|++.|++                         |||+|||+||+++++|++.++|+|.|++.
T Consensus        99 ~gkLIaaICaap~~al~a~gl~~gkk~T~~ps~k~~L~~~gy~yve~~vv~dG~liTSrGpgT~~eFal~lvEqL~GKek  178 (247)
T KOG2764|consen   99 SGKLIAAICAAPLTALAAHGLLGGKKCTAHPSVKPKLEEGGYKYVEPRVVKDGNLITSRGPGTAFEFALKLVEQLGGKEK  178 (247)
T ss_pred             cCCeEEEeecchHHHHhhccccccceeeeccchhhhHhhcCcEEecCCeEEeCcEEeccCCCchHHHHHHHHHHhcCchh
Confidence            99999999999954788888888888                         99999999999999999999999999999


Q ss_pred             HHHHhhcccccccCCCchhhcccCccccccCCCCeEEEEecCCCchhhHHHHHHHHHhCCCeEEEEeeCCCceEEcccCc
Q 023800          128 ADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQV  207 (277)
Q Consensus       128 a~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kV~ill~~g~~~~e~~~~~~~l~~a~~~v~~vs~~~~~~v~~~~g~  207 (277)
                      +.++.+.+.+..+.                         +.|+-...|.....+++++ +.++.+-+..          .
T Consensus       179 a~~v~~~l~l~~~~-------------------------v~~~~~~~e~~a~~~~~~~-~~~v~~~~~g----------~  222 (247)
T KOG2764|consen  179 ANEVKKPLSLLFLP-------------------------VAPEKKAGEACATADHDLE-GRQVPVEKVG----------H  222 (247)
T ss_pred             hhhhhccceeeccc-------------------------cCCCchhcceecceehhhh-cCcceeeccc----------c
Confidence            99998877766433                         4566666777777777777 6666544433          2


Q ss_pred             EEEeCcchhhhccCCccEEEEcCCc
Q 023800          208 KLVADMLIDEAAKLSYDLIVLPGGL  232 (277)
Q Consensus       208 ~i~~~~~~~~~~~~~~D~livpGG~  232 (277)
                      +......|+|+..++||.|++|||.
T Consensus       223 ~~~~~~~~dd~~~~syD~ivlPgg~  247 (247)
T KOG2764|consen  223 NFAKTVAWDDAAVSSYDLIVLPGGR  247 (247)
T ss_pred             ceEEEEEehhhhcccccEEEecCCC
Confidence            2222233888877899999999983



>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PF13587 DJ-1_PfpI_N: N-terminal domain of DJ-1_PfpI family; PDB: 1U9C_A 1QVW_B 1QVV_D 1QVZ_A 1RW7_A Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4285 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK02645 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
3ot1_A208 Crystal Structure Of Vc2308 Protein Length = 208 9e-21
3ot1_B208 Crystal Structure Of Vc2308 Protein Length = 208 2e-19
2ab0_A205 Crystal Structure Of E. Coli Protein Yajl (Thij) Le 7e-19
4e08_A190 Crystal Structure Of Drosophila Melanogaster Dj-1be 4e-14
3b36_A192 Structure Of M26l Dj-1 Length = 192 1e-13
1pe0_A197 Crystal Structure Of The K130r Mutant Of Human Dj-1 2e-13
3b3a_A192 Structure Of E163kR145E DJ-1 Length = 192 2e-13
1j42_A189 Crystal Structure Of Human Dj-1 Length = 189 2e-13
2r1u_A187 Dj-1 Activation By Catechol Quinone Modification Le 2e-13
3sf8_B191 Structural Insights Into Thiol Stabilization Of Dj- 2e-13
1ucf_A189 The Crystal Structure Of Dj-1, A Protein Related To 2e-13
2rk4_A197 Structure Of M26i Dj-1 Length = 197 2e-13
3cy6_A197 Crystal Structure Of E18q Dj-1 Length = 197 5e-13
2rk3_A197 Structure Of A104t Dj-1 Length = 197 5e-13
3cza_A197 Crystal Structure Of E18d Dj-1 Length = 197 5e-13
3b38_A192 Structure Of A104v Dj-1 Length = 192 6e-13
3cz9_A197 Crystal Structure Of E18l Dj-1 Length = 197 2e-12
3bwe_A189 Crystal Structure Of Aggregated Form Of Dj1 Length 2e-12
1pdv_A197 Crystal Structure Of Human Dj-1, P 31 2 1 Space Gro 3e-12
2r1t_B187 Dopamine Quinone Conjugation To Dj-1 Length = 187 3e-12
2r1t_A187 Dopamine Quinone Conjugation To Dj-1 Length = 187 3e-12
2rk6_A192 Structure Of E163k Dj-1 Length = 192 4e-12
1soa_A189 Human Dj-1 With Sulfinic Acid Length = 189 4e-12
3sf8_A191 Structural Insights Into Thiol Stabilization Of Dj- 4e-12
3ezg_A196 Crystal Structure Of E18q Dj-1 With Oxidized C106 L 8e-12
3f71_A196 Crystal Structure Of E18d Dj-1 With Oxidized C106 L 8e-12
3cyf_A197 Crystal Structure Of E18n Dj-1 Length = 197 2e-11
>pdb|3OT1|A Chain A, Crystal Structure Of Vc2308 Protein Length = 208 Back     alignment and structure

Iteration: 1

Score = 97.1 bits (240), Expect = 9e-21, Method: Compositional matrix adjust. Identities = 50/110 (45%), Positives = 71/110 (64%) Query: 160 SPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADKLEILASCQVKLVADMLIDEAA 219 S +ILVP+A+GSEE E VII+D L RA V A+V DKL++ S V L A+ ++ + Sbjct: 9 SKRILVPVAHGSEEXETVIIVDTLVRAGFQVTXAAVGDKLQVQGSRGVWLTAEQTLEACS 68 Query: 220 KLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVL 269 ++D + LPGG+GGAQAFA S L+ ++ + + AICA+PALV Sbjct: 69 AEAFDALALPGGVGGAQAFADSTALLALIDAFSQQGKLVAAICATPALVF 118
>pdb|3OT1|B Chain B, Crystal Structure Of Vc2308 Protein Length = 208 Back     alignment and structure
>pdb|2AB0|A Chain A, Crystal Structure Of E. Coli Protein Yajl (Thij) Length = 205 Back     alignment and structure
>pdb|4E08|A Chain A, Crystal Structure Of Drosophila Melanogaster Dj-1beta Length = 190 Back     alignment and structure
>pdb|3B36|A Chain A, Structure Of M26l Dj-1 Length = 192 Back     alignment and structure
>pdb|1PE0|A Chain A, Crystal Structure Of The K130r Mutant Of Human Dj-1 Length = 197 Back     alignment and structure
>pdb|3B3A|A Chain A, Structure Of E163kR145E DJ-1 Length = 192 Back     alignment and structure
>pdb|1J42|A Chain A, Crystal Structure Of Human Dj-1 Length = 189 Back     alignment and structure
>pdb|2R1U|A Chain A, Dj-1 Activation By Catechol Quinone Modification Length = 187 Back     alignment and structure
>pdb|3SF8|B Chain B, Structural Insights Into Thiol Stabilization Of Dj-1 Length = 191 Back     alignment and structure
>pdb|1UCF|A Chain A, The Crystal Structure Of Dj-1, A Protein Related To Male Fertility And Parkinson's Disease Length = 189 Back     alignment and structure
>pdb|2RK4|A Chain A, Structure Of M26i Dj-1 Length = 197 Back     alignment and structure
>pdb|3CY6|A Chain A, Crystal Structure Of E18q Dj-1 Length = 197 Back     alignment and structure
>pdb|2RK3|A Chain A, Structure Of A104t Dj-1 Length = 197 Back     alignment and structure
>pdb|3CZA|A Chain A, Crystal Structure Of E18d Dj-1 Length = 197 Back     alignment and structure
>pdb|3B38|A Chain A, Structure Of A104v Dj-1 Length = 192 Back     alignment and structure
>pdb|3CZ9|A Chain A, Crystal Structure Of E18l Dj-1 Length = 197 Back     alignment and structure
>pdb|3BWE|A Chain A, Crystal Structure Of Aggregated Form Of Dj1 Length = 189 Back     alignment and structure
>pdb|1PDV|A Chain A, Crystal Structure Of Human Dj-1, P 31 2 1 Space Group Length = 197 Back     alignment and structure
>pdb|2R1T|B Chain B, Dopamine Quinone Conjugation To Dj-1 Length = 187 Back     alignment and structure
>pdb|2R1T|A Chain A, Dopamine Quinone Conjugation To Dj-1 Length = 187 Back     alignment and structure
>pdb|2RK6|A Chain A, Structure Of E163k Dj-1 Length = 192 Back     alignment and structure
>pdb|1SOA|A Chain A, Human Dj-1 With Sulfinic Acid Length = 189 Back     alignment and structure
>pdb|3SF8|A Chain A, Structural Insights Into Thiol Stabilization Of Dj-1 Length = 191 Back     alignment and structure
>pdb|3EZG|A Chain A, Crystal Structure Of E18q Dj-1 With Oxidized C106 Length = 196 Back     alignment and structure
>pdb|3F71|A Chain A, Crystal Structure Of E18d Dj-1 With Oxidized C106 Length = 196 Back     alignment and structure
>pdb|3CYF|A Chain A, Crystal Structure Of E18n Dj-1 Length = 197 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 1e-46
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 7e-42
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 1e-46
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 3e-45
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 1e-45
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 7e-41
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 2e-44
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 2e-40
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 8e-37
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 2e-33
2fex_A188 Conserved hypothetical protein; structural genomic 7e-35
2fex_A188 Conserved hypothetical protein; structural genomic 2e-24
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 4e-34
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 2e-15
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 3e-10
3cne_A175 Putative protease I; structural genomics, PSI-2, M 9e-33
3cne_A175 Putative protease I; structural genomics, PSI-2, M 2e-26
3bhn_A 236 THIJ/PFPI domain protein; structural genomics, joi 3e-32
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 2e-28
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 3e-28
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 3e-23
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 2e-27
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 2e-18
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 1e-25
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 2e-20
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 1e-20
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 1e-16
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 2e-18
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 2e-14
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 2e-16
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 1e-06
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 2e-06
3ewn_A 253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 2e-05
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 3e-06
1u9c_A224 APC35852; structural genomics, protein structure i 7e-06
3mgk_A211 Intracellular protease/amidase related enzyme (THI 7e-06
3mgk_A211 Intracellular protease/amidase related enzyme (THI 5e-04
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 2e-05
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 2e-04
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Length = 205 Back     alignment and structure
 Score =  154 bits (391), Expect = 1e-46
 Identities = 57/119 (47%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 160 SPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVADK--LEILASCQVKLVADMLIDE 217
           S   LV +A GSEE EAV  ID+L R    V  ASVA    L I  S  VKL+AD  + E
Sbjct: 2   SASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVE 61

Query: 218 AAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLK 276
            A   YD+IVLPGG+ GA+ F  S  LV  +K+   S R   AICA+PA VL PH +  
Sbjct: 62  VADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFP 120


>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Length = 205 Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} Length = 208 Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} Length = 208 Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Length = 190 Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Length = 190 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Length = 197 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Length = 197 Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Length = 194 Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Length = 194 Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Length = 188 Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Length = 188 Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Length = 396 Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Length = 396 Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Length = 396 Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Length = 175 Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Length = 175 Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Length = 236 Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Length = 236 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Length = 365 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Length = 365 Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Length = 212 Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Length = 212 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Length = 206 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Length = 206 Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Length = 190 Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Length = 190 Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} PDB: 1g2i_A Length = 168 Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} PDB: 1g2i_A Length = 168 Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Length = 193 Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Length = 193 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Length = 232 Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Length = 253 Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Length = 253 Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Length = 242 Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Length = 224 Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Length = 211 Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Length = 211 Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Length = 231 Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 100.0
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 99.96
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 99.95
3er6_A209 Putative transcriptional regulator protein; struct 99.95
3mgk_A211 Intracellular protease/amidase related enzyme (THI 99.95
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 99.95
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 99.95
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 99.95
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 99.95
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 99.95
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 99.94
3gra_A202 Transcriptional regulator, ARAC family; transcript 99.94
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 99.93
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 99.93
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 99.93
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 99.92
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 99.92
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 99.92
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 99.92
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 99.92
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 99.91
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 99.91
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 99.91
2fex_A188 Conserved hypothetical protein; structural genomic 99.91
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 99.91
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 99.91
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 99.91
3ewn_A 253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 99.9
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 99.9
3gra_A202 Transcriptional regulator, ARAC family; transcript 99.9
3noq_A 231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 99.9
3er6_A209 Putative transcriptional regulator protein; struct 99.9
2fex_A188 Conserved hypothetical protein; structural genomic 99.89
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 99.89
3mgk_A211 Intracellular protease/amidase related enzyme (THI 99.89
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 99.89
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 99.88
3cne_A175 Putative protease I; structural genomics, PSI-2, M 99.88
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 99.87
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 99.87
1u9c_A224 APC35852; structural genomics, protein structure i 99.87
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 99.87
1u9c_A224 APC35852; structural genomics, protein structure i 99.86
3cne_A175 Putative protease I; structural genomics, PSI-2, M 99.86
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 99.85
3n7t_A247 Macrophage binding protein; seattle structural gen 99.84
3bhn_A 236 THIJ/PFPI domain protein; structural genomics, joi 99.84
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 99.84
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 99.84
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 99.83
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 99.83
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 99.83
3n7t_A247 Macrophage binding protein; seattle structural gen 99.82
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 99.82
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 99.81
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 99.8
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 99.78
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 99.74
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 99.69
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 99.65
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 99.64
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 99.44
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 99.22
3d54_D 213 Phosphoribosylformylglycinamidine synthase 1; alph 99.21
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 99.01
2nv0_A 196 Glutamine amidotransferase subunit PDXT; 3-layer(A 98.46
1q7r_A 219 Predicted amidotransferase; structural genomics, Y 98.41
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 98.37
1ka9_H 200 Imidazole glycerol phosphtate synthase; riken stru 98.36
3l7n_A 236 Putative uncharacterized protein; glutamine amidot 98.31
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 98.31
3m3p_A 250 Glutamine amido transferase; structural genomics, 98.28
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 98.03
3ugj_A 1303 Phosphoribosylformylglycinamidine synthase; amidot 98.0
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 97.99
2abw_A 227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 97.98
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 97.92
1gpw_B 201 Amidotransferase HISH; lyase/transferase, complex 97.85
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 97.81
4gud_A 211 Imidazole glycerol phosphate synthase subunit His; 97.7
1o1y_A 239 Conserved hypothetical protein TM1158; flavodoxin- 97.67
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 97.54
2a9v_A 212 GMP synthase; structural genomics, joint center fo 97.31
2vpi_A 218 GMP synthase; guanine monophosphate synthetase, ph 97.18
3fij_A 254 LIN1909 protein; 11172J, uncharacterized protein, 97.15
2vdj_A 301 Homoserine O-succinyltransferase; methionine biosy 97.03
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 96.99
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 96.9
2h2w_A 312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 96.87
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 96.85
1l9x_A 315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 96.83
2w7t_A 273 CTP synthetase, putative cytidine triphosphate syn 96.74
2v4u_A 289 CTP synthase 2; pyrimidine biosynthesis, glutamine 96.58
3uow_A 556 GMP synthetase; structural genomics consortium, SG 96.47
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 96.26
3r75_A 645 Anthranilate/para-aminobenzoate synthases compone; 96.17
1q7r_A219 Predicted amidotransferase; structural genomics, Y 96.01
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 95.71
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 95.6
1i1q_B192 Anthranilate synthase component II; tryptophan bio 95.53
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 95.13
3nva_A 535 CTP synthase; rossman fold, nucleotide binding, LI 95.07
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 95.06
3l7n_A236 Putative uncharacterized protein; glutamine amidot 95.0
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 94.9
3m3p_A250 Glutamine amido transferase; structural genomics, 94.77
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 94.51
1s1m_A 545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 94.31
1vco_A 550 CTP synthetase; tetramer, riken structural genomic 94.06
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 93.9
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 93.51
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 93.39
3en0_A 291 Cyanophycinase; serine protease, beta peptide spec 93.24
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 92.74
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 92.6
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 92.6
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 90.13
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 89.71
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 88.75
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 88.11
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 87.5
3rht_A 259 (gatase1)-like protein; structural genomics, PSI-b 86.75
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 85.08
2a9v_A212 GMP synthase; structural genomics, joint center fo 82.5
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 82.43
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=3.5e-45  Score=333.07  Aligned_cols=242  Identities=22%  Similarity=0.295  Sum_probs=216.5

Q ss_pred             CchhhHHHHHHhCCCeEEEEeeCCCc---------------eeecCCCCEEecCcccccccc---C-----CCccchhcc
Q 023800            1 MEAVITIDVLRRSGADVVVASVEKQL---------------RVDACHGVKIVADALVSNCRD---A-----CGMPGATNL   57 (277)
Q Consensus         1 ~E~~~~~~~l~~~~~~v~~~s~~~~~---------------~v~~~~g~~v~~d~~~~~~~~---~-----gG~~~~~~~   57 (277)
                      +|+..|+++|+++||+|+++|++++.               .++++.|+.+.+|..+++++.   +     ||. +...+
T Consensus        26 ~E~~~~~~~l~~ag~~v~~vs~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~D~livpGG~-~~~~~  104 (396)
T 3uk7_A           26 YEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCGHQTYFESRGHNFTLNATFDEVDLSKYDGLVIPGGR-APEYL  104 (396)
T ss_dssp             HHHHHHHHHHHHTTCEEEEECTTCCTTCEECEEEEECSSSSSCEEEECCCEECCSCGGGCCGGGCSEEEECCBS-HHHHH
T ss_pred             HHHHHHHHHHHHCCCEEEEEcCCCcCCCcccccccccccchhhhhccCceeeccCChhhcCcccCCEEEECCCc-chhhc
Confidence            38899999999999999999998521               356778999999999998742   2     774 56667


Q ss_pred             ccChHHHHHHHHHHhCCCEEEEEchhHHHHHHHcCCCCCCC-----------------------------CCCeEcCCCC
Q 023800           58 KESEVLESIVKKQASDGRLYAAICVFLAVALGSWGLLKGLK-----------------------------DGKVVTTRGP  108 (277)
Q Consensus        58 ~~~~~~~~~l~~~~~~g~~i~aiC~g~~~~La~aGll~g~~-----------------------------dg~~iT~~g~  108 (277)
                      ..++.+.+||+++++++++|++||+|++ +|+++|||+||+                             |||+|||+|+
T Consensus       105 ~~~~~~~~~l~~~~~~~~~i~aiC~G~~-~La~aGlL~g~~~T~~~~~~~~l~~~g~~~~~~~~~~~~v~Dg~iiT~~g~  183 (396)
T 3uk7_A          105 ALTASVVELVKEFSRSGKPIASICHGQL-ILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATY  183 (396)
T ss_dssp             TTCHHHHHHHHHHHHTTCCEEEETTTHH-HHHHTTCCTTCEECCCGGGHHHHHHTTCEECCCSSTTCEEEETTEEEESSG
T ss_pred             ccCHHHHHHHHHHHHcCCEEEEECchHH-HHHhccccCCCEeecCcchHHHHHHCCCEEECCCCCcceEecCCEEEecCc
Confidence            8899999999999999999999999999 999999999998                             8999999999


Q ss_pred             CCHHHHHHHHHHHhcChhHHHHHhhcccccccCCCchhhcccCccccccCCCCeEEEEecCCCchhhHHHHHHHHHhCCC
Q 023800          109 GTPMEFVVALVEQLYGKGKADEVSGARVMRANHGDEFTIAEFNPVQWTFDNSPQILVPIANGSEEMEAVIIIDILRRAKA  188 (277)
Q Consensus       109 ~~~~~~a~~li~~l~g~~~a~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kV~ill~~g~~~~e~~~~~~~l~~a~~  188 (277)
                      +++++|++++++++.|++.                              .+++||+|+++|||++.|+..|+++|+++|+
T Consensus       184 ~~~~d~al~li~~l~g~~~------------------------------~~~~ki~ill~dg~~~~e~~~~~~~l~~ag~  233 (396)
T 3uk7_A          184 EGHPEFIQLFVKALGGKIT------------------------------GANKRILFLCGDYMEDYEVKVPFQSLQALGC  233 (396)
T ss_dssp             GGHHHHHHHHHHHTTCEEE------------------------------CCCCEEEEECCTTEEHHHHHHHHHHHHHHTC
T ss_pred             ccHHHHHHHHHHHHhccch------------------------------hccceEEEEecCCCcchhHHHHHHHHHHCCC
Confidence            9999999999999999742                              1347999999999999999999999999999


Q ss_pred             eEEEEeeCCCc---------------eEEcccCcEEEeCcchhhhccCCccEEEEcCCcchHHhhhcCHHHHHHHHHHHH
Q 023800          189 NVVVASVADKL---------------EILASCQVKLVADMLIDEAAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKE  253 (277)
Q Consensus       189 ~v~~vs~~~~~---------------~v~~~~g~~i~~~~~~~~~~~~~~D~livpGG~~~~~~~~~~~~~~~~l~~~~~  253 (277)
                      +++++|+++++               .++++.|..+.++..++++++.+||+|+||||. ....+..++++.+||+++++
T Consensus       234 ~v~~vs~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~D~livpGg~-~~~~~~~~~~~~~~l~~~~~  312 (396)
T 3uk7_A          234 QVDAVCPEKKAGDRCPTAIHDFEGDQTYSEKPGHTFALTTNFDDLVSSSYDALVIPGGR-APEYLALNEHVLNIVKEFMN  312 (396)
T ss_dssp             EEEEECTTCCTTCEECEEEEECCSSSSCEEEECCCEECCSCGGGCCGGGCSEEEECCBS-HHHHHTTCHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCcccccccccccccchhhhcCCceeeccCCHHHCCcccCCEEEECCCc-chhhhccCHHHHHHHHHHHH
Confidence            99999999862               145778999999999999877889999999997 45667889999999999999


Q ss_pred             cCCcEEEEchhhHHhhhhCCCCC
Q 023800          254 SNRPYGAICASPALVLEPHGLLK  276 (277)
Q Consensus       254 ~~~~i~aiC~G~~~lLa~aGlL~  276 (277)
                      ++++|++||+|++ +||++|||+
T Consensus       313 ~~~~i~aiC~g~~-~La~aGlL~  334 (396)
T 3uk7_A          313 SEKPVASICHGQQ-ILAAAGVLK  334 (396)
T ss_dssp             TTCCEEEEGGGHH-HHHHTTTTT
T ss_pred             CCCEEEEEchHHH-HHHHcCCcC
Confidence            9999999999999 999999997



>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d2ab0a1195 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherich 5e-21
d2ab0a1195 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherich 6e-19
d1p5fa_186 c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 2e-16
d1p5fa_186 c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 5e-15
d2fexa1188 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 { 8e-16
d2fexa1188 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 { 2e-11
d1vhqa_217 c.23.16.2 (A:) Putative sigma cross-reacting prote 5e-14
d1vhqa_217 c.23.16.2 (A:) Putative sigma cross-reacting prote 6e-05
d1p80a1156 c.23.16.3 (A:598-753) Catalase, C-terminal domain 3e-12
d1g2ia_166 c.23.16.2 (A:) Intracellular protease {Archaeon Py 4e-11
d1g2ia_166 c.23.16.2 (A:) Intracellular protease {Archaeon Py 1e-10
d1oi4a1170 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Es 9e-11
d1oi4a1170 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Es 2e-10
d1u9ca_221 c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothe 9e-11
d1u9ca_221 c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothe 7e-06
d1sy7a1184 c.23.16.3 (A:553-736) Catalase, C-terminal domain 3e-09
d1sy7a1184 c.23.16.3 (A:553-736) Catalase, C-terminal domain 2e-05
d1n57a_279 c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia col 5e-07
d1qvwa_236 c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Bake 4e-06
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: DJ-1/PfpI
domain: Protein ThiJ (YajL)
species: Escherichia coli [TaxId: 562]
 Score = 85.9 bits (212), Expect = 5e-21
 Identities = 57/119 (47%), Positives = 68/119 (57%), Gaps = 2/119 (1%)

Query: 160 SPQILVPIANGSEEMEAVIIIDILRRAKANVVVASVA--DKLEILASCQVKLVADMLIDE 217
           S   LV +A GSEE EAV  ID+L R    V  ASVA    L I  S  VKL+AD  + E
Sbjct: 1   SASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAITCSRGVKLLADAPLVE 60

Query: 218 AAKLSYDLIVLPGGLGGAQAFAKSKKLVNMLKKQKESNRPYGAICASPALVLEPHGLLK 276
            A   YD+IVLPGG+ GA+ F  S  LV  +K+   S R   AICA+PA VL PH +  
Sbjct: 61  VADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAAICAAPATVLVPHDIFP 119


>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Length = 188 Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Length = 188 Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 166 Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 166 Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Length = 221 Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Length = 221 Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Length = 184 Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Length = 184 Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Length = 279 Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 236 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 99.95
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 99.94
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 99.93
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 99.92
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 99.92
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 99.91
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 99.91
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 99.91
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 99.91
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 99.9
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 99.85
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 99.85
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 99.82
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 99.8
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 99.79
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 99.77
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 99.76
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 99.66
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 99.62
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 99.59
d1q7ra_ 202 Hypothetical protein YaaE {Bacillus stearothermoph 98.58
d2nv0a1 195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 98.51
d1t3ta2 262 FGAM synthase PurL, amidotransferase domain {Salmo 98.49
d1o1ya_ 230 Hypothetical protein TM1158 {Thermotoga maritima [ 98.17
d1jvna2 232 GAT subunit, HisH, (or domain) of imidazoleglycero 97.75
d1k9vf_ 200 GAT subunit, HisH, (or domain) of imidazoleglycero 97.64
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 97.57
d2abwa1 218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 97.51
d2a9va1 196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 97.27
d2ghra1 281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 97.12
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 96.97
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 96.88
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 96.75
d1ka9h_ 195 GAT subunit, HisH, (or domain) of imidazoleglycero 96.38
d1gpma2 205 GMP synthetase {Escherichia coli [TaxId: 562]} 95.85
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 94.56
d1s1ma1 258 CTP synthase PyrG, C-terminal domain {Escherichia 94.47
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 94.32
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 94.08
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 93.9
d1l9xa_ 288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 93.11
d1vcoa1 250 CTP synthase PyrG, C-terminal domain {Thermus ther 92.48
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 89.44
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 89.39
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 88.3
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 88.26
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 85.57
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 83.01
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 81.12
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: DJ-1/PfpI
domain: DJ-1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.1e-30  Score=211.61  Aligned_cols=137  Identities=40%  Similarity=0.562  Sum_probs=126.8

Q ss_pred             CchhhHHHHHHhCCCeEEEEeeCCCceeecCCCCEEecCccccccc---cC------CCccchhccccChHHHHHHHHHH
Q 023800            1 MEAVITIDVLRRSGADVVVASVEKQLRVDACHGVKIVADALVSNCR---DA------CGMPGATNLKESEVLESIVKKQA   71 (277)
Q Consensus         1 ~E~~~~~~~l~~~~~~v~~~s~~~~~~v~~~~g~~v~~d~~~~~~~---~~------gG~~~~~~~~~~~~~~~~l~~~~   71 (277)
                      +|+++|+++|+++||+|+++|++++.+|++++|+.+.+|..++++.   ++      ||..+++.+++++.+.+|||+++
T Consensus        15 ~E~~~p~~~l~~ag~~v~~~s~~~~~~v~~~~g~~i~~d~~l~d~~~~~~~D~liipGG~~~~~~l~~~~~l~~~lr~~~   94 (186)
T d1p5fa_          15 METVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQE   94 (186)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEETTCSSCEECTTSCEECCSEEHHHHHHTCCCSEEEECCCHHHHHHHHHCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCEEEEEEecCCcceecCCCccccCccchhccCCcccccEEEEecCccccccccchHHHHHHHHHhh
Confidence            4889999999999999999999876789999999999999998753   22      87656777889999999999999


Q ss_pred             hCCCEEEEEchhHHHHHHHcCCCCCCC--------------------------CCCeEcCCCCCCHHHHHHHHHHHhcCh
Q 023800           72 SDGRLYAAICVFLAVALGSWGLLKGLK--------------------------DGKVVTTRGPGTPMEFVVALVEQLYGK  125 (277)
Q Consensus        72 ~~g~~i~aiC~g~~~~La~aGll~g~~--------------------------dg~~iT~~g~~~~~~~a~~li~~l~g~  125 (277)
                      ++|++|++||+|++ +||++|||+||+                          |||+|||+|++++++|++++++++.|+
T Consensus        95 ~~~k~i~aiC~G~~-~La~aglL~g~~~T~~~~~~~~~~~~~~~~~~~~~vv~Dg~iiT~~g~~~~~d~al~li~~l~g~  173 (186)
T d1p5fa_          95 NRKGLIAAICAGPT-ALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGK  173 (186)
T ss_dssp             HTTCEEEEETTTHH-HHHHTTCSTTCEECCCGGGHHHHTTTSCSEECCCSEEEETTEEEECSGGGHHHHHHHHHHHHHCH
T ss_pred             ccccceeecccCcc-hhhhcCCccccccccchhHHHHHHhcCceEEecccEEecCCEEECCCccHHHHHHHHHHHHhcCH
Confidence            99999999999999 999999999998                          999999999999999999999999999


Q ss_pred             hHHHHHhhccccc
Q 023800          126 GKADEVSGARVMR  138 (277)
Q Consensus       126 ~~a~~v~~~~~~~  138 (277)
                      +.|+++++.|+++
T Consensus       174 ~~a~~va~~l~l~  186 (186)
T d1p5fa_         174 EVAAQVKAPLVLK  186 (186)
T ss_dssp             HHHHHHHGGGTCC
T ss_pred             HHHHHHHHhhccC
Confidence            9999999999864



>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure