Citrus Sinensis ID: 023944
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| 147839974 | 452 | hypothetical protein VITISV_024206 [Viti | 0.974 | 0.592 | 0.472 | 6e-60 | |
| 225448699 | 441 | PREDICTED: U-box domain-containing prote | 0.974 | 0.607 | 0.472 | 9e-60 | |
| 356507514 | 426 | PREDICTED: U-box domain-containing prote | 0.967 | 0.624 | 0.450 | 2e-47 | |
| 356518698 | 428 | PREDICTED: U-box domain-containing prote | 0.941 | 0.605 | 0.453 | 4e-46 | |
| 449460185 | 429 | PREDICTED: U-box domain-containing prote | 0.938 | 0.601 | 0.45 | 1e-44 | |
| 297736483 | 384 | unnamed protein product [Vitis vinifera] | 0.8 | 0.572 | 0.443 | 4e-41 | |
| 388522335 | 432 | unknown [Medicago truncatula] | 0.938 | 0.597 | 0.438 | 1e-38 | |
| 449457472 | 379 | PREDICTED: U-box domain-containing prote | 0.807 | 0.585 | 0.452 | 7e-35 | |
| 449524615 | 380 | PREDICTED: U-box domain-containing prote | 0.807 | 0.584 | 0.465 | 2e-34 | |
| 255559723 | 394 | conserved hypothetical protein [Ricinus | 0.345 | 0.241 | 0.629 | 6e-29 |
| >gi|147839974|emb|CAN61689.1| hypothetical protein VITISV_024206 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 236 bits (603), Expect = 6e-60, Method: Compositional matrix adjust.
Identities = 152/322 (47%), Positives = 199/322 (61%), Gaps = 54/322 (16%)
Query: 1 MSSDEIAL-------NGLNTQLVFQDDPLRSFNC--QQHRVGDPGPKTRELTGFIDDKMF 51
M+S+E+ NGLN+QLVFQD+ LR FNC Q RVGDPGPKTREL+ FID+KMF
Sbjct: 1 MASEEVGFVPPQRLENGLNSQLVFQDEALR-FNCGAPQRRVGDPGPKTRELSSFIDEKMF 59
Query: 52 SVDRDRYFRPQ-----PTMFTEHHPERRDPPQAREWSGNATSPSTDESDGEDDDVDDDED 106
V+RDRYF PQ +++ + PER P R W+GN +P+ E ++ DD+E+
Sbjct: 60 CVERDRYFHPQGGEFRRSIYGDAPPER---PDGRNWNGNGNTPTPSGEGSEGEEDDDEEE 116
Query: 107 DDDVDEAEKNNNHNSNSNVTNCNNNNNSTNCGILTAGVEKMGNGKAKNQLNFGK------ 160
+DD DE ++ + + N +N+ + G L + +K+GNGKAK+ +FG
Sbjct: 117 EDDDDEVDEGDGEVEGLVAVDDANKSNNHSSGSLHSSADKIGNGKAKDHSSFGSNRDVLM 176
Query: 161 ------------IGNAGQNVNNGAI------VTVAEADSDVYYSQYLQQGTEGSSGSGQK 202
+ +N G I VT+AE D D+YYSQ+LQ G EGS+ GQK
Sbjct: 177 KDGAIVLSTNSARASPSENHRQGRISHYQNAVTIAEPDGDMYYSQFLQ-GPEGSA-PGQK 234
Query: 203 ECVAVDNGCGISG---------SGDSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHV 253
E +AV+NGCG SG SG+SL+AILSDP+TG LMDDAMILPCGHSFG G+QHV
Sbjct: 235 E-LAVENGCGFSGRKDVSLSTESGESLKAILSDPLTGALMDDAMILPCGHSFGGGGMQHV 293
Query: 254 IRMKACYTCSRPVLEDSIAPNL 275
I+MKAC TCS+P EDS+ PNL
Sbjct: 294 IKMKACSTCSQPFSEDSVQPNL 315
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225448699|ref|XP_002275253.1| PREDICTED: U-box domain-containing protein 62-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356507514|ref|XP_003522509.1| PREDICTED: U-box domain-containing protein 62-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356518698|ref|XP_003528015.1| PREDICTED: U-box domain-containing protein 62-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449460185|ref|XP_004147826.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] gi|449476988|ref|XP_004154895.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297736483|emb|CBI25354.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388522335|gb|AFK49229.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449457472|ref|XP_004146472.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449524615|ref|XP_004169317.1| PREDICTED: U-box domain-containing protein 62-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255559723|ref|XP_002520881.1| conserved hypothetical protein [Ricinus communis] gi|223540012|gb|EEF41590.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| TAIR|locus:2153484 | 363 | AT5G05230 [Arabidopsis thalian | 0.429 | 0.325 | 0.488 | 1.1e-31 | |
| TAIR|locus:2061823 | 383 | AT2G40640 "AT2G40640" [Arabido | 0.352 | 0.253 | 0.5 | 2.2e-21 | |
| TAIR|locus:504955744 | 554 | AT3G19895 "AT3G19895" [Arabido | 0.203 | 0.101 | 0.428 | 3.1e-08 |
| TAIR|locus:2153484 AT5G05230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 293 (108.2 bits), Expect = 1.1e-31, Sum P(2) = 1.1e-31
Identities = 65/133 (48%), Positives = 84/133 (63%)
Query: 157 NFGKIG---NAGQN-VNNGAIVTVAEADSDVYYSQYLQQGTEXXXXXXQKECVAVDNGCG 212
N G IG +AG++ V+ GA++ V + D+ YYSQ+ + ++ +A DNGC
Sbjct: 106 NEGDIGMNKDAGEDSVSAGAVIVVGQ-DNAAYYSQHFKTVEASFVSRNEESSIAADNGCD 164
Query: 213 ISGSGD----------SLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMKACYTC 262
SG D SLR ILSDP TG+LM DAMILPCGH+FGA G++ V +MKAC TC
Sbjct: 165 FSGRRDLSSSSSNSIESLRTILSDPTTGSLMADAMILPCGHTFGAGGIEQVKQMKACCTC 224
Query: 263 SRPVLEDSIAPNL 275
S+PV EDSI PNL
Sbjct: 225 SQPVSEDSITPNL 237
|
|
| TAIR|locus:2061823 AT2G40640 "AT2G40640" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955744 AT3G19895 "AT3G19895" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00029454001 | SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (225 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.3 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.1 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.57 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.51 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.2 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 96.75 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 96.75 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 96.67 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 96.66 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 96.64 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 96.37 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 96.19 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.19 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 95.94 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 95.86 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 95.8 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 94.95 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 94.34 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 93.93 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 93.93 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 93.66 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 93.18 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.71 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 91.85 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.14 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 90.21 | |
| KOG2042 | 943 | consensus Ubiquitin fusion degradation protein-2 [ | 89.27 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 89.06 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 87.72 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 87.29 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 87.22 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 85.75 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.68 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 84.9 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 84.56 |
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
Probab=99.30 E-value=8.5e-13 Score=96.35 Aligned_cols=54 Identities=28% Similarity=0.519 Sum_probs=45.3
Q ss_pred hhhcCcccccccccceeccCCcccCchhHHHHHhc--cccccCCCccccCCCCCCC
Q 023944 222 AILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRM--KACYTCSRPVLEDSIAPNL 275 (275)
Q Consensus 222 aILSDPlSGalMEDAMIl~CGHSFG~~giq~Vi~m--k~C~lCs~~Ite~sL~PNl 275 (275)
.-|.+|||+.+|.|+||++|||+|.+..|++|++. .+||+|.+++++..|+||.
T Consensus 3 ~~f~CpIt~~lM~dPVi~~~G~tyer~~I~~~l~~~~~~~P~t~~~l~~~~l~pn~ 58 (73)
T PF04564_consen 3 DEFLCPITGELMRDPVILPSGHTYERSAIERWLEQNGGTDPFTRQPLSESDLIPNR 58 (73)
T ss_dssp GGGB-TTTSSB-SSEEEETTSEEEEHHHHHHHHCTTSSB-TTT-SB-SGGGSEE-H
T ss_pred cccCCcCcCcHhhCceeCCcCCEEcHHHHHHHHHcCCCCCCCCCCcCCcccceECH
Confidence 35889999999999999999999999999999987 9999999999999999984
|
Molecular chaperones recognise and contribute to the refolding of misfolded or unfolded proteins, whereas the ubiquitin-proteasome system mediates the degradation of such abnormal proteins. Ubiquitin-protein ligases (E3s) determine the substrate specificity for ubiquitylation and have been classified into HECT and RING-finger families. More recently, however, U-box proteins, which contain a domain (the U box) of about 70 amino acids that is conserved from yeast to humans, have been identified as a new type of E3 []. Members of the U-box family of proteins constitute a class of ubiquitin-protein ligases (E3s) distinct from the HECT-type and RING finger-containing E3 families []. Using yeast two-hybrid technology, all mammalian U-box proteins have been reported to interact with molecular chaperones or co-chaperones, including Hsp90, Hsp70, DnaJc7, EKN1, CRN, and VCP. This suggests that the function of U box-type E3s is to mediate the degradation of unfolded or misfolded proteins in conjunction with molecular chaperones as receptors that recognise such abnormal proteins [, ]. Unlike the RING finger domain, IPR001841 from INTERPRO, that is stabilised by Zn2+ ions coordinated by the cysteines and a histidine, the U-box scaffold is probably stabilised by a system of salt-bridges and hydrogen bonds. The charged and polar residues that participate in this network of bonds are more strongly conserved in the U-box proteins than in classic RING fingers, which supports their role in maintaining the stability of the U box. Thus, the U box appears to have evolved from a RING finger domain by appropriation of a new set of residues required to stabilise its structure, concomitant with the loss of the original, metal-chelating residues [].; GO: 0004842 ubiquitin-protein ligase activity, 0016567 protein ubiquitination, 0000151 ubiquitin ligase complex; PDB: 1T1H_A 2C2L_D 2C2V_V 1WGM_A 2KR4_A 3L1Z_B 3L1X_A 2KRE_A 3M63_A 2QIZ_A .... |
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 275 | |||
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 5e-05 |
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
Score = 40.5 bits (95), Expect = 5e-05
Identities = 14/68 (20%), Positives = 30/68 (44%), Gaps = 5/68 (7%)
Query: 213 ISGSGDSLRAILSDPVTGNLMDDAMILP-CGHSFGAAGVQHVIRMKACYTC----SRPVL 267
+ D + L + ++M DA+++P CG+S+ ++ + +TC V
Sbjct: 3 LGSEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVS 62
Query: 268 EDSIAPNL 275
D++ N
Sbjct: 63 PDALIANK 70
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.14 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.09 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.0 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.98 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.92 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.92 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.9 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.81 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.54 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.53 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.46 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.46 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.43 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.38 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.37 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.34 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.29 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.27 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.27 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.24 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.22 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.22 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.2 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.19 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.18 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.17 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.13 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.1 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.08 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.01 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.99 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.98 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.98 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 97.94 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.86 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.75 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.68 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.67 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.63 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.56 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.49 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.48 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 97.47 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 97.44 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.44 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 97.37 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 97.37 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.36 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.23 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.19 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 97.08 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 97.07 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 96.96 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 96.94 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 96.64 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 96.61 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 96.6 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 96.52 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 96.23 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 96.13 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 96.08 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 96.01 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 95.53 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 95.49 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 95.29 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 94.7 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 94.05 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 87.78 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 87.44 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 85.14 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 84.7 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 81.74 |
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=99.14 E-value=1.3e-11 Score=90.21 Aligned_cols=57 Identities=18% Similarity=0.209 Sum_probs=52.5
Q ss_pred hHhhhhcCcccccccccceeccCCcccCchhHHHHHh-ccccccCCCccccCCCCCCC
Q 023944 219 SLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIR-MKACYTCSRPVLEDSIAPNL 275 (275)
Q Consensus 219 SLRaILSDPlSGalMEDAMIl~CGHSFG~~giq~Vi~-mk~C~lCs~~Ite~sL~PNl 275 (275)
.+..-|.+||++.+|.|+|+++|||+|-+.-|+++++ ...||.|.++++...|+||.
T Consensus 10 ~~p~~~~CpI~~~~m~dPV~~~cGhtf~r~~I~~~l~~~~~cP~~~~~l~~~~l~pn~ 67 (85)
T 2kr4_A 10 DAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVP 67 (85)
T ss_dssp TCCTTTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHCSBCTTTCCBCCGGGCEECH
T ss_pred cCchheECcccCchhcCCeECCCCCEECHHHHHHHHhcCCCCCCCcCCCChHhcchHH
Confidence 4566789999999999999999999999999999876 78999999999999999983
|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 275 | ||||
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-05 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 0.003 |
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: brca1 RING domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.8 bits (95), Expect = 1e-05
Identities = 11/61 (18%), Positives = 26/61 (42%), Gaps = 4/61 (6%)
Query: 218 DSLRAILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIRMK----ACYTCSRPVLEDSIAP 273
++++ IL P+ L+ + + C H F + ++ K C C + + S+
Sbjct: 16 NAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQE 75
Query: 274 N 274
+
Sbjct: 76 S 76
|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.17 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.09 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.07 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.83 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.66 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.54 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.21 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.04 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.9 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.56 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.11 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 96.96 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 96.64 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 96.53 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 96.5 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 89.69 |
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.17 E-value=3.9e-12 Score=90.12 Aligned_cols=54 Identities=19% Similarity=0.373 Sum_probs=49.4
Q ss_pred hhhcCcccccccccceeccCCcccCchhHHHHHh--ccccccCCCccccCCCCCCC
Q 023944 222 AILSDPVTGNLMDDAMILPCGHSFGAAGVQHVIR--MKACYTCSRPVLEDSIAPNL 275 (275)
Q Consensus 222 aILSDPlSGalMEDAMIl~CGHSFG~~giq~Vi~--mk~C~lCs~~Ite~sL~PNl 275 (275)
.-|..||+..+|.|+|+++|||||-..-|++++. ...||.|.++++.+.|.||+
T Consensus 6 ~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l~pN~ 61 (80)
T d2c2la2 6 DYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQLIPNL 61 (80)
T ss_dssp STTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGCEECH
T ss_pred ccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCCccCCCccccccccccccHH
Confidence 4578999999999999999999999999999876 35799999999999999984
|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|