Citrus Sinensis ID: 024066

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV
ccccccccccccHHHHHHcccEEEEEccccHHHHHHHccccccccccccccccEEEEcccccHHHHHHHHHHHHHcHHHHccccccccccccccccccHHHHHcccEEEEEcccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccc
cHHHcccEEcccHHHHHHcccEEEEEccccccHHHHEcccccHHHcccccccEEEEEcccccHHHHHHHHHHHHHHcHHHHHHHHcccEEEEccccccHHHHHccEEEEEEcccHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccc
mfsdmgvptketpfevaEASDVVITmlpssshvldvyngpngllqggnsvrpqllidsstidpqtsrnISAAVSNCILkekkdswenpvmldapvsgGVLAAEAGTLTFMVGGSEDAYQAAKPLFlsmgkntiycggagngaaAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSssarcwssdsynpvpgvmegvpasrnygggfaSKLMAKDLNLALASAKevgvdcpltsQAQDIYAKLCenghdskdfscvfqhyyggkdev
mfsdmgvptketpfeVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSstidpqtsrniSAAVSNCILKekkdswenpvMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV
MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV
*******************SDVVITMLPSSSHVLDVYNGPNGLLQGGN*V**QLLI************ISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYG*****
MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGG****
MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV
MFS*MGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query273 2.2.26 [Sep-21-2011]
Q9SUC0347 Probable 3-hydroxyisobuty yes no 1.0 0.786 0.765 1e-125
Q99L13335 3-hydroxyisobutyrate dehy yes no 0.923 0.752 0.515 6e-68
Q2HJD7336 3-hydroxyisobutyrate dehy yes no 0.923 0.75 0.515 9e-68
Q5R5E7336 3-hydroxyisobutyrate dehy yes no 0.923 0.75 0.511 3e-67
P31937336 3-hydroxyisobutyrate dehy yes no 0.923 0.75 0.511 3e-67
P29266335 3-hydroxyisobutyrate dehy yes no 0.923 0.752 0.507 1e-66
Q54CX6321 Probable 3-hydroxyisobuty yes no 0.912 0.775 0.494 8e-60
Q9V8M5324 Probable 3-hydroxyisobuty yes no 0.860 0.725 0.453 2e-51
Q9XTI0299 Probable 3-hydroxyisobuty yes no 0.849 0.775 0.443 6e-51
P28811298 3-hydroxyisobutyrate dehy yes no 0.934 0.855 0.4 3e-47
>sp|Q9SUC0|3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=At4g20930 PE=2 SV=3 Back     alignment and function desciption
 Score =  448 bits (1152), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 209/273 (76%), Positives = 242/273 (88%)

Query: 1   MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSST 60
           MF++MGV ++ETP+EVA+ S+VVITMLPSSSHV+DVY G NGLL G N +RP L IDSST
Sbjct: 75  MFTEMGVSSRETPYEVAQDSEVVITMLPSSSHVMDVYTGTNGLLLGENDIRPALFIDSST 134

Query: 61  IDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQA 120
           IDPQT+R IS AVSNC LKEK+D+WE PVMLDAPVSGGVLAAEAGTLTFMVGG EDAY A
Sbjct: 135 IDPQTTRKISLAVSNCNLKEKRDNWEKPVMLDAPVSGGVLAAEAGTLTFMVGGPEDAYLA 194

Query: 121 AKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKIL 180
           A+P+  SMG+ +IYCGG+GNG+AAKICNNL MAVSMLG SEAL LGQSLGISASTLT++L
Sbjct: 195 ARPILQSMGRTSIYCGGSGNGSAAKICNNLAMAVSMLGTSEALALGQSLGISASTLTEVL 254

Query: 181 NSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTS 240
           N+SS RCWSSD+YNPVPGVM+GVP+SR+Y GGFASKLMAKDLNLA ASA+EVG   PL S
Sbjct: 255 NTSSGRCWSSDAYNPVPGVMKGVPSSRDYNGGFASKLMAKDLNLAAASAEEVGHKSPLIS 314

Query: 241 QAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV 273
           +AQ+IY K+CE GH++KDFSCVF+H+Y GKDEV
Sbjct: 315 KAQEIYKKMCEEGHETKDFSCVFRHFYNGKDEV 347

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 1
>sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=2 SV=1 Back     alignment and function description
>sp|Q2HJD7|3HIDH_BOVIN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=HIBADH PE=2 SV=1 Back     alignment and function description
>sp|Q5R5E7|3HIDH_PONAB 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Pongo abelii GN=HIBADH PE=2 SV=1 Back     alignment and function description
>sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=HIBADH PE=1 SV=2 Back     alignment and function description
>sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 Back     alignment and function description
>sp|Q54CX6|3HIDH_DICDI Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=hibA PE=3 SV=1 Back     alignment and function description
>sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 Back     alignment and function description
>sp|Q9XTI0|3HIDH_CAEEL Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=B0250.5 PE=3 SV=1 Back     alignment and function description
>sp|P28811|MMSB_PSEAE 3-hydroxyisobutyrate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mmsB PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
224061611347 predicted protein [Populus trichocarpa] 1.0 0.786 0.857 1e-136
225444069345 PREDICTED: probable 3-hydroxyisobutyrate 0.996 0.788 0.801 1e-129
255564371 388 3-hydroxyisobutyrate dehydrogenase, puta 1.0 0.703 0.805 1e-129
18415593347 3-hydroxyisobutyrate dehydrogenase [Arab 1.0 0.786 0.765 1e-123
21555592347 3-hydroxyisobutyrate dehydrogenase-like 1.0 0.786 0.765 1e-123
449435530353 PREDICTED: probable 3-hydroxyisobutyrate 0.996 0.770 0.779 1e-122
7431189371 3-hydroxyisobutyrate dehydrogenase homol 1.0 0.735 0.703 1e-119
297799966372 hypothetical protein ARALYDRAFT_329506 [ 1.0 0.733 0.700 1e-118
357448533352 hypothetical protein MTR_2g030400 [Medic 0.996 0.772 0.738 1e-118
356533083343 PREDICTED: probable 3-hydroxyisobutyrate 0.996 0.793 0.753 1e-118
>gi|224061611|ref|XP_002300566.1| predicted protein [Populus trichocarpa] gi|222847824|gb|EEE85371.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 234/273 (85%), Positives = 250/273 (91%)

Query: 1   MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSST 60
           MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVY GPNGLL+  N +RPQLLIDSST
Sbjct: 75  MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYTGPNGLLRCANLMRPQLLIDSST 134

Query: 61  IDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQA 120
           IDPQTSR +S AVSNCILKEKKD WE PVMLDAPVSGGVLAAEAGTLTFMVGGSEDAY A
Sbjct: 135 IDPQTSRKVSVAVSNCILKEKKDHWEKPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYLA 194

Query: 121 AKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKIL 180
           AKPLFLSMGKN IYCGGAG G+AAKICNNL +AVSMLGVSEA  LGQSLGISA TLTK+L
Sbjct: 195 AKPLFLSMGKNAIYCGGAGTGSAAKICNNLALAVSMLGVSEAFVLGQSLGISAGTLTKVL 254

Query: 181 NSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTS 240
           N+SSARCWSSDSYNPVPGVMEGVPASRNY GGFASKLMAKDLNLA  SAKEVG+ CPLT 
Sbjct: 255 NTSSARCWSSDSYNPVPGVMEGVPASRNYAGGFASKLMAKDLNLAATSAKEVGLQCPLTY 314

Query: 241 QAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV 273
           QAQ+IY +LC++GH+SKDFSC F+HYY G+DE+
Sbjct: 315 QAQEIYTELCKDGHESKDFSCAFRHYYSGQDEL 347

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225444069|ref|XP_002264140.1| PREDICTED: probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial [Vitis vinifera] gi|297740847|emb|CBI31029.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564371|ref|XP_002523182.1| 3-hydroxyisobutyrate dehydrogenase, putative [Ricinus communis] gi|223537589|gb|EEF39213.1| 3-hydroxyisobutyrate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|18415593|ref|NP_567617.1| 3-hydroxyisobutyrate dehydrogenase [Arabidopsis thaliana] gi|30316393|sp|Q9SUC0.3|3HIDH_ARATH RecName: Full=Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial; Short=HIBADH; Flags: Precursor gi|105830240|gb|ABF74718.1| At4g20930 [Arabidopsis thaliana] gi|110737072|dbj|BAF00489.1| 3-hydroxyisobutyrate dehydrogenase -like protein [Arabidopsis thaliana] gi|332658977|gb|AEE84377.1| 3-hydroxyisobutyrate dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21555592|gb|AAM63893.1| 3-hydroxyisobutyrate dehydrogenase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449435530|ref|XP_004135548.1| PREDICTED: probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|7431189|pir||T10635 3-hydroxyisobutyrate dehydrogenase homolog T13K14.90 - Arabidopsis thaliana gi|5262783|emb|CAB45888.1| 3-hydroxyisobutyrate dehydrogenase-like protein [Arabidopsis thaliana] gi|7268890|emb|CAB79093.1| 3-hydroxyisobutyrate dehydrogenase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297799966|ref|XP_002867867.1| hypothetical protein ARALYDRAFT_329506 [Arabidopsis lyrata subsp. lyrata] gi|297313703|gb|EFH44126.1| hypothetical protein ARALYDRAFT_329506 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357448533|ref|XP_003594542.1| hypothetical protein MTR_2g030400 [Medicago truncatula] gi|355483590|gb|AES64793.1| hypothetical protein MTR_2g030400 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356533083|ref|XP_003535098.1| PREDICTED: probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
TAIR|locus:2133134347 AT4G20930 [Arabidopsis thalian 1.0 0.786 0.765 1.1e-112
UNIPROTKB|Q5ZLI9333 HIBADH "Uncharacterized protei 0.919 0.753 0.536 7.2e-68
UNIPROTKB|F1PYB6336 HIBADH "Uncharacterized protei 0.919 0.747 0.517 6e-64
MGI|MGI:1889802335 Hibadh "3-hydroxyisobutyrate d 0.923 0.752 0.515 7.6e-64
UNIPROTKB|Q2HJD7336 HIBADH "3-hydroxyisobutyrate d 0.919 0.747 0.517 1.2e-63
UNIPROTKB|P31937336 HIBADH "3-hydroxyisobutyrate d 0.919 0.747 0.513 3.3e-63
UNIPROTKB|Q5R5E7336 HIBADH "3-hydroxyisobutyrate d 0.919 0.747 0.513 3.3e-63
RGD|708399335 Hibadh "3-hydroxyisobutyrate d 0.923 0.752 0.507 5.4e-63
ZFIN|ZDB-GENE-040801-264328 hibadha "3-hydroxyisobutyrate 0.912 0.759 0.509 8.8e-63
ZFIN|ZDB-GENE-040426-1582329 hibadhb "3-hydroxyisobutyrate 0.912 0.756 0.509 1.1e-62
TAIR|locus:2133134 AT4G20930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1112 (396.5 bits), Expect = 1.1e-112, P = 1.1e-112
 Identities = 209/273 (76%), Positives = 242/273 (88%)

Query:     1 MFSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSST 60
             MF++MGV ++ETP+EVA+ S+VVITMLPSSSHV+DVY G NGLL G N +RP L IDSST
Sbjct:    75 MFTEMGVSSRETPYEVAQDSEVVITMLPSSSHVMDVYTGTNGLLLGENDIRPALFIDSST 134

Query:    61 IDPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQA 120
             IDPQT+R IS AVSNC LKEK+D+WE PVMLDAPVSGGVLAAEAGTLTFMVGG EDAY A
Sbjct:   135 IDPQTTRKISLAVSNCNLKEKRDNWEKPVMLDAPVSGGVLAAEAGTLTFMVGGPEDAYLA 194

Query:   121 AKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKIL 180
             A+P+  SMG+ +IYCGG+GNG+AAKICNNL MAVSMLG SEAL LGQSLGISASTLT++L
Sbjct:   195 ARPILQSMGRTSIYCGGSGNGSAAKICNNLAMAVSMLGTSEALALGQSLGISASTLTEVL 254

Query:   181 NSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTS 240
             N+SS RCWSSD+YNPVPGVM+GVP+SR+Y GGFASKLMAKDLNLA ASA+EVG   PL S
Sbjct:   255 NTSSGRCWSSDAYNPVPGVMKGVPSSRDYNGGFASKLMAKDLNLAAASAEEVGHKSPLIS 314

Query:   241 QAQDIYAKLCENGHDSKDFSCVFQHYYGGKDEV 273
             +AQ+IY K+CE GH++KDFSCVF+H+Y GKDEV
Sbjct:   315 KAQEIYKKMCEEGHETKDFSCVFRHFYNGKDEV 347
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004616 "phosphogluconate dehydrogenase (decarboxylating) activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0006098 "pentose-phosphate shunt" evidence=IEA
GO:0006573 "valine metabolic process" evidence=IEA
GO:0008442 "3-hydroxyisobutyrate dehydrogenase activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|Q5ZLI9 HIBADH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYB6 HIBADH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1889802 Hibadh "3-hydroxyisobutyrate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJD7 HIBADH "3-hydroxyisobutyrate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P31937 HIBADH "3-hydroxyisobutyrate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R5E7 HIBADH "3-hydroxyisobutyrate dehydrogenase, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|708399 Hibadh "3-hydroxyisobutyrate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-264 hibadha "3-hydroxyisobutyrate dehydrogenase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1582 hibadhb "3-hydroxyisobutyrate dehydrogenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P28811MMSB_PSEAE1, ., 1, ., 1, ., 3, 10.40.93400.8557yesno
Q5R5E73HIDH_PONAB1, ., 1, ., 1, ., 3, 10.51130.92300.75yesno
P63935MMSB_MYCTU1, ., 1, ., 1, ., 3, 10.40300.89370.8299yesno
P63936MMSB_MYCBO1, ., 1, ., 1, ., 3, 10.40300.89370.8299yesno
Q9SUC03HIDH_ARATH1, ., 1, ., 1, ., 3, 10.76551.00.7867yesno
P292663HIDH_RAT1, ., 1, ., 1, ., 3, 10.50750.92300.7522yesno
P319373HIDH_HUMAN1, ., 1, ., 1, ., 3, 10.51130.92300.75yesno
O34948YKWC_BACSU1, ., 1, ., -, ., -0.33330.88640.8402yesno
Q99L133HIDH_MOUSE1, ., 1, ., 1, ., 3, 10.51510.92300.7522yesno
Q2HJD73HIDH_BOVIN1, ., 1, ., 1, ., 3, 10.51510.92300.75yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 4e-98
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 4e-80
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; 5e-48
TIGR01505291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona 4e-45
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 1e-38
PRK15059292 PRK15059, PRK15059, tartronate semialdehyde reduct 3e-33
PRK15461296 PRK15461, PRK15461, NADH-dependent gamma-hydroxybu 2e-26
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 1e-19
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 7e-16
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 8e-08
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 9e-07
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogena 1e-05
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 4e-04
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information 
 Score =  288 bits (739), Expect = 4e-98
 Identities = 123/265 (46%), Positives = 161/265 (60%), Gaps = 12/265 (4%)

Query: 2   FSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTI 61
               G     +P E AE +D VITMLP+  HV+ VY+G  G+L      +  LLID STI
Sbjct: 35  AVAAGAQAAASPAEAAEGADRVITMLPAGQHVISVYSGDEGILP--KVAKGSLLIDCSTI 92

Query: 62  DPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAA 121
           DP ++R ++   +              V +DAPVSGGV  A AGTLTFMVGG  + + AA
Sbjct: 93  DPDSARKLAELAAA----------HGAVFMDAPVSGGVGGARAGTLTFMVGGVAEEFAAA 142

Query: 122 KPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILN 181
           +P+   MG+N ++CG  G G AAKICNN+ + +SM+G +EA+ LG+ LG+    L +I N
Sbjct: 143 EPVLGPMGRNIVHCGDHGAGQAAKICNNMLLGISMIGTAEAMALGEKLGLDPKVLFEIAN 202

Query: 182 SSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQ 241
           +SS RCWSSD+YNPVPGVM   PAS  Y GGF + LM KDL LA  +AK  G   PL + 
Sbjct: 203 TSSGRCWSSDTYNPVPGVMPQAPASNGYQGGFGTALMLKDLGLAQDAAKSAGAPTPLGAL 262

Query: 242 AQDIYAKLCENGHDSKDFSCVFQHY 266
           A+ +Y+   + GH  KDFS V Q  
Sbjct: 263 ARQLYSLFDDKGHGGKDFSSVIQLL 287

3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators. 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterized 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate. HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase above trusted (pfam03446) [Energy metabolism, Amino acids and amines]. Length = 288
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 273
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
KOG0409327 consensus Predicted dehydrogenase [General functio 100.0
PRK15059292 tartronate semialdehyde reductase; Provisional 100.0
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 100.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 100.0
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 100.0
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 100.0
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 100.0
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.97
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.97
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.96
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.95
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.93
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 99.92
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.92
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.91
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.89
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.86
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.85
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.83
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.82
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.81
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.7
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.7
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.66
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.61
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.61
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.6
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.54
PLN02688266 pyrroline-5-carboxylate reductase 99.48
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.47
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.39
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.33
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.32
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.32
PRK08507275 prephenate dehydrogenase; Validated 99.29
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.26
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.1
PRK08655 437 prephenate dehydrogenase; Provisional 99.08
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.03
PRK07417279 arogenate dehydrogenase; Reviewed 98.98
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 98.96
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 98.82
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.79
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 98.76
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 98.66
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 98.6
PRK07502307 cyclohexadienyl dehydrogenase; Validated 98.51
PRK07680273 late competence protein ComER; Validated 98.51
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 98.5
PRK06545359 prephenate dehydrogenase; Validated 98.49
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 98.32
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 98.12
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.98
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.96
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 97.96
PRK12921305 2-dehydropantoate 2-reductase; Provisional 97.95
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 97.95
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.9
PLN02712667 arogenate dehydrogenase 97.89
PTZ00431260 pyrroline carboxylate reductase; Provisional 97.73
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.72
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.68
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 97.58
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.56
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 97.55
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 97.44
PF00393 291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 97.44
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 97.35
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 97.27
PLN02256304 arogenate dehydrogenase 97.24
PRK09287459 6-phosphogluconate dehydrogenase; Validated 97.11
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.09
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.08
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 97.04
PRK05479330 ketol-acid reductoisomerase; Provisional 97.03
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 97.02
PRK08818370 prephenate dehydrogenase; Provisional 96.86
PRK06249313 2-dehydropantoate 2-reductase; Provisional 96.73
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 96.72
PLN02712 667 arogenate dehydrogenase 96.7
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.66
PRK06436303 glycerate dehydrogenase; Provisional 96.5
PRK07574385 formate dehydrogenase; Provisional 96.47
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 96.47
PLN03139386 formate dehydrogenase; Provisional 96.43
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.43
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.26
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.18
PRK08605332 D-lactate dehydrogenase; Validated 96.06
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 95.88
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.78
PRK13243333 glyoxylate reductase; Reviewed 95.76
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 94.82
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 94.37
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 94.23
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 94.07
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 94.06
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.04
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 93.97
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 93.78
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 93.76
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 93.61
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 93.48
PRK12480330 D-lactate dehydrogenase; Provisional 93.33
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.1
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 92.59
PRK13403335 ketol-acid reductoisomerase; Provisional 92.27
PRK11154708 fadJ multifunctional fatty acid oxidation complex 92.15
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 91.72
PRK11730715 fadB multifunctional fatty acid oxidation complex 91.7
PRK06141314 ornithine cyclodeaminase; Validated 91.2
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.74
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 90.26
PLN02928347 oxidoreductase family protein 90.08
PRK13302271 putative L-aspartate dehydrogenase; Provisional 89.91
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 89.89
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 89.72
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 89.09
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 89.08
PF10728132 DUF2520: Domain of unknown function (DUF2520); Int 88.86
PRK06444197 prephenate dehydrogenase; Provisional 88.85
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 88.46
PF00393291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 88.23
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 87.84
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 87.78
PRK13304265 L-aspartate dehydrogenase; Reviewed 87.47
PRK06932314 glycerate dehydrogenase; Provisional 86.76
COG4408431 Uncharacterized protein conserved in bacteria [Fun 86.69
PF10100429 DUF2338: Uncharacterized protein conserved in bact 86.24
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 85.85
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 85.42
PLN02306386 hydroxypyruvate reductase 85.08
PRK06487317 glycerate dehydrogenase; Provisional 84.65
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 84.13
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 83.72
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 83.27
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 82.52
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 81.02
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 80.02
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-60  Score=414.59  Aligned_cols=247  Identities=41%  Similarity=0.655  Sum_probs=235.6

Q ss_pred             cccCCCCCCCCHHHHHhcCCEEEEeCCChHHHHHHHcCCCCcccCCCCCCCeEEEEcCCCCHHHHHHHHHHHhhchhhhc
Q 024066            2 FSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEK   81 (273)
Q Consensus         2 l~~~Ga~~~~s~~e~~~~advvi~~v~~~~av~~v~~~~~g~l~~~~~~~g~iiid~ST~~P~~~~~l~~~~~~~g~~~~   81 (273)
                      +.+.|++.+.||+|+++.+|+||+||+++++|++|+++++|+++++  ++|++||||||++|++++++++.++++     
T Consensus        40 ~~~~Ga~~a~s~~eaa~~aDvVitmv~~~~~V~~V~~g~~g~~~~~--~~G~i~IDmSTisp~~a~~~a~~~~~~-----  112 (286)
T COG2084          40 LAAAGATVAASPAEAAAEADVVITMLPDDAAVRAVLFGENGLLEGL--KPGAIVIDMSTISPETARELAAALAAK-----  112 (286)
T ss_pred             HHHcCCcccCCHHHHHHhCCEEEEecCCHHHHHHHHhCccchhhcC--CCCCEEEECCCCCHHHHHHHHHHHHhc-----
Confidence            3567999999999999999999999999999999999999999885  577999999999999999999999874     


Q ss_pred             cCCCCCceEEEecCCCCHHHHhcCceEEEeecCHHHHHHHHHHHHHhcCCeEEeCCcChHHHHHHHHHHHHHHHHHHHHH
Q 024066           82 KDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSE  161 (273)
Q Consensus        82 ~g~~~g~~~ldapv~G~~~~a~~g~l~~~vgG~~~~~~~~~~~l~~~~~~i~~~G~~g~a~~~Kl~~n~~~~~~~~~~~E  161 (273)
                           |.+|+|+||+||+..+++|+|++|+||+++.|++++|+|+.++++++|+|+.|+|+.+||+||++..+++++++|
T Consensus       113 -----G~~~lDAPVsGg~~~A~~GtLtimvGG~~~~f~r~~pvl~~~g~~i~~~G~~G~G~~~Kl~nn~l~~~~~~a~aE  187 (286)
T COG2084         113 -----GLEFLDAPVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLEAMGKNIVHVGPVGAGQAAKLANNILLAGNIAALAE  187 (286)
T ss_pred             -----CCcEEecCccCCchhhhhCceEEEeCCCHHHHHHHHHHHHHhcCceEEECCCCchHHHHHHHHHHHHHHHHHHHH
Confidence                 389999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCHHHHHHHHhhcCCcccccccCCCCCCcccCCCCCCCCCCCcchhhHHHHHHHHHHHHHHhCCCChHHHH
Q 024066          162 ALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQ  241 (273)
Q Consensus       162 a~~la~~~Gl~~~~~~~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~KD~~~~~~~a~~~g~~~~~~~~  241 (273)
                      ++.++++.|+|++.+.+++++++++||+++.+.+       ++.+++|+|+|+++++.||++++++++++.|+++|+...
T Consensus       188 Al~la~k~Gld~~~~~~vi~~~~~~s~~~e~~~~-------~m~~~~~~p~F~v~~~~KDl~la~~~A~~~g~~lP~~~~  260 (286)
T COG2084         188 ALALAEKAGLDPDVVLEVISGGAAGSWILENYGP-------RMLEGDFSPGFAVDLMLKDLGLALDAAKELGAPLPLTAL  260 (286)
T ss_pred             HHHHHHHcCCCHHHHHHHHhccccCChHHHhhcc-------hhhcCCCCcchhHHHHHHHHHHHHHHHHhcCCCCcHHHH
Confidence            9999999999999999999999999999987753       466889999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCcHHHHHHHHh
Q 024066          242 AQDIYAKLCENGHDSKDFSCVFQHYY  267 (273)
Q Consensus       242 ~~~~~~~a~~~G~g~~d~sai~~~~~  267 (273)
                      +.++|+.+.+.|+|++|++++++.++
T Consensus       261 ~~~ly~~~~~~G~g~~D~sal~~~l~  286 (286)
T COG2084         261 AAELYAKAAAAGGGEEDFSALIKLLE  286 (286)
T ss_pred             HHHHHHHHHhcCCCccChHHHHHHhC
Confidence            99999999999999999999999764

>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PF10728 DUF2520: Domain of unknown function (DUF2520); InterPro: IPR018931 This presumed domain is found C-terminal to a Rossmann-like domain suggesting that these proteins are oxidoreductases Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
2i9p_A319 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 2e-68
2gf2_A296 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 3e-68
3obb_A300 Crystal Structure Of A Possible 3-Hydroxyisobutyrat 3e-38
3q3c_A299 Crystal Structure Of A Serine Dehydrogenase From Ps 4e-38
3cky_A301 Structural And Kinetic Properties Of A Beta-Hydroxy 1e-33
1yb4_A295 Crystal Structure Of The Tartronic Semialdehyde Red 8e-27
3pef_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 1e-26
1vpd_A299 X-Ray Crystal Structure Of Tartronate Semialdehyde 4e-25
1wp4_A289 Structure Of Tt368 Protein From Thermus Thermophilu 1e-23
3pdu_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 1e-22
2cvz_A289 Structure Of Hydroxyisobutyrate Dehydrogenase From 2e-22
2uyy_A316 Structure Of The Cytokine-Like Nuclear Factor N-Pac 3e-20
3doj_A310 Structure Of Glyoxylate Reductase 1 From Arabidopsi 1e-18
4dll_A320 Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Re 3e-14
3g0o_A303 Crystal Structure Of 3-Hydroxyisobutyrate Dehydroge 4e-10
3qha_A296 Crystal Structure Of A Putative Oxidoreductase From 5e-09
>pdb|2I9P|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Complexed With Nad+ Length = 319 Back     alignment and structure 
Iteration: 1

 Score =  255 bits (651), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 170/264 (64%), Gaps = 12/264 (4%)
Query: 2   FSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTI 61
           F D G     +P +VAE +D +ITMLP+S + ++ Y+G NG+L+     +  LLIDSSTI
Sbjct: 61  FQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILK--KVKKGSLLIDSSTI 118
Query: 62  DPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAA 121
           DP  S+ ++  V      EK  +    V +DAPVSGGV AA +G LTFMVGG ED + AA
Sbjct: 119 DPAVSKELAKEV------EKMGA----VFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAA 168
Query: 122 KPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILN 181
           + L   MG N +YCG  G G AAKICNN+ +A+SM+G +EA+ LG  LG+    L KILN
Sbjct: 169 QELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILN 228
Query: 182 SSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQ 241
            SS RCWSSD+YNPVPGVM+GVP++ NY GGF + LMAKDL LA  SA        L S 
Sbjct: 229 MSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSL 288
Query: 242 AQDIYAKLCENGHDSKDFSCVFQH 265
           A  IY  +C  G+  KDFS VFQ 
Sbjct: 289 AHQIYRMMCAKGYSKKDFSSVFQF 312
>pdb|2GF2|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Length = 296 Back     alignment and structure
>pdb|3OBB|A Chain A, Crystal Structure Of A Possible 3-Hydroxyisobutyrate Dehydrogenase From Pseudomonas Aeruginosa Pao1 Length = 300 Back     alignment and structure
>pdb|3Q3C|A Chain A, Crystal Structure Of A Serine Dehydrogenase From Pseudomonas Aeruginosa Pao1 In Complex With Nad Length = 299 Back     alignment and structure
>pdb|3CKY|A Chain A, Structural And Kinetic Properties Of A Beta-Hydroxyacid Dehydrogenase Involved In Nicotinate Fermentation Length = 301 Back     alignment and structure
>pdb|1YB4|A Chain A, Crystal Structure Of The Tartronic Semialdehyde Reductase From Salmonella Typhimurium Lt2 Length = 295 Back     alignment and structure
>pdb|3PEF|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Metallireducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|1VPD|A Chain A, X-Ray Crystal Structure Of Tartronate Semialdehyde Reductase [salmonella Typhimurium Lt2] Length = 299 Back     alignment and structure
>pdb|1WP4|A Chain A, Structure Of Tt368 Protein From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|3PDU|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Sulfurreducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|2CVZ|A Chain A, Structure Of Hydroxyisobutyrate Dehydrogenase From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|2UYY|A Chain A, Structure Of The Cytokine-Like Nuclear Factor N-Pac Length = 316 Back     alignment and structure
>pdb|3DOJ|A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Back     alignment and structure
>pdb|4DLL|A Chain A, Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Reductase From Polaromonas Sp. Js666 Length = 320 Back     alignment and structure
>pdb|3G0O|A Chain A, Crystal Structure Of 3-Hydroxyisobutyrate Dehydrogenase (Ygbj) From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|3QHA|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Mycobacterium Avium 104 Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 1e-122
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 1e-119
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 1e-102
3qha_A296 Putative oxidoreductase; seattle structural genomi 3e-97
1vpd_A299 Tartronate semialdehyde reductase; structural geno 6e-91
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 4e-90
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 8e-90
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 4e-88
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 2e-87
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 1e-81
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 2e-81
1yb4_A295 Tartronic semialdehyde reductase; structural genom 4e-80
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 5e-71
3l6d_A306 Putative oxidoreductase; structural genomics, prot 8e-67
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 8e-45
4ezb_A317 Uncharacterized conserved protein; structural geno 2e-39
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 2e-30
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 3e-05
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 2e-04
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 7e-04
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
 Score =  348 bits (895), Expect = e-122
 Identities = 132/269 (49%), Positives = 170/269 (63%), Gaps = 12/269 (4%)

Query: 2   FSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTI 61
           F D G     +P +VAE +D +ITMLP+S + ++ Y+G NG+L+     +  LLIDSSTI
Sbjct: 39  FQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVK--KGSLLIDSSTI 96

Query: 62  DPQTSRNISAAVSNCILKEKKDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAA 121
           DP  S+ ++       +++        V +DAPVSGGV AA +G LTFMVGG ED + AA
Sbjct: 97  DPAVSKELAKE-----VEKM-----GAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAA 146

Query: 122 KPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILN 181
           + L   MG N +YCG  G G AAKICNN+ +A+SM+G +EA+ LG  LG+    L KILN
Sbjct: 147 QELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILN 206

Query: 182 SSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQ 241
            SS RCWSSD+YNPVPGVM+GVP++ NY GGF + LMAKDL LA  SA        L S 
Sbjct: 207 MSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSL 266

Query: 242 AQDIYAKLCENGHDSKDFSCVFQHYYGGK 270
           A  IY  +C  G+  KDFS VFQ     +
Sbjct: 267 AHQIYRMMCAKGYSKKDFSSVFQFLREEE 295
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Length = 317 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Length = 201 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 100.0
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 100.0
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 100.0
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 100.0
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 100.0
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 100.0
3l6d_A306 Putative oxidoreductase; structural genomics, prot 100.0
3qha_A296 Putative oxidoreductase; seattle structural genomi 100.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 100.0
1vpd_A299 Tartronate semialdehyde reductase; structural geno 100.0
4ezb_A317 Uncharacterized conserved protein; structural geno 100.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 100.0
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 100.0
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 100.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 100.0
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 100.0
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 100.0
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.97
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.96
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.95
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.95
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.95
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.94
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.94
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.93
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.93
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 99.92
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.92
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.92
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.91
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.9
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.9
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.87
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.86
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.75
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.67
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.66
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.62
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.59
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.59
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.58
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.56
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.53
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.52
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.51
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.46
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.44
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.44
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.43
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.43
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.41
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.41
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.39
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.2
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.2
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.19
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.14
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.07
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 98.64
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.05
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.04
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 98.98
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.97
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.97
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 98.9
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 98.9
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 98.89
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 98.86
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 98.81
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 98.78
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 98.74
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 98.69
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 98.65
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.64
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.48
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 98.41
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 98.17
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 98.1
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 98.06
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 97.9
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 97.89
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 97.72
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.6
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 97.53
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 97.51
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 97.43
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.03
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.01
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 96.98
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.61
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.43
2duw_A145 Putative COA-binding protein; ligand binding prote 96.41
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 96.4
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 96.39
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.26
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.25
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 96.24
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.22
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.22
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 96.17
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 96.17
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.01
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 95.99
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 95.95
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.95
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 95.88
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 95.87
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.84
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 95.82
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 95.76
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 95.74
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 95.64
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 95.58
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 95.57
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 95.56
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 95.54
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 95.44
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 95.3
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 95.28
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 95.18
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 95.11
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.03
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 95.03
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 94.96
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 94.94
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 94.92
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 94.72
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 94.59
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 94.14
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.89
2rir_A300 Dipicolinate synthase, A chain; structural genomic 92.52
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 92.48
3euw_A344 MYO-inositol dehydrogenase; protein structure init 92.1
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 91.71
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 91.6
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 91.38
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 91.37
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 91.34
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 91.19
1iuk_A140 Hypothetical protein TT1466; structural genomics, 90.81
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 90.58
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 90.47
2d59_A144 Hypothetical protein PH1109; COA binding, structur 90.45
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 90.38
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 90.21
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 89.81
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 89.77
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 89.71
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 89.16
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 89.14
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 89.08
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 89.03
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 88.87
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 88.77
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 88.54
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 87.81
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 87.7
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 87.36
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 86.96
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 86.41
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 86.38
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 85.81
1ydw_A362 AX110P-like protein; structural genomics, protein 85.63
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 85.6
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 85.6
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 85.51
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 84.9
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 84.87
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 84.36
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 83.87
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 83.26
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 83.08
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 82.07
3btv_A438 Galactose/lactose metabolism regulatory protein GA 82.03
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 81.57
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 81.33
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 80.38
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
Probab=100.00  E-value=4.8e-59  Score=413.22  Aligned_cols=257  Identities=43%  Similarity=0.696  Sum_probs=243.6

Q ss_pred             cccCCCCCCCCHHHHHhcCCEEEEeCCChHHHHHHHcCCCCcccCCCCCCCeEEEEcCCCCHHHHHHHHHHHhhchhhhc
Q 024066            2 FSDMGVPTKETPFEVAEASDVVITMLPSSSHVLDVYNGPNGLLQGGNSVRPQLLIDSSTIDPQTSRNISAAVSNCILKEK   81 (273)
Q Consensus         2 l~~~Ga~~~~s~~e~~~~advvi~~v~~~~av~~v~~~~~g~l~~~~~~~g~iiid~ST~~P~~~~~l~~~~~~~g~~~~   81 (273)
                      |++.|+++++||+|++++||+||+|||+++++++|+++.+|+++++  .+|++|||+||++|+++++++++++++     
T Consensus        42 l~~~Ga~~a~s~~e~~~~~dvv~~~l~~~~~v~~V~~~~~g~~~~~--~~g~iiId~sT~~p~~~~~~a~~~~~~-----  114 (300)
T 3obb_A           42 LVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDDGLLAHI--APGTLVLECSTIAPTSARKIHAAARER-----  114 (300)
T ss_dssp             HHHTTCEECSSHHHHHTTCSEEEECCSCHHHHHHHHHSSSSSTTSC--CC-CEEEECSCCCHHHHHHHHHHHHTT-----
T ss_pred             HHHcCCEEcCCHHHHHhcCCceeecCCchHHHHHHHhchhhhhhcC--CCCCEEEECCCCCHHHHHHHHHHHHHc-----
Confidence            5678999999999999999999999999999999999999999875  567999999999999999999999874     


Q ss_pred             cCCCCCceEEEecCCCCHHHHhcCceEEEeecCHHHHHHHHHHHHHhcCCeEEeCCcChHHHHHHHHHHHHHHHHHHHHH
Q 024066           82 KDSWENPVMLDAPVSGGVLAAEAGTLTFMVGGSEDAYQAAKPLFLSMGKNTIYCGGAGNGAAAKICNNLTMAVSMLGVSE  161 (273)
Q Consensus        82 ~g~~~g~~~ldapv~G~~~~a~~g~l~~~vgG~~~~~~~~~~~l~~~~~~i~~~G~~g~a~~~Kl~~n~~~~~~~~~~~E  161 (273)
                           |+.|+||||+|++.+|++|+|++|+||++++|++++|+|+.|+++++|+|++|+|+.+||+||++.++++++++|
T Consensus       115 -----G~~~lDaPVsGg~~~A~~G~L~imvGG~~~~~~~~~p~l~~~g~~i~~~G~~G~g~~~Kl~~N~l~~~~~~a~aE  189 (300)
T 3obb_A          115 -----GLAMLDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNIFHAGPDGAGQVAKVCNNQLLAVLMIGTAE  189 (300)
T ss_dssp             -----TCEEEECCEESCHHHHHHTCEEEEEESCHHHHHHHHHHHHHHEEEEEEEESTTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             -----CCEEEecCCCCCHHHHHhCCEEEEEeCCHHHHHHHHHHHHHhCCCEEEeCCccHHHHHHHHHHHHHHHHHHHHHH
Confidence                 389999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCCCHHHHHHHHhhcCCcccccccCCCCCCcccCCCCCCCCCCCcchhhHHHHHHHHHHHHHHhCCCChHHHH
Q 024066          162 ALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQ  241 (273)
Q Consensus       162 a~~la~~~Gl~~~~~~~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~KD~~~~~~~a~~~g~~~~~~~~  241 (273)
                      ++.++++.|+|++.++++++.+++.||.++.+.|.+......+..++|+++|+++++.||++++++++++.|+|+|+++.
T Consensus       190 a~~la~~~Gld~~~~~~vl~~~~~~s~~~~~~~p~~~~~~~~~~~~~~~~~f~~~l~~KDl~l~~~~A~~~g~~~p~~~~  269 (300)
T 3obb_A          190 AMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGGFMAQLMAKDLGLAQEAAQASASSTPMGSL  269 (300)
T ss_dssp             HHHHHHHTTCCHHHHHHHHHTSTTCCHHHHHCCCSTTTSTTSGGGGTTCSSSBHHHHHHHHHHHHHHHHHHTCCCHHHHH
T ss_pred             HHHHHHhcCCCHHHHHHHHHhCcccchHHHhhccccchhhhccccccCCccchHHHHHHHHHHHHHHHHHcCCCChHHHH
Confidence            99999999999999999999999999999888887777666677899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCcHHHHHHHHhcCC
Q 024066          242 AQDIYAKLCENGHDSKDFSCVFQHYYGGK  270 (273)
Q Consensus       242 ~~~~~~~a~~~G~g~~d~sai~~~~~~~~  270 (273)
                      ++++|+++.++|+|++||++|+++|++..
T Consensus       270 a~~~~~~a~~~G~g~~D~sal~~~~e~~~  298 (300)
T 3obb_A          270 ALSLYRLLLKQGYAERDFSVVQKLFDPTQ  298 (300)
T ss_dssp             HHHHHHHHHHTTCTTSBGGGGHHHHCTTC
T ss_pred             HHHHHHHHHhCCCCCcCHHHHHHHHHHhc
Confidence            99999999999999999999999987643
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 273
d3cuma1134 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydroge 2e-33
d1vpda1133 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydroge 3e-26
d2cvza1132 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydroge 2e-25
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 1e-22
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 3e-17
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 2e-14
d2cvza2156 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase 3e-12
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 7e-09
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 2e-07
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 3e-07
d2pv7a2152 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA { 3e-06
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 2e-04
d2pgda2176 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase 0.004
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: Hydroxyisobutyrate dehydrogenase
species: Pseudomonas aeruginosa [TaxId: 287]

 Score =  116 bits (291), Expect = 2e-33
 Identities = 57/129 (44%), Positives = 80/129 (62%)

Query: 138 AGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVP 197
            G G  AK+CNN  +AV M+G +EA+ LG + G+ A  L +I+  SS   W+ + YNP P
Sbjct: 2   DGAGQVAKVCNNQLLAVLMIGTAEAMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWP 61

Query: 198 GVMEGVPASRNYGGGFASKLMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSK 257
           GVME  PASR+Y GGF ++LMAKDL LA  +A+      P+ S A  +Y  L + G+  +
Sbjct: 62  GVMENAPASRDYSGGFMAQLMAKDLGLAQEAAQASASSTPMGSLALSLYRLLLKQGYAER 121

Query: 258 DFSCVFQHY 266
           DFS V + +
Sbjct: 122 DFSVVQKLF 130
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 133 Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Length = 152 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 176 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.96
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.95
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.94
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.94
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.92
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.87
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.82
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.71
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.64
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.53
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.21
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.86
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 98.76
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.68
d1dlja198 UDP-glucose dehydrogenase (UDPGDH), middle domain 98.54
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 98.25
d1i36a1112 Conserved hypothetical protein MTH1747 {Archaeon M 98.25
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.85
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.8
d2pgda1 297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 97.6
d1pgja1 300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 97.55
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.98
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 95.32
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 94.24
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 92.96
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.48
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 88.39
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 88.22
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 87.9
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 87.78
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 86.82
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 85.52
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 84.73
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 84.7
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 83.22
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 81.72
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 80.97
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: Hydroxyisobutyrate dehydrogenase
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.96  E-value=1.1e-28  Score=191.48  Aligned_cols=133  Identities=43%  Similarity=0.710  Sum_probs=124.5

Q ss_pred             CcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhhcCCcccccccCCCCCCcccCCCCCCCCCCCcchh
Q 024066          137 GAGNGAAAKICNNLTMAVSMLGVSEALTLGQSLGISASTLTKILNSSSARCWSSDSYNPVPGVMEGVPASRNYGGGFASK  216 (273)
Q Consensus       137 ~~g~a~~~Kl~~n~~~~~~~~~~~Ea~~la~~~Gl~~~~~~~~l~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~f~~~  216 (273)
                      |.|+|+.+|++||++.++++++++|++.++++.|||++.++++++.++++||+++.+.++...+...+..++|+++|+++
T Consensus         1 P~GsG~~~Kl~~N~l~~~~~~a~aEal~la~~~Gld~~~~~eil~~~~g~s~~~~~~~~~~~~~~~~~~~~~~~~~f~~~   80 (134)
T d3cuma1           1 PDGAGQVAKVCNNQLLAVLMIGTAEAMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGGFMAQ   80 (134)
T ss_dssp             STTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHTSTTCCHHHHHCCCSTTSSTTSGGGGTTCSSSBHH
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHHHhcccchhhhhhhhhhhhccchhhhcCCCCCCcchH
Confidence            57999999999999999999999999999999999999999999999999999887766555555567789999999999


Q ss_pred             hHHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHHHCCCCCCcHHHHHHHHhcC
Q 024066          217 LMAKDLNLALASAKEVGVDCPLTSQAQDIYAKLCENGHDSKDFSCVFQHYYGG  269 (273)
Q Consensus       217 ~~~KD~~~~~~~a~~~g~~~~~~~~~~~~~~~a~~~G~g~~d~sai~~~~~~~  269 (273)
                      ++.||++++++++++.|+|+|+++.++++|+.+.+.|+|++|+++|++.|++.
T Consensus        81 l~~KDl~l~~~~a~~~g~~~p~~~~a~~~~~~a~~~G~g~~D~s~i~~~~e~~  133 (134)
T d3cuma1          81 LMAKDLGLAQEAAQASASSTPMGSLALSLYRLLLKQGYAERDFSVVQKLFDPT  133 (134)
T ss_dssp             HHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHTTCTTSBGGGGHHHHCTT
T ss_pred             HHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHcCCCCCCHHHHHHHHcCC
Confidence            99999999999999999999999999999999999999999999999999765
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i36a1 a.100.1.8 (A:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure