Citrus Sinensis ID: 024114
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| 297743970 | 221 | unnamed protein product [Vitis vinifera] | 0.716 | 0.882 | 0.577 | 5e-65 | |
| 225437543 | 220 | PREDICTED: uncharacterized protein LOC10 | 0.713 | 0.881 | 0.579 | 6e-65 | |
| 388517545 | 234 | unknown [Lotus japonicus] | 0.801 | 0.931 | 0.513 | 2e-59 | |
| 356534819 | 227 | PREDICTED: uncharacterized protein LOC10 | 0.808 | 0.969 | 0.509 | 9e-59 | |
| 356501871 | 220 | PREDICTED: uncharacterized protein LOC10 | 0.783 | 0.968 | 0.501 | 4e-55 | |
| 357511349 | 219 | E3 ubiquitin-protein ligase MARCH3 [Medi | 0.786 | 0.977 | 0.472 | 3e-54 | |
| 255548477 | 213 | protein binding protein, putative [Ricin | 0.724 | 0.924 | 0.536 | 4e-54 | |
| 388522949 | 215 | unknown [Medicago truncatula] | 0.772 | 0.976 | 0.476 | 2e-53 | |
| 217074272 | 196 | unknown [Medicago truncatula] | 0.702 | 0.974 | 0.491 | 3e-51 | |
| 357442271 | 234 | E3 ubiquitin-protein ligase MARCH6 [Medi | 0.794 | 0.923 | 0.529 | 8e-51 |
| >gi|297743970|emb|CBI36940.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 253 bits (647), Expect = 5e-65, Method: Compositional matrix adjust.
Identities = 138/239 (57%), Positives = 165/239 (69%), Gaps = 44/239 (18%)
Query: 1 MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEK 60
MGDVVLFV+DF+ N HCRICHE EFESC +LEAPCACSGTVKFAHRDCIQRWC EK
Sbjct: 1 MGDVVLFVDDFELN-SAVPHCRICHEAEFESCKTLEAPCACSGTVKFAHRDCIQRWCNEK 59
Query: 61 GNTTCEICLQEYGPGYTA--PSKKSQLIEAAVTIRDSLQIPRREHVPRNPRLVAIAERLS 118
GNTTCEICLQEY PGYTA P KK+QL++ AVTIR SL+IPRR +PR VA+A+
Sbjct: 60 GNTTCEICLQEYEPGYTAPPPPKKAQLVDVAVTIRGSLEIPRRRQELEDPRRVAMADG-- 117
Query: 119 AESHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVRICCLLA 178
P+C++AA R A+CCR +AL FTVLLLV+HLFAV+TG+T+DYPF L+T
Sbjct: 118 -----PECTAAADRGASCCRVVALIFTVLLLVRHLFAVVTGSTEDYPFTLLT-------- 164
Query: 179 RQQSLSSQVSVSFGFYVVLTLELFLQVLLLRACGIILPMYVLMRTITAIHNSIRREYHH 237
+L+LR GIILPMY+++RTI+AI NSIR Y+
Sbjct: 165 --------------------------LLILRTSGIILPMYIVIRTISAIQNSIREHYYQ 197
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225437543|ref|XP_002275880.1| PREDICTED: uncharacterized protein LOC100260678 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388517545|gb|AFK46834.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356534819|ref|XP_003535949.1| PREDICTED: uncharacterized protein LOC100776501 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356501871|ref|XP_003519747.1| PREDICTED: uncharacterized protein LOC100797029 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357511349|ref|XP_003625963.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula] gi|355500978|gb|AES82181.1| E3 ubiquitin-protein ligase MARCH3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255548477|ref|XP_002515295.1| protein binding protein, putative [Ricinus communis] gi|223545775|gb|EEF47279.1| protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388522949|gb|AFK49536.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217074272|gb|ACJ85496.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357442271|ref|XP_003591413.1| E3 ubiquitin-protein ligase MARCH6 [Medicago truncatula] gi|355480461|gb|AES61664.1| E3 ubiquitin-protein ligase MARCH6 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| TAIR|locus:505006426 | 218 | PIT1 "pitchoun 1" [Arabidopsis | 0.577 | 0.720 | 0.590 | 1.4e-50 | |
| TAIR|locus:504956090 | 259 | AT2G01275 [Arabidopsis thalian | 0.573 | 0.602 | 0.421 | 1.6e-32 | |
| TAIR|locus:2154109 | 307 | AT5G62460 [Arabidopsis thalian | 0.547 | 0.485 | 0.417 | 6.8e-30 | |
| TAIR|locus:2012477 | 265 | AT1G14260 [Arabidopsis thalian | 0.555 | 0.569 | 0.402 | 3.7e-29 | |
| TAIR|locus:2056710 | 275 | AT2G02960 [Arabidopsis thalian | 0.599 | 0.592 | 0.431 | 9.1e-29 | |
| TAIR|locus:2079112 | 288 | AT3G47550 [Arabidopsis thalian | 0.496 | 0.468 | 0.459 | 6.6e-28 | |
| TAIR|locus:2144441 | 259 | AT5G38070 [Arabidopsis thalian | 0.522 | 0.548 | 0.402 | 7.3e-27 | |
| UNIPROTKB|B7Z739 | 144 | MARCH1 "E3 ubiquitin-protein l | 0.209 | 0.395 | 0.379 | 6.7e-09 | |
| UNIPROTKB|D6REN1 | 141 | MARCH1 "E3 ubiquitin-protein l | 0.209 | 0.404 | 0.379 | 6.7e-09 | |
| TAIR|locus:2175158 | 494 | AT5G60580 [Arabidopsis thalian | 0.227 | 0.125 | 0.435 | 3.9e-08 |
| TAIR|locus:505006426 PIT1 "pitchoun 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 461 (167.3 bits), Expect = 1.4e-50, Sum P(2) = 1.4e-50
Identities = 101/171 (59%), Positives = 119/171 (69%)
Query: 1 MGDVVLFVEDFKSNPETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEK 60
MGDV+LF++D KS T CRICHEEE ES E PCACSGTVKFAHR+CIQRWC EK
Sbjct: 1 MGDVILFIDDTKSKVRIT-RCRICHEEEEESF--FEVPCACSGTVKFAHRNCIQRWCNEK 57
Query: 61 GNTTCEICLQEYGPGYTAPSKKSQLIEAAVTIRDSLQIPRREHVPRNPRLVAIAERLSAE 120
GNTTCEICLQ Y GYTA K+S+LIE VTIR + RR R+ RLV+IAE
Sbjct: 58 GNTTCEICLQVYKDGYTAVLKQSKLIEQEVTIRVN---GRRRR--RSRRLVSIAE----- 107
Query: 121 SHYPQCSSAAGRTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTV 171
S QC+S A R A+ CRSL T +V LL+KH F V+ G T++YPF++ TV
Sbjct: 108 SDISQCNSVADRGASFCRSLTFTLSVFLLMKHTFDVIYG-TEEYPFSVFTV 157
|
|
| TAIR|locus:504956090 AT2G01275 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154109 AT5G62460 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2012477 AT1G14260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056710 AT2G02960 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079112 AT3G47550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144441 AT5G38070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z739 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6REN1 MARCH1 "E3 ubiquitin-protein ligase MARCH1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| pfam12428 | 118 | pfam12428, DUF3675, Protein of unknown function (D | 1e-41 | |
| smart00744 | 49 | smart00744, RINGv, The RING-variant domain is a C4 | 3e-18 | |
| pfam12906 | 47 | pfam12906, RINGv, RING-variant domain | 4e-15 | |
| COG5183 | 1175 | COG5183, SSM4, Protein involved in mRNA turnover a | 9e-10 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 9e-05 | |
| PHA02825 | 162 | PHA02825, PHA02825, LAP/PHD finger-like protein; P | 1e-04 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 0.002 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 0.002 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 0.004 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.004 | |
| pfam04889 | 241 | pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont | 0.004 |
| >gnl|CDD|221572 pfam12428, DUF3675, Protein of unknown function (DUF3675) | Back alignment and domain information |
|---|
Score = 138 bits (351), Expect = 1e-41
Identities = 62/154 (40%), Positives = 81/154 (52%), Gaps = 38/154 (24%)
Query: 74 PGYTAPSKKSQLIEAAVTIRDSLQIPRREHVPRNPRLVAI--AERLSAESHYPQCSSAAG 131
PGYTAP K Q E A+TIR + +I RR+ R+PRL+A+ AER E+ Y + ++A
Sbjct: 1 PGYTAPPKLFQPGETAITIRGNWEISRRDL--RDPRLLAMAEAERQFLEAEYDEYAAANP 58
Query: 132 RTAACCRSLALTFTVLLLVKHLFAVLTGNTDDYPFALVTVRICCLLARQQSLSSQVSVSF 191
AACCRS+AL F VLLL++H V+ G DDY F L T
Sbjct: 59 SGAACCRSVALIFMVLLLLRHALPVVLGGADDYSFTLFT--------------------- 97
Query: 192 GFYVVLTLELFLQVLLLRACGIILPMYVLMRTIT 225
+LLLRA GI+LP Y++ R IT
Sbjct: 98 -------------LLLLRAAGILLPCYIMARAIT 118
|
This domain family is found in eukaryotes, and is approximately 120 amino acids in length. The family is found in association with pfam00097. There are two completely conserved residues (R and L) that may be functionally important. Length = 118 |
| >gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221845 pfam12906, RINGv, RING-variant domain | Back alignment and domain information |
|---|
| >gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
| >gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| PF12428 | 118 | DUF3675: Protein of unknown function (DUF3675) ; I | 100.0 | |
| KOG1609 | 323 | consensus Protein involved in mRNA turnover and st | 99.77 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 99.75 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 99.69 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 99.67 | |
| PHA02862 | 156 | 5L protein; Provisional | 99.62 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 99.48 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 99.42 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 97.88 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.57 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.93 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.92 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 96.69 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 96.65 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.58 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 96.56 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 96.43 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 96.18 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 96.16 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.15 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 95.91 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 95.74 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 95.28 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 95.18 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.84 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 94.04 | |
| PF06679 | 163 | DUF1180: Protein of unknown function (DUF1180); In | 93.78 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 93.4 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 93.33 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 93.25 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.79 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.15 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 89.36 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 89.11 | |
| PF09026 | 101 | CENP-B_dimeris: Centromere protein B dimerisation | 88.61 | |
| PF14851 | 153 | FAM176: FAM176 family | 87.89 | |
| PLN02189 | 1040 | cellulose synthase | 87.56 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 87.46 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 86.7 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 86.18 | |
| PLN02436 | 1094 | cellulose synthase A | 85.09 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 84.89 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 83.64 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 83.43 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 82.32 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 80.78 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 80.59 |
| >PF12428 DUF3675: Protein of unknown function (DUF3675) ; InterPro: IPR022143 This domain family is found in eukaryotes, and is approximately 120 amino acids in length | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-42 Score=284.25 Aligned_cols=116 Identities=53% Similarity=0.882 Sum_probs=110.5
Q ss_pred cCccCCCCCchhhhhhhcccccccccccCCCCCCchhHHHh--hhhccccCCCccccCCCcchhhHHHHHHHHHHHHHHH
Q 024114 74 PGYTAPSKKSQLIEAAVTIRDSLQIPRREHVPRNPRLVAIA--ERLSAESHYPQCSSAAGRTAACCRSLALTFTVLLLVK 151 (272)
Q Consensus 74 ~~yt~p~~~~~~~~~~i~ir~~~~i~r~~~~~~~~~~~a~~--e~~~~~~~y~e~~~~~~~~a~~CRsvAii~m~lLLLr 151 (272)
|+||+|||+.+.++++|+||+||+++|+ |++||+++||+ |+++++++|++|++++++|++||||+|||||+|||||
T Consensus 1 PgYTaPp~~~~~~~~~i~ir~~we~~~~--d~~~~~~~a~~~ae~~~l~~~y~e~~~~~~~~a~~CRsvAli~m~LLllR 78 (118)
T PF12428_consen 1 PGYTAPPKKFQPGETAIDIRGNWEISRR--DLRDPRFLAMAAAERQFLESEYDEYAASNTRGAACCRSVALIFMVLLLLR 78 (118)
T ss_pred CCCCCCCCCCCcCccceEecCCcccccc--CccchhhhhhhhhhhhccccccccccccCCCceeHHHHHHHHHHHHHHHH
Confidence 6899999999999999999999997655 58999999996 5799999999999999999999999999999999999
Q ss_pred HHHHHHhCCCCCCcchhhhhHHHhhhhhhcccccccccccchhhhHHHHHHHHHHHHHHhhhhHHHHHHHHHHH
Q 024114 152 HLFAVLTGNTDDYPFALVTVRICCLLARQQSLSSQVSVSFGFYVVLTLELFLQVLLLRACGIILPMYVLMRTIT 225 (272)
Q Consensus 152 hal~ii~~g~e~ysf~~~tvr~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~lra~gillP~Yi~~r~~~ 225 (272)
|+++++++|+++|||++|| +++|||+||+||||||+|+|+
T Consensus 79 hal~l~~~~~~~~s~~lft----------------------------------l~~LRaaGilLP~Yim~rais 118 (118)
T PF12428_consen 79 HALALVTGGAEDYSFTLFT----------------------------------LLLLRAAGILLPCYIMARAIS 118 (118)
T ss_pred HHHHHhcCCcccccHHHHH----------------------------------HHHHHHHHHHHHHHHHHhccC
Confidence 9999999999999999999 999999999999999999985
|
The family is found in association with PF00097 from PFAM. There are two completely conserved residues (R and L) that may be functionally important. |
| >KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF06679 DUF1180: Protein of unknown function (DUF1180); InterPro: IPR009565 This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box | Back alignment and domain information |
|---|
| >PF14851 FAM176: FAM176 family | Back alignment and domain information |
|---|
| >PLN02189 cellulose synthase | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN02436 cellulose synthase A | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 272 | ||||
| 2d8s_A | 80 | Solution Structure Of The Ring Domain Of The Human | 8e-05 |
| >pdb|2D8S|A Chain A, Solution Structure Of The Ring Domain Of The Human Cellular Modulator Of Immune Recognition Protein Length = 80 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 1e-18 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 4e-18 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 |
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
Score = 77.3 bits (190), Expect = 1e-18
Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)
Query: 15 PETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEY 72
P + CRICH E + + L PC C+G++ F H+ C+Q+W CE+C E+
Sbjct: 12 PSSQDICRICHCEG-DDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEF 68
|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 99.74 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.68 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.17 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.13 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.11 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.11 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.04 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.94 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.93 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 97.86 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.71 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.67 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.6 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.55 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.54 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.53 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.53 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.51 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.47 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.46 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 97.43 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.42 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 97.41 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.39 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.36 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.27 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 97.21 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 97.2 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.16 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.14 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 97.11 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 96.98 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 96.9 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 96.85 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 96.81 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 96.79 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 96.72 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 96.67 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 96.66 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 96.64 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 96.57 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 96.56 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 96.49 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 96.28 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.24 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 96.15 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 96.07 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 95.99 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 95.68 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 95.55 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 94.74 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 94.71 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 94.66 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 94.38 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 94.21 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 94.15 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 93.6 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 93.45 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 92.82 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 92.67 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 92.26 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 92.22 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 91.83 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 91.45 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 91.33 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 90.73 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 89.64 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 86.94 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 83.56 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 80.98 |
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
Probab=99.74 E-value=6.1e-19 Score=128.04 Aligned_cols=56 Identities=36% Similarity=0.748 Sum_probs=50.4
Q ss_pred CCCCceeEeccCcccCCCccccccccCCCcceecHHHHHHHHHhhCCcccccccccccc
Q 024114 16 ETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGP 74 (272)
Q Consensus 16 e~~~~CRIC~eeeees~~~Li~PC~C~GSlkyVH~~CL~rWl~~kg~~~CEICk~~Y~~ 74 (272)
++...||||+++.. ++++.||+|+||+||||+.||++|++++++.+||+|+++|++
T Consensus 4 ~~~~~CrIC~~~~~---~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~ 59 (60)
T 1vyx_A 4 EDVPVCWICNEELG---NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT 59 (60)
T ss_dssp CSCCEETTTTEECS---CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred CCCCEeEEeecCCC---CceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence 46789999998743 358999999999999999999999999999999999999974
|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 272 | ||||
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 2e-06 |
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: Variant RING domain domain: IE1B protein (ORF K3), N-terminal domain species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]
Score = 41.8 bits (97), Expect = 2e-06
Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%)
Query: 16 ETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEY 72
E C IC+EE C C+G ++ HR C+ W NT C+IC Y
Sbjct: 4 EDVPVCWICNEELGNERFR---ACGCTGELENVHRSCLSTWLTISRNTACQICGVVY 57
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.51 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.03 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.0 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 97.97 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 97.83 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.75 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.64 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.53 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.94 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 96.78 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 96.47 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 96.07 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 95.3 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 94.29 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 93.49 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 92.07 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 86.23 |
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: Variant RING domain domain: IE1B protein (ORF K3), N-terminal domain species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]
Probab=99.51 E-value=3.1e-15 Score=105.59 Aligned_cols=57 Identities=35% Similarity=0.731 Sum_probs=50.9
Q ss_pred CCCCCceeEeccCcccCCCccccccccCCCcceecHHHHHHHHHhhCCcccccccccccc
Q 024114 15 PETTSHCRICHEEEFESCNSLEAPCACSGTVKFAHRDCIQRWCYEKGNTTCEICLQEYGP 74 (272)
Q Consensus 15 se~~~~CRIC~eeeees~~~Li~PC~C~GSlkyVH~~CL~rWl~~kg~~~CEICk~~Y~~ 74 (272)
.++..+|+||+++.. ++++.||.|+|+.+++|+.||++|+..+++.+||+|+++|++
T Consensus 3 ded~~~C~IC~~~~~---~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~ 59 (60)
T d1vyxa_ 3 DEDVPVCWICNEELG---NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT 59 (60)
T ss_dssp TCSCCEETTTTEECS---CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred CCCCCCCccCCccCC---CceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence 357789999998653 458899999999999999999999999999999999999975
|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|