Citrus Sinensis ID: 024121


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MDAFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIHELEKSGFRGILMNAVVAAAKRSRELS
cccccccccccEEEEEcccHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHcccEEEccHHHHHccccEEEEEEccccHHHHHHHHccccccccEEEEEcccccHHHHHHHHccccEEEEccccHHHHccccEEEEccccccHHHHHHHHHHHHcccEEEEEccccccHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcc
cccccccccccEEEEEcccHHHHHHHHHHHHcccccHHHEEEccccHHHHHHHHHHcccEEcccHHHHHHHccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHcccccEEEEccccccEHcccEEEEcccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcc
mdafpipaesFILGFIGAGKMAESIAKGvaksgvlppdrictavhsnlkrrdAFESIGVkvlsdnnavveYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGvklkdlqewtghsrfirvmpntpsavgEAATVmslggtateedGELIGKLFGSVGKIWRADEKLFdaitglsgpAYIFLAIEALAdggvaaglPRELALGLASQTVLGAASmvtksgkhpgqlkddvaspggttiAGIHELEKSGFRGILMNAVVAAAKRSRELS
MDAFPIPAESFILGFIGAGKMAESIAKGVaksgvlppdRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQirpllsrkkLLVSVAagvklkdlqewtghsrfirVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVtksgkhpgqlkddvasPGGTTIAGIHEleksgfrgILMNAVVAAakrsrels
MDAFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAvveysdvvvfsvkpqvvkdvAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIHELEKSGFRGILMNAVVAAAKRSRELS
******PAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAA***********************TIAGIHELEKSGFRGILMNAVVA*********
*********SFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIHELEKSGFRGILMNAVVAAAKRSREL*
MDAFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIHELEKSGFRGILMNAVVA*********
**AFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIHELEKSGFRGILMNAVVAAAKRS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIHELEKSGFRGILMNAVVAAAKRSRELS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query272 2.2.26 [Sep-21-2011]
P17817274 Pyrroline-5-carboxylate r yes no 1.0 0.992 0.773 1e-120
Q04708273 Pyrroline-5-carboxylate r N/A no 0.996 0.992 0.777 1e-119
P54904276 Pyrroline-5-carboxylate r yes no 1.0 0.985 0.762 1e-118
O04016278 Pyrroline-5-carboxylate r N/A no 0.977 0.956 0.784 1e-117
Q9HH99270 Pyrroline-5-carboxylate r yes no 0.966 0.974 0.439 9e-56
Q5R9X6319 Pyrroline-5-carboxylate r yes no 0.952 0.811 0.458 2e-55
P32322319 Pyrroline-5-carboxylate r no no 0.952 0.811 0.458 2e-55
Q96C36320 Pyrroline-5-carboxylate r no no 0.952 0.809 0.443 7e-55
Q5RAQ3320 Pyrroline-5-carboxylate r no no 0.952 0.809 0.443 2e-54
Q17QJ7320 Pyrroline-5-carboxylate r yes no 0.952 0.809 0.443 3e-54
>sp|P17817|P5CR_SOYBN Pyrroline-5-carboxylate reductase OS=Glycine max PE=2 SV=1 Back     alignment and function desciption
 Score =  429 bits (1104), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 212/274 (77%), Positives = 239/274 (87%), Gaps = 2/274 (0%)

Query: 1   MDAFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVK 60
           M+ FPIPAES+ LGFIGAGKMAESIA+G  +SGVLPP RI TAVH NL RR AFES GV 
Sbjct: 1   MEIFPIPAESYTLGFIGAGKMAESIARGAVRSGVLPPSRIRTAVHFNLARRGAFESFGVT 60

Query: 61  VLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHS 120
           VL  N+ VV  SDVVV SVKPQ+VKDV  ++ PLL++ KLLVSVAAG KLKDLQEW G+ 
Sbjct: 61  VLPSNDDVVRESDVVVLSVKPQLVKDVVSKLTPLLTKHKLLVSVAAGTKLKDLQEWAGND 120

Query: 121 RFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGL-- 178
           RFIRVMPNTP+AVG+AA+VMSLGG+ATEEDG +I +LFGS+GKIW+A+EK FDAITGL  
Sbjct: 121 RFIRVMPNTPAAVGQAASVMSLGGSATEEDGNIIAQLFGSIGKIWKAEEKYFDAITGLSG 180

Query: 179 SGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPG 238
           SGPAY++LAIEALADGGVAAGLPR+L+L LASQTVLGAASMV+++GKHPGQLKDDV SPG
Sbjct: 181 SGPAYVYLAIEALADGGVAAGLPRDLSLSLASQTVLGAASMVSQTGKHPGQLKDDVTSPG 240

Query: 239 GTTIAGIHELEKSGFRGILMNAVVAAAKRSRELS 272
           GTTI GIHELE  GFRG LMNAVVAAAKRSRELS
Sbjct: 241 GTTITGIHELENGGFRGTLMNAVVAAAKRSRELS 274





Glycine max (taxid: 3847)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 2
>sp|Q04708|P5CR_PEA Pyrroline-5-carboxylate reductase OS=Pisum sativum GN=PROC PE=2 SV=1 Back     alignment and function description
>sp|P54904|P5CR1_ARATH Pyrroline-5-carboxylate reductase OS=Arabidopsis thaliana GN=PROC1 PE=2 SV=1 Back     alignment and function description
>sp|O04016|P5CR_ACTCH Pyrroline-5-carboxylate reductase OS=Actinidia chinensis PE=2 SV=1 Back     alignment and function description
>sp|Q9HH99|P5CR_METAC Pyrroline-5-carboxylate reductase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=proC PE=3 SV=1 Back     alignment and function description
>sp|Q5R9X6|P5CR1_PONAB Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Pongo abelii GN=PYCR1 PE=2 SV=1 Back     alignment and function description
>sp|P32322|P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens GN=PYCR1 PE=1 SV=2 Back     alignment and function description
>sp|Q96C36|P5CR2_HUMAN Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens GN=PYCR2 PE=1 SV=1 Back     alignment and function description
>sp|Q5RAQ3|P5CR2_PONAB Pyrroline-5-carboxylate reductase 2 OS=Pongo abelii GN=PYCR2 PE=2 SV=1 Back     alignment and function description
>sp|Q17QJ7|P5CR2_BOVIN Pyrroline-5-carboxylate reductase 2 OS=Bos taurus GN=PYCR2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
224086867279 predicted protein [Populus trichocarpa] 0.981 0.956 0.810 1e-121
357509475274 Pyrroline-5-carboxylate reductase [Medic 1.0 0.992 0.773 1e-119
351720961274 pyrroline-5-carboxylate reductase [Glyci 1.0 0.992 0.773 1e-118
296882319276 pyrroline-5-carboxylate reductase [Arabi 1.0 0.985 0.777 1e-118
449449789276 PREDICTED: pyrroline-5-carboxylate reduc 1.0 0.985 0.781 1e-118
417540273 RecName: Full=Pyrroline-5-carboxylate re 0.996 0.992 0.777 1e-117
13161407274 VuP5CR [Vigna unguiculata] 1.0 0.992 0.770 1e-117
356504710274 PREDICTED: pyrroline-5-carboxylate reduc 1.0 0.992 0.766 1e-116
15241505276 Pyrroline-5-carboxylate reductase [Arabi 1.0 0.985 0.762 1e-116
312283283276 unnamed protein product [Thellungiella h 1.0 0.985 0.773 1e-116
>gi|224086867|ref|XP_002307988.1| predicted protein [Populus trichocarpa] gi|222853964|gb|EEE91511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 240/269 (89%), Gaps = 2/269 (0%)

Query: 6   IPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDN 65
           I  E++ LGFIGAGKMAESIAKG  +SG LPP RI T++HSN  RR AF+S+GVKVL  N
Sbjct: 9   IQTETYKLGFIGAGKMAESIAKGAVQSGFLPPPRISTSIHSNPARRLAFDSLGVKVLPQN 68

Query: 66  NAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRV 125
             VVE SDVV+FSVKPQVV+DV +++RPLL++ KLLVS+AAG KLKDLQEW GHSRFIRV
Sbjct: 69  RNVVEESDVVIFSVKPQVVRDVVLELRPLLTKDKLLVSIAAGTKLKDLQEWAGHSRFIRV 128

Query: 126 MPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGL--SGPAY 183
           +PNTPSAVGEAA+VM LGG ATEEDGEL+ KLFGSVGKIWRADEKLFDAI GL  SGPAY
Sbjct: 129 VPNTPSAVGEAASVMCLGGAATEEDGELVAKLFGSVGKIWRADEKLFDAIVGLSGSGPAY 188

Query: 184 IFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIA 243
           I+LAIEALADGGVAAGLPRELA+GLASQTVLGAASM +K+GKHPGQLKDDVASPGGTTIA
Sbjct: 189 IYLAIEALADGGVAAGLPRELAMGLASQTVLGAASMASKTGKHPGQLKDDVASPGGTTIA 248

Query: 244 GIHELEKSGFRGILMNAVVAAAKRSRELS 272
           GIHELEK GFRG LMNAVVAAAKRSRELS
Sbjct: 249 GIHELEKGGFRGTLMNAVVAAAKRSRELS 277




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357509475|ref|XP_003625026.1| Pyrroline-5-carboxylate reductase [Medicago truncatula] gi|355500041|gb|AES81244.1| Pyrroline-5-carboxylate reductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|351720961|ref|NP_001235914.1| pyrroline-5-carboxylate reductase [Glycine max] gi|130972|sp|P17817.1|P5CR_SOYBN RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C reductase; Short=P5CR gi|18724|emb|CAA34401.1| unnamed protein product [Glycine max] Back     alignment and taxonomy information
>gi|296882319|gb|ADH83382.1| pyrroline-5-carboxylate reductase [Arabis stelleri] Back     alignment and taxonomy information
>gi|449449789|ref|XP_004142647.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Cucumis sativus] gi|449527143|ref|XP_004170572.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|417540|sp|Q04708.1|P5CR_PEA RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C reductase; Short=P5CR gi|20851|emb|CAA44646.1| pyrroline carboxylate reductase [Pisum sativum] gi|445614|prf||1909360A pyrroline carboxylate reductase Back     alignment and taxonomy information
>gi|13161407|dbj|BAB33038.1| VuP5CR [Vigna unguiculata] Back     alignment and taxonomy information
>gi|356504710|ref|XP_003521138.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Glycine max] Back     alignment and taxonomy information
>gi|15241505|ref|NP_196984.1| Pyrroline-5-carboxylate reductase [Arabidopsis thaliana] gi|1709786|sp|P54904.1|P5CR1_ARATH RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C reductase; Short=P5CR; AltName: Full=Protein EMBRYO DEFECTIVE 2772 gi|15294224|gb|AAK95289.1|AF410303_1 AT5g14800/T9L3_100 [Arabidopsis thaliana] gi|166815|gb|AAA61346.1| pyrroline carboxylate reductase [Arabidopsis thaliana] gi|1632776|emb|CAA70148.1| T5r protein [Arabidopsis thaliana] gi|9755748|emb|CAC01879.1| pyrroline-5-carboxylate reductase [Arabidopsis thaliana] gi|20453291|gb|AAM19884.1| AT5g14800/T9L3_100 [Arabidopsis thaliana] gi|21593123|gb|AAM65072.1| pyrroline-5-carboxylate reductase [Arabidopsis thaliana] gi|332004695|gb|AED92078.1| Pyrroline-5-carboxylate reductase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312283283|dbj|BAJ34507.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query272
TAIR|locus:2185435276 P5CR "pyrroline-5- carboxylate 1.0 0.985 0.708 2.9e-96
WB|WBGene00010924279 M153.1 [Caenorhabditis elegans 0.933 0.910 0.424 4.1e-49
TIGR_CMR|GSU_2541270 GSU_2541 "pyrroline-5-carboxyl 0.948 0.955 0.435 1.4e-46
UNIPROTKB|B4DMU0346 PYCR1 "Pyrroline-5-carboxylate 0.966 0.760 0.429 4.8e-46
ZFIN|ZDB-GENE-040426-1675320 pycr1 "pyrroline-5-carboxylate 0.952 0.809 0.421 4.8e-46
FB|FBgn0038516273 CG5840 [Drosophila melanogaste 0.952 0.948 0.420 7.9e-46
ZFIN|ZDB-GENE-050522-26362 zgc:110655 "zgc:110655" [Danio 0.952 0.715 0.417 1e-45
UNIPROTKB|P32322319 PYCR1 "Pyrroline-5-carboxylate 0.952 0.811 0.432 1.3e-45
UNIPROTKB|Q5R9X6319 PYCR1 "Pyrroline-5-carboxylate 0.952 0.811 0.432 1.3e-45
UNIPROTKB|F1S8R2320 LOC100524702 "Pyrroline-5-carb 0.952 0.809 0.421 3.4e-45
TAIR|locus:2185435 P5CR "pyrroline-5- carboxylate (P5C) reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 957 (341.9 bits), Expect = 2.9e-96, P = 2.9e-96
 Identities = 194/274 (70%), Positives = 218/274 (79%)

Query:     1 MDAFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVK 60
             M+  PIPAESF +GFIGAGKMAESIA+GV  SGVLPP+RICTAVHSNL RRD FES GV 
Sbjct:     1 MEILPIPAESFKVGFIGAGKMAESIARGVVASGVLPPNRICTAVHSNLNRRDVFESFGVN 60

Query:    61 VLSDNNAXXXXXXXXXXXXXXXXXXXXAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHS 120
             V S +                        +++  LS+ K+LVSVAAG+KL DLQEW+G  
Sbjct:    61 VFSTSEEVVKESDVVIFSVKPQVVKKAVTELKSKLSKNKILVSVAAGIKLNDLQEWSGQD 120

Query:   121 RFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSG 180
             RFIRVMPNTP+AVGEAA+VMSLG  ATEEDG ++  LFG+VGKI +ADEK+FDA+TGLSG
Sbjct:   121 RFIRVMPNTPAAVGEAASVMSLGTGATEEDGAIVAMLFGAVGKILKADEKMFDAVTGLSG 180

Query:   181 --PAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPG 238
               PAYIFLAIEALADGGVAAGLPRELAL LASQTVLGAA+MV+K+GKHPG LKDDV SPG
Sbjct:   181 SGPAYIFLAIEALADGGVAAGLPRELALSLASQTVLGAATMVSKTGKHPGVLKDDVTSPG 240

Query:   239 GTTIAGIHELEKSGFRGILMNAVVAAAKRSRELS 272
             GTTIAG+HELEK  FR  LMNAVVAAAKRSRELS
Sbjct:   241 GTTIAGVHELEKGSFRATLMNAVVAAAKRSRELS 274




GO:0000166 "nucleotide binding" evidence=IEA
GO:0004735 "pyrroline-5-carboxylate reductase activity" evidence=IEA;IGI;ISS
GO:0005737 "cytoplasm" evidence=ISM;ISS
GO:0006561 "proline biosynthetic process" evidence=IEA;ISS;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009408 "response to heat" evidence=IEP
GO:0005618 "cell wall" evidence=IDA
GO:0006567 "threonine catabolic process" evidence=RCA
GO:0009651 "response to salt stress" evidence=IEP
WB|WBGene00010924 M153.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2541 GSU_2541 "pyrroline-5-carboxylate reductase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|B4DMU0 PYCR1 "Pyrroline-5-carboxylate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1675 pycr1 "pyrroline-5-carboxylate reductase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0038516 CG5840 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-26 zgc:110655 "zgc:110655" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P32322 PYCR1 "Pyrroline-5-carboxylate reductase 1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R9X6 PYCR1 "Pyrroline-5-carboxylate reductase 1, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8R2 LOC100524702 "Pyrroline-5-carboxylate reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P54904P5CR1_ARATH1, ., 5, ., 1, ., 20.76271.00.9855yesno
Q9CPE8P5CR_PASMU1, ., 5, ., 1, ., 20.32460.94480.9345yesno
P43869P5CR_HAEIN1, ., 5, ., 1, ., 20.32070.94850.9520yesno
Q9P7Y7P5CR_SCHPO1, ., 5, ., 1, ., 20.33330.93380.9007yesno
Q5HFR9P5CR_STAAC1, ., 5, ., 1, ., 20.30450.94850.9520yesno
Q5R9X6P5CR1_PONAB1, ., 5, ., 1, ., 20.45860.95220.8119yesno
Q922Q4P5CR2_MOUSE1, ., 5, ., 1, ., 20.44730.95220.8093yesno
Q7A5G8P5CR_STAAN1, ., 5, ., 1, ., 20.30450.94850.9520yesno
Q04708P5CR_PEA1, ., 5, ., 1, ., 20.77730.99630.9926N/Ano
Q49XV0P5CR_STAS11, ., 5, ., 1, ., 20.30070.94850.9520yesno
Q6G961P5CR_STAAS1, ., 5, ., 1, ., 20.30450.94850.9520yesno
E0TY11P5CR1_BACPZ1, ., 5, ., 1, ., 20.35220.95580.8754yesno
Q5HP48P5CR_STAEQ1, ., 5, ., 1, ., 20.30450.94850.9520yesno
O04016P5CR_ACTCH1, ., 5, ., 1, ., 20.78430.97790.9568N/Ano
Q6GGJ5P5CR_STAAR1, ., 5, ., 1, ., 20.30450.94850.9520yesno
Q7A0U1P5CR_STAAW1, ., 5, ., 1, ., 20.30450.94850.9520yesno
P32263P5CR_YEAST1, ., 5, ., 1, ., 20.32150.95220.9055yesno
Q9HH99P5CR_METAC1, ., 5, ., 1, ., 20.43980.96690.9740yesno
Q8CP51P5CR_STAES1, ., 5, ., 1, ., 20.30450.94850.9520yesno
P54893P5CR_THET21, ., 5, ., 1, ., 20.37260.92270.9616yesno
P0CI77P5CR1_BACSU1, ., 5, ., 1, ., 20.35220.95580.8754yesno
Q17QJ7P5CR2_BOVIN1, ., 5, ., 1, ., 20.44360.95220.8093yesno
P0A9L9P5CR_SHIFL1, ., 5, ., 1, ., 20.37260.95580.9665yesno
Q99TZ0P5CR_STAAM1, ., 5, ., 1, ., 20.30450.94850.9520yesno
P22008P5CR_PSEAE1, ., 5, ., 1, ., 20.38250.95220.9487yesno
P27771P5CR_TREPA1, ., 5, ., 1, ., 20.30300.93010.9619yesno
P17817P5CR_SOYBN1, ., 5, ., 1, ., 20.77371.00.9927yesno
O66553P5CR_AQUAE1, ., 5, ., 1, ., 20.33450.91540.9396yesno
P0C1E4P5CR_CORGL1, ., 5, ., 1, ., 20.35840.94850.9555yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!
4th Layer1.5.1.20.979
3rd Layer1.5.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
PLN02688266 PLN02688, PLN02688, pyrroline-5-carboxylate reduct 1e-153
PRK11880267 PRK11880, PRK11880, pyrroline-5-carboxylate reduct 2e-99
COG0345266 COG0345, ProC, Pyrroline-5-carboxylate reductase [ 1e-97
TIGR00112245 TIGR00112, proC, pyrroline-5-carboxylate reductase 2e-94
PRK12491272 PRK12491, PRK12491, pyrroline-5-carboxylate reduct 8e-57
PTZ00431260 PTZ00431, PTZ00431, pyrroline carboxylate reductas 2e-56
PRK07679279 PRK07679, PRK07679, pyrroline-5-carboxylate reduct 5e-50
PRK07634245 PRK07634, PRK07634, pyrroline-5-carboxylate reduct 2e-33
PRK06928277 PRK06928, PRK06928, pyrroline-5-carboxylate reduct 1e-20
PRK07680273 PRK07680, PRK07680, late competence protein ComER; 1e-19
pfam0380793 pfam03807, F420_oxidored, NADP oxidoreductase coen 1e-15
PRK06476258 PRK06476, PRK06476, pyrroline-5-carboxylate reduct 1e-15
pfam01210157 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol- 0.003
>gnl|CDD|178291 PLN02688, PLN02688, pyrroline-5-carboxylate reductase Back     alignment and domain information
 Score =  427 bits (1099), Expect = e-153
 Identities = 187/262 (71%), Positives = 216/262 (82%), Gaps = 2/262 (0%)

Query: 13  LGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFESIGVKVLSDNNAVVEYS 72
           +GFIGAGKMAE+IA+G+  SGV+PP RI TA  SN  RRD F+S+GVK  + N  VV+ S
Sbjct: 3   VGFIGAGKMAEAIARGLVASGVVPPSRISTADDSNPARRDVFQSLGVKTAASNTEVVKSS 62

Query: 73  DVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSA 132
           DV++ +VKPQVVKDV  ++RPLLS+ KLLVSVAAG+ L DLQEW G  R +RVMPNTP  
Sbjct: 63  DVIILAVKPQVVKDVLTELRPLLSKDKLLVSVAAGITLADLQEWAGGRRVVRVMPNTPCL 122

Query: 133 VGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGL--SGPAYIFLAIEA 190
           VGEAA+VMSLG  AT +D +L+  LFG+VGKIW  DEKL DA+TGL  SGPAYIFLAIEA
Sbjct: 123 VGEAASVMSLGPAATADDRDLVATLFGAVGKIWVVDEKLLDAVTGLSGSGPAYIFLAIEA 182

Query: 191 LADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIHELEK 250
           LADGGVAAGLPR++AL LA+QTVLGAA MV ++GKHPGQLKD V SPGGTTIAG+HELEK
Sbjct: 183 LADGGVAAGLPRDVALSLAAQTVLGAAKMVLETGKHPGQLKDMVTSPGGTTIAGVHELEK 242

Query: 251 SGFRGILMNAVVAAAKRSRELS 272
            GFR  LMNAVVAAAKRSRELS
Sbjct: 243 GGFRAALMNAVVAAAKRSRELS 264


Length = 266

>gnl|CDD|237008 PRK11880, PRK11880, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|223422 COG0345, ProC, Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|232829 TIGR00112, proC, pyrroline-5-carboxylate reductase Back     alignment and domain information
>gnl|CDD|105695 PRK12491, PRK12491, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|173621 PTZ00431, PTZ00431, pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>gnl|CDD|181079 PRK07679, PRK07679, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181063 PRK07634, PRK07634, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235888 PRK06928, PRK06928, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|181080 PRK07680, PRK07680, late competence protein ComER; Validated Back     alignment and domain information
>gnl|CDD|202773 pfam03807, F420_oxidored, NADP oxidoreductase coenzyme F420-dependent Back     alignment and domain information
>gnl|CDD|235812 PRK06476, PRK06476, pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|201664 pfam01210, NAD_Gly3P_dh_N, NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 272
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 100.0
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 100.0
PTZ00431260 pyrroline carboxylate reductase; Provisional 100.0
PLN02688266 pyrroline-5-carboxylate reductase 100.0
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 100.0
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 100.0
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 100.0
PRK07680273 late competence protein ComER; Validated 100.0
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 100.0
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 100.0
KOG3124267 consensus Pyrroline-5-carboxylate reductase [Amino 100.0
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 100.0
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.98
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 99.97
KOG0409327 consensus Predicted dehydrogenase [General functio 99.95
PRK08507275 prephenate dehydrogenase; Validated 99.95
PRK07417279 arogenate dehydrogenase; Reviewed 99.95
PRK06545359 prephenate dehydrogenase; Validated 99.95
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 99.94
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.94
PRK15059292 tartronate semialdehyde reductase; Provisional 99.94
PRK08655 437 prephenate dehydrogenase; Provisional 99.94
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.93
PLN02256304 arogenate dehydrogenase 99.93
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 99.92
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.92
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 99.92
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.91
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 99.91
PLN02858 1378 fructose-bisphosphate aldolase 99.91
PRK05479330 ketol-acid reductoisomerase; Provisional 99.91
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 99.91
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.91
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.91
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.9
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.89
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 99.89
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.88
PLN02858 1378 fructose-bisphosphate aldolase 99.88
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.88
PLN02712667 arogenate dehydrogenase 99.87
PRK08818 370 prephenate dehydrogenase; Provisional 99.87
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.87
PF14748107 P5CR_dimer: Pyrroline-5-carboxylate reductase dime 99.86
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.86
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.84
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.83
PLN02712 667 arogenate dehydrogenase 99.83
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.83
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.82
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.82
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.81
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.81
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.8
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.8
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.8
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.79
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.78
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 99.77
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.76
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.76
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.76
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.75
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.75
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.75
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.73
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.73
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.72
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.72
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.72
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.71
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.71
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.71
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.7
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.68
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.68
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.65
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.64
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.64
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 99.63
PRK13403335 ketol-acid reductoisomerase; Provisional 99.63
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 99.62
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.61
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.61
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.58
PRK06444197 prephenate dehydrogenase; Provisional 99.56
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 99.52
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 99.52
PRK11730 715 fadB multifunctional fatty acid oxidation complex 99.51
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.51
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.51
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.51
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.5
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 99.48
KOG2380 480 consensus Prephenate dehydrogenase (NADP+) [Amino 99.46
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 99.45
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 99.45
PRK05225 487 ketol-acid reductoisomerase; Validated 99.43
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 99.39
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.38
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 99.36
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.36
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.32
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.22
COG5495289 Uncharacterized conserved protein [Function unknow 99.2
PRK12480330 D-lactate dehydrogenase; Provisional 99.16
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 99.16
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 99.15
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.15
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 99.11
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 99.11
PRK07574385 formate dehydrogenase; Provisional 99.1
PLN03139386 formate dehydrogenase; Provisional 99.09
PRK13243333 glyoxylate reductase; Reviewed 99.07
PRK13302271 putative L-aspartate dehydrogenase; Provisional 99.05
PRK13304265 L-aspartate dehydrogenase; Reviewed 99.04
KOG2653 487 consensus 6-phosphogluconate dehydrogenase [Carboh 99.03
PRK08605332 D-lactate dehydrogenase; Validated 99.02
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 98.99
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.99
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.92
PRK06436303 glycerate dehydrogenase; Provisional 98.9
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.89
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.88
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 98.86
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 98.81
PRK06141314 ornithine cyclodeaminase; Validated 98.77
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.76
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.75
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.74
PLN02928347 oxidoreductase family protein 98.74
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.73
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 98.7
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.69
KOG2305313 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 98.69
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 98.69
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 98.68
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.66
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 98.66
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 98.65
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.63
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 98.61
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 98.57
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 98.56
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.54
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.53
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.53
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.52
PRK06932314 glycerate dehydrogenase; Provisional 98.48
PLN02306386 hydroxypyruvate reductase 98.48
PRK00048257 dihydrodipicolinate reductase; Provisional 98.47
PRK06487317 glycerate dehydrogenase; Provisional 98.46
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.43
PRK07340304 ornithine cyclodeaminase; Validated 98.43
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 98.4
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 98.39
PRK06823315 ornithine cyclodeaminase; Validated 98.37
PRK06223307 malate dehydrogenase; Reviewed 98.37
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.37
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 98.36
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 98.36
PRK06407301 ornithine cyclodeaminase; Provisional 98.36
PLN00203519 glutamyl-tRNA reductase 98.35
PRK08618325 ornithine cyclodeaminase; Validated 98.35
PRK13303265 L-aspartate dehydrogenase; Provisional 98.34
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.34
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 98.33
COG0569225 TrkA K+ transport systems, NAD-binding component [ 98.33
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 98.31
PTZ00075476 Adenosylhomocysteinase; Provisional 98.31
PRK06046326 alanine dehydrogenase; Validated 98.3
PRK07589346 ornithine cyclodeaminase; Validated 98.3
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 98.3
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 98.29
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.29
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.28
PRK08300302 acetaldehyde dehydrogenase; Validated 98.28
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 98.28
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 98.28
PLN02494477 adenosylhomocysteinase 98.27
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.27
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.25
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 98.25
PTZ00117319 malate dehydrogenase; Provisional 98.23
TIGR00036266 dapB dihydrodipicolinate reductase. 98.21
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.2
PRK13940414 glutamyl-tRNA reductase; Provisional 98.2
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 98.2
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.16
PTZ00082321 L-lactate dehydrogenase; Provisional 98.15
COG0673342 MviM Predicted dehydrogenases and related proteins 98.15
PRK08291330 ectoine utilization protein EutC; Validated 98.15
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 98.14
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 98.12
PRK04148134 hypothetical protein; Provisional 98.1
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 98.09
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 98.08
PRK06199379 ornithine cyclodeaminase; Validated 98.08
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 98.05
PRK09496 453 trkA potassium transporter peripheral membrane com 98.04
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 98.04
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.04
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 98.04
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.02
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 98.02
PRK15076 431 alpha-galactosidase; Provisional 98.01
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.99
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.99
PRK11579346 putative oxidoreductase; Provisional 97.97
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 97.95
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.92
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.92
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.9
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.88
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 97.87
PLN02602350 lactate dehydrogenase 97.85
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.85
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.83
PRK05442326 malate dehydrogenase; Provisional 97.82
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.8
PTZ00325321 malate dehydrogenase; Provisional 97.79
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 97.78
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 97.76
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 97.74
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.74
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.72
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.72
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.72
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 97.71
PRK03659601 glutathione-regulated potassium-efflux system prot 97.7
PRK10206344 putative oxidoreductase; Provisional 97.69
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.69
PRK06719157 precorrin-2 dehydrogenase; Validated 97.68
PRK05086312 malate dehydrogenase; Provisional 97.68
COG2910211 Putative NADH-flavin reductase [General function p 97.68
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 97.67
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 97.66
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 97.65
PRK09496453 trkA potassium transporter peripheral membrane com 97.64
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 97.63
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.63
PLN00112444 malate dehydrogenase (NADP); Provisional 97.63
PRK10669558 putative cation:proton antiport protein; Provision 97.63
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 97.63
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.58
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.58
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 97.55
PRK06349 426 homoserine dehydrogenase; Provisional 97.54
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.54
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.53
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.52
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.52
PRK03562621 glutathione-regulated potassium-efflux system prot 97.52
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.5
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 97.5
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.48
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 97.47
KOG0068406 consensus D-3-phosphoglycerate dehydrogenase, D-is 97.46
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.46
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.45
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 97.44
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 97.43
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 97.42
PLN02383344 aspartate semialdehyde dehydrogenase 97.41
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 97.41
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.4
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.35
PRK08040336 putative semialdehyde dehydrogenase; Provisional 97.34
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 97.32
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.31
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 97.29
PRK00676338 hemA glutamyl-tRNA reductase; Validated 97.28
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 97.27
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.27
PLN00106323 malate dehydrogenase 97.26
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.25
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 97.25
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.25
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.22
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.22
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.21
CHL00194317 ycf39 Ycf39; Provisional 97.21
PF10100 429 DUF2338: Uncharacterized protein conserved in bact 97.2
PRK06270341 homoserine dehydrogenase; Provisional 97.19
COG2344211 AT-rich DNA-binding protein [General function pred 97.18
PRK14982340 acyl-ACP reductase; Provisional 97.17
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.17
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 97.17
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.16
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 97.15
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.15
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.15
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.12
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.12
PF10728132 DUF2520: Domain of unknown function (DUF2520); Int 97.09
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 97.08
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.08
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 97.06
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 97.05
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 97.01
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.0
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 97.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.99
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.99
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 96.96
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 96.95
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.93
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.93
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 96.91
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.89
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.88
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 96.88
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 96.86
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.84
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.84
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.84
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.84
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.83
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.83
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.81
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 96.79
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.78
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.76
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 96.75
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.75
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 96.7
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.69
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.68
PRK06153393 hypothetical protein; Provisional 96.67
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 96.66
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.63
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 96.63
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.63
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 96.62
PRK08328231 hypothetical protein; Provisional 96.62
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.58
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 96.57
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 96.57
PRK05600370 thiamine biosynthesis protein ThiF; Validated 96.53
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 96.51
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.49
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.46
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.35
COG0300265 DltE Short-chain dehydrogenases of various substra 96.33
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.31
KOG1495332 consensus Lactate dehydrogenase [Energy production 96.26
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.26
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.25
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 96.24
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.24
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.2
PLN02353473 probable UDP-glucose 6-dehydrogenase 96.19
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.18
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 96.17
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.17
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 96.15
PRK08374336 homoserine dehydrogenase; Provisional 96.15
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.15
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 96.14
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.13
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 96.13
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 96.12
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.11
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 96.1
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.1
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.09
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 96.08
PRK07411390 hypothetical protein; Validated 96.08
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 96.06
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.04
PLN03075296 nicotianamine synthase; Provisional 96.03
PLN02775286 Probable dihydrodipicolinate reductase 96.02
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 96.01
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.99
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.99
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 95.98
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.96
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.95
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 95.95
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.95
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.87
PRK15116268 sulfur acceptor protein CsdL; Provisional 95.86
PRK06180277 short chain dehydrogenase; Provisional 95.85
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 95.84
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 95.83
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 95.83
PLN02477410 glutamate dehydrogenase 95.83
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.83
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 95.83
PRK10637 457 cysG siroheme synthase; Provisional 95.81
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.8
PRK06392326 homoserine dehydrogenase; Provisional 95.8
PRK09242257 tropinone reductase; Provisional 95.78
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.77
PRK09186256 flagellin modification protein A; Provisional 95.77
PLN03209 576 translocon at the inner envelope of chloroplast su 95.77
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.76
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.71
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 95.7
PRK12814 652 putative NADPH-dependent glutamate synthase small 95.69
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 95.63
PRK06182273 short chain dehydrogenase; Validated 95.61
PRK08223287 hypothetical protein; Validated 95.61
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 95.6
COG4408 431 Uncharacterized protein conserved in bacteria [Fun 95.6
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.6
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 95.59
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.59
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.58
PRK05717255 oxidoreductase; Validated 95.58
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 95.57
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.54
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.53
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 95.52
PRK11908347 NAD-dependent epimerase/dehydratase family protein 95.52
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 95.52
PLN02427386 UDP-apiose/xylose synthase 95.52
COG5322351 Predicted dehydrogenase [General function predicti 95.48
PRK10538248 malonic semialdehyde reductase; Provisional 95.44
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.43
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 95.42
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.42
PRK07454241 short chain dehydrogenase; Provisional 95.4
PRK05875276 short chain dehydrogenase; Provisional 95.39
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 95.38
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 95.37
PRK07326237 short chain dehydrogenase; Provisional 95.36
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 95.35
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 95.35
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 95.35
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 95.32
PRK07523255 gluconate 5-dehydrogenase; Provisional 95.31
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.31
PRK09414445 glutamate dehydrogenase; Provisional 95.3
PRK05866293 short chain dehydrogenase; Provisional 95.29
PLN02172 461 flavin-containing monooxygenase FMO GS-OX 95.25
PRK12939250 short chain dehydrogenase; Provisional 95.22
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.21
PRK08163 396 salicylate hydroxylase; Provisional 95.21
PRK07825273 short chain dehydrogenase; Provisional 95.18
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 95.18
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.17
PRK12828239 short chain dehydrogenase; Provisional 95.16
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 95.16
PRK07775274 short chain dehydrogenase; Provisional 95.11
PRK05993277 short chain dehydrogenase; Provisional 95.1
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 95.09
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 95.09
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 95.08
KOG3007333 consensus Mu-crystallin [Amino acid transport and 95.08
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.08
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 95.06
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 95.06
PRK12829264 short chain dehydrogenase; Provisional 95.06
PLN02896353 cinnamyl-alcohol dehydrogenase 95.05
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 95.05
PRK07062265 short chain dehydrogenase; Provisional 95.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 94.96
PRK07814263 short chain dehydrogenase; Provisional 94.95
PRK08267260 short chain dehydrogenase; Provisional 94.92
PRK07890258 short chain dehydrogenase; Provisional 94.92
PRK08017256 oxidoreductase; Provisional 94.91
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.9
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 94.9
PRK06179270 short chain dehydrogenase; Provisional 94.89
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 94.89
PRK08340259 glucose-1-dehydrogenase; Provisional 94.88
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 94.87
PRK06138252 short chain dehydrogenase; Provisional 94.87
PRK06914280 short chain dehydrogenase; Provisional 94.86
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.84
PRK06057255 short chain dehydrogenase; Provisional 94.83
PRK08213259 gluconate 5-dehydrogenase; Provisional 94.82
PRK03815 401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.81
PRK10537393 voltage-gated potassium channel; Provisional 94.79
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 94.78
COG1832140 Predicted CoA-binding protein [General function pr 94.77
PRK05854313 short chain dehydrogenase; Provisional 94.75
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 94.74
PRK08251248 short chain dehydrogenase; Provisional 94.74
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 94.74
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.73
PRK05867253 short chain dehydrogenase; Provisional 94.72
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.72
PRK07831262 short chain dehydrogenase; Provisional 94.72
PRK14030445 glutamate dehydrogenase; Provisional 94.71
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 94.66
PRK06949258 short chain dehydrogenase; Provisional 94.66
PRK07109334 short chain dehydrogenase; Provisional 94.63
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.62
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 94.61
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 94.61
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.6
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 94.58
PRK06500249 short chain dehydrogenase; Provisional 94.58
COG0773 459 MurC UDP-N-acetylmuramate-alanine ligase [Cell env 94.57
KOG1683 380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 94.57
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 94.57
PRK08265261 short chain dehydrogenase; Provisional 94.56
PRK06197306 short chain dehydrogenase; Provisional 94.55
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=6.8e-53  Score=348.81  Aligned_cols=261  Identities=49%  Similarity=0.801  Sum_probs=246.9

Q ss_pred             CCeEEEEcccHHHHHHHHHHHhCCCCCCCcEEEEeCCCHHHHHHHHH-cCceeecCchhhhccCCEEEEeeCcccHHHHH
Q 024121           10 SFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFES-IGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVA   88 (272)
Q Consensus        10 ~~~IgiIG~G~mG~~la~~l~~~g~~~~~~V~v~~~r~~~~~~~l~~-~g~~~~~~~~~~~~~aDivil~v~~~~~~~v~   88 (272)
                      ++||||||+|+||++|+.+|+++|.+++.+|++. +|++++.+.+.+ +|+..+.++.+++.++|+||+||+|+++++++
T Consensus         1 ~~~IgfIG~G~Mg~Ai~~gl~~~g~~~~~~I~v~-~~~~e~~~~l~~~~g~~~~~~~~~~~~~advv~LavKPq~~~~vl   79 (266)
T COG0345           1 MMKIGFIGAGNMGEAILSGLLKSGALPPEEIIVT-NRSEEKRAALAAEYGVVTTTDNQEAVEEADVVFLAVKPQDLEEVL   79 (266)
T ss_pred             CceEEEEccCHHHHHHHHHHHhcCCCCcceEEEe-CCCHHHHHHHHHHcCCcccCcHHHHHhhCCEEEEEeChHhHHHHH
Confidence            4789999999999999999999995577799999 999999875655 77776677788899999999999999999999


Q ss_pred             HHhchhcCCCCEEEEEcCCCCHHHHHHHhCCCCEEEEccCchhhhcCCceEEEeCCCCCHHHHHHHHHHhhhcCCeEEcC
Q 024121           89 MQIRPLLSRKKLLVSVAAGVKLKDLQEWTGHSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRAD  168 (272)
Q Consensus        89 ~~l~~~l~~~~~iis~~~~~~~~~l~~~~~~~~~~~~~p~~~~~~~~g~~~~~~~~~~~~~~~~~v~~ll~~~G~~~~~~  168 (272)
                      .++.+ +.++++|||+.+|++.+.+++++++.+++|+|||+|..++.|.+.++.+...++++.+.+.++|+.+|++++++
T Consensus        80 ~~l~~-~~~~~lvISiaAGv~~~~l~~~l~~~~vvR~MPNt~a~vg~g~t~i~~~~~~~~~~~~~v~~l~~~~G~v~~v~  158 (266)
T COG0345          80 SKLKP-LTKDKLVISIAAGVSIETLERLLGGLRVVRVMPNTPALVGAGVTAISANANVSEEDKAFVEALLSAVGKVVEVE  158 (266)
T ss_pred             HHhhc-ccCCCEEEEEeCCCCHHHHHHHcCCCceEEeCCChHHHHcCcceeeecCccCCHHHHHHHHHHHHhcCCeEEec
Confidence            99998 77999999999999999999999878999999999999999999999998899999999999999999998888


Q ss_pred             cccchhHHHch--HHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHhcCCCcchHHHHHH
Q 024121          169 EKLFDAITGLS--GPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTIAGIH  246 (272)
Q Consensus       169 e~~~~~~~~~~--~~~~~~~~~~~l~~~~~~~Gl~~~~a~~~~~~~~~g~~~~~~~~~~~~~~l~~~~~~~~g~t~~~l~  246 (272)
                      |+.+|.+++++  +|+|++.++|+|.+++.+.|++++++++++.+++.|+..++.+++.+|..|+++|+||||+|++||+
T Consensus       159 E~~~da~TaisGSgPAyv~~~iEal~~agv~~Gl~~~~A~~l~~~t~~Gaakll~e~~~~p~~Lr~~VtSPGGtTiagl~  238 (266)
T COG0345         159 ESLMDAVTALSGSGPAYVFLFIEALADAGVRLGLPREEARELAAQTVAGAAKLLLESGEHPAELRDQVTSPGGTTIAGLR  238 (266)
T ss_pred             hHHhhHHHHHhcCCHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHhCcCCCchHHHHHH
Confidence            99999999999  9999999999999999999999999999999999999999998888999999999999999999999


Q ss_pred             HHHhCCHHHHHHHHHHHHHHHHhhcC
Q 024121          247 ELEKSGFRGILMNAVVAAAKRSRELS  272 (272)
Q Consensus       247 ~l~~~~~~~~~~~~~~~~~~r~~~~~  272 (272)
                      .|++.+|+..+.++++++++|++||+
T Consensus       239 ~le~~g~~~~v~~av~aa~~r~~el~  264 (266)
T COG0345         239 VLEEDGFRGAVIEAVEAAYKRSEELG  264 (266)
T ss_pred             HHHHhChHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999999985



>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG3124 consensus Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PF14748 P5CR_dimer: Pyrroline-5-carboxylate reductase dimerisation; PDB: 2RCY_D 3TRI_A 2IZZ_B 2GR9_B 2GRA_B 2GER_C 1YQG_A 2AG8_A 3GT0_A 2AMF_E Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2653 consensus 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>KOG2305 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF10728 DUF2520: Domain of unknown function (DUF2520); InterPro: IPR018931 This presumed domain is found C-terminal to a Rossmann-like domain suggesting that these proteins are oxidoreductases Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1495 consensus Lactate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
2izz_A322 Crystal Structure Of Human Pyrroline-5-Carboxylate 7e-49
2gr9_A277 Crystal Structure Of P5cr Complexed With Nadh Lengt 2e-48
2ger_A321 Crystal Structure And Oxidative Mechanism Of Human 2e-48
2rcy_A262 Crystal Structure Of Plasmodium Falciparum Pyrrolin 1e-32
3tri_A280 Structure Of A Pyrroline-5-Carboxylate Reductase (P 5e-31
3gt0_A247 Crystal Structure Of Pyrroline 5-Carboxylate Reduct 5e-27
2amf_A259 Crystal Structure Of 1-Pyrroline-5-Carboxylate Redu 1e-26
2ahr_A259 Crystal Structures Of 1-Pyrroline-5-Carboxylate Red 4e-25
1yqg_A263 Crystal Structure Of A Pyrroline-5-Carboxylate Redu 8e-17
>pdb|2IZZ|A Chain A, Crystal Structure Of Human Pyrroline-5-Carboxylate Reductase Length = 322 Back     alignment and structure

Iteration: 1

Score = 190 bits (483), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 116/270 (42%), Positives = 155/270 (57%), Gaps = 7/270 (2%) Query: 9 ESFILGFIGAGKMAESIAKGVAKSGVLPPDRI-CTAVHSNLKRRDAFESIGVKVLSDNNA 67 +S +GFIGAG++A ++AKG +GVL +I ++ +L A +GVK+ N Sbjct: 21 QSMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKE 80 Query: 68 XXXXXXXXXXXXXXXXXXXXAMQIRPLLSRKKLLVSVAAGVKL----KDLQEWTGHSRFI 123 +I + + ++VS AAGV + K L + R I Sbjct: 81 TVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVI 140 Query: 124 RVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAITGLSG--P 181 R M NTP V E ATV + G A EDG L+ +L SVG +E L DA+TGLSG P Sbjct: 141 RCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGP 200 Query: 182 AYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTT 241 AY F A++ALADGGV GLPR LA+ L +Q +LGAA M+ S +HPGQLKD+V+SPGG T Sbjct: 201 AYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGAT 260 Query: 242 IAGIHELEKSGFRGILMNAVVAAAKRSREL 271 I +H LE GFR +L+NAV A+ R+REL Sbjct: 261 IHALHVLESGGFRSLLINAVEASCIRTREL 290
>pdb|2GR9|A Chain A, Crystal Structure Of P5cr Complexed With Nadh Length = 277 Back     alignment and structure
>pdb|2GER|A Chain A, Crystal Structure And Oxidative Mechanism Of Human Pyrroline-5- Carboxylate Reductase Length = 321 Back     alignment and structure
>pdb|2RCY|A Chain A, Crystal Structure Of Plasmodium Falciparum Pyrroline Carboxylate Reductase (Mal13p1.284) With Nadp Bound Length = 262 Back     alignment and structure
>pdb|3TRI|A Chain A, Structure Of A Pyrroline-5-Carboxylate Reductase (Proc) From Coxiella Burnetii Length = 280 Back     alignment and structure
>pdb|3GT0|A Chain A, Crystal Structure Of Pyrroline 5-Carboxylate Reductase From Bacillus Cereus. Northeast Structural Genomics Consortium Target Bcr38b Length = 247 Back     alignment and structure
>pdb|2AMF|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Reductase From Human Pathogen Streptococcus Pyogenes Length = 259 Back     alignment and structure
>pdb|2AHR|A Chain A, Crystal Structures Of 1-Pyrroline-5-Carboxylate Reductase From Human Pathogen Streptococcus Pyogenes Length = 259 Back     alignment and structure
>pdb|1YQG|A Chain A, Crystal Structure Of A Pyrroline-5-Carboxylate Reductase From Neisseria Meningitides Mc58 Length = 263 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query272
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 1e-125
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 1e-122
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 1e-120
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 1e-119
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 1e-115
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 1e-110
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 2e-16
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 3e-12
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Length = 322 Back     alignment and structure
 Score =  358 bits (921), Expect = e-125
 Identities = 121/279 (43%), Positives = 171/279 (61%), Gaps = 7/279 (2%)

Query: 1   MDAFPIPAESFILGFIGAGKMAESIAKGVAKSGVLPPDRIC-TAVHSNLKRRDAFESIGV 59
           +    +  +S  +GFIGAG++A ++AKG   +GVL   +I  ++   +L    A   +GV
Sbjct: 13  LGTENLYFQSMSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGV 72

Query: 60  KVLSDNNAVVEYSDVVVFSVKPQVVKDVAMQIRPLLSRKKLLVSVAAGVKLKDLQEWTGH 119
           K+   N   V++SDV+  +VKP ++  +  +I   +  + ++VS AAGV +  +++    
Sbjct: 73  KLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSA 132

Query: 120 ----SRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRADEKLFDAI 175
                R IR M NTP  V E ATV + G  A  EDG L+ +L  SVG     +E L DA+
Sbjct: 133 FRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAV 192

Query: 176 TGLSG--PAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDD 233
           TGLSG  PAY F A++ALADGGV  GLPR LA+ L +Q +LGAA M+  S +HPGQLKD+
Sbjct: 193 TGLSGSGPAYAFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDN 252

Query: 234 VASPGGTTIAGIHELEKSGFRGILMNAVVAAAKRSRELS 272
           V+SPGG TI  +H LE  GFR +L+NAV A+  R+REL 
Sbjct: 253 VSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQ 291


>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Length = 262 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Length = 280 Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Length = 259 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Length = 247 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Length = 263 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Length = 266 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Length = 276 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 100.0
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 100.0
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 100.0
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 100.0
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 100.0
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 100.0
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 100.0
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.97
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.97
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.97
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 99.96
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.96
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.96
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.96
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 99.95
3l6d_A306 Putative oxidoreductase; structural genomics, prot 99.95
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 99.94
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 99.94
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 99.94
1yb4_A295 Tartronic semialdehyde reductase; structural genom 99.94
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 99.94
1vpd_A299 Tartronate semialdehyde reductase; structural geno 99.93
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 99.93
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.93
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.93
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 99.93
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 99.93
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 99.93
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.93
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.92
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 99.92
3qha_A296 Putative oxidoreductase; seattle structural genomi 99.92
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.91
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.91
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.91
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.9
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.9
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.9
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 99.9
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.89
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.88
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.88
4ezb_A317 Uncharacterized conserved protein; structural geno 99.88
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.87
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.87
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.87
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 99.86
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.86
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.86
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.86
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.85
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.85
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.84
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.84
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.83
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.83
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.83
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.81
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.81
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.81
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.81
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.81
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.69
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.8
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.78
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.78
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.78
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.77
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.76
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.76
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.75
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.75
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.73
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.73
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.72
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.72
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.71
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.69
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.68
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.68
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.67
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.66
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.65
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 99.63
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.59
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.53
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 99.49
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.47
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 99.41
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 99.4
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.37
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.34
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.34
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.33
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.28
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 99.28
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.27
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.24
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.23
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.23
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.23
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.22
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.22
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.21
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.2
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.19
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.19
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.16
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.16
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.16
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.16
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.15
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 99.15
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 99.11
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.11
1lss_A140 TRK system potassium uptake protein TRKA homolog; 99.1
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.1
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.09
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.08
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.07
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.06
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.04
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 99.04
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 99.04
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 99.04
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.03
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.02
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 99.02
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.01
3euw_A344 MYO-inositol dehydrogenase; protein structure init 99.01
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 99.01
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.01
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 99.0
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 99.0
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.99
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 98.97
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.96
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.96
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.96
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.94
2duw_A145 Putative COA-binding protein; ligand binding prote 98.94
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.94
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.93
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.92
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.91
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.91
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.91
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.9
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.89
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.88
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.88
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.87
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 98.86
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.86
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.86
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.84
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.83
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.83
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.82
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.81
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.8
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.8
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 98.78
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 98.77
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.75
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.75
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 98.73
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.73
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.72
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 98.72
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 98.72
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.71
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.71
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.71
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.7
1ydw_A362 AX110P-like protein; structural genomics, protein 98.7
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.69
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.69
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 98.67
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 98.65
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.65
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.64
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.64
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.63
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.62
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 98.62
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.61
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 98.61
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.6
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 98.6
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 98.59
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 98.58
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.57
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.56
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.56
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 98.55
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 98.53
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 98.53
1iuk_A140 Hypothetical protein TT1466; structural genomics, 98.52
4had_A350 Probable oxidoreductase protein; structural genomi 98.52
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 98.52
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.52
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 98.51
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 98.51
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 98.5
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.5
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 98.49
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.49
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.48
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 98.48
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.48
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 98.47
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.46
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 98.46
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 98.45
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.44
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 98.43
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.43
2d59_A144 Hypothetical protein PH1109; COA binding, structur 98.43
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.43
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 98.43
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 98.41
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 98.41
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 98.41
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 98.4
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 98.38
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.38
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 98.37
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 98.36
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 98.36
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.35
4h3v_A 390 Oxidoreductase domain protein; structural genomics 98.34
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.33
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 98.33
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 98.32
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 98.31
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.3
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.3
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.29
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 98.28
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 98.28
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 98.28
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.26
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 98.26
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 98.25
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 98.25
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 98.23
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 98.23
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.23
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.22
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.2
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 98.2
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.2
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 98.19
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.19
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 98.19
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.19
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 98.19
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 98.16
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.13
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 98.11
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 98.1
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 98.07
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 98.06
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 98.05
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.04
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.04
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 98.04
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 98.04
4g65_A 461 TRK system potassium uptake protein TRKA; structur 98.04
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 98.04
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 98.03
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.0
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.98
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 97.97
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.96
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 97.94
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.94
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.93
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 97.92
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 97.89
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 97.88
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.88
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.88
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.87
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.86
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 97.86
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.85
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 97.83
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 97.83
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.81
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.8
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.79
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.78
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 97.75
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.74
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 97.74
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.74
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.73
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.73
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.73
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.73
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.72
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.71
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 97.7
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 97.67
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 97.63
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.63
1up7_A 417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 97.63
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.61
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.6
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.59
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 97.58
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 97.57
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 97.55
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 97.55
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.54
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.54
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.53
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.52
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.52
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.5
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 97.5
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 97.49
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 97.48
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.42
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 97.41
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.41
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.38
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.37
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.36
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.32
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.32
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.31
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 97.3
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 97.28
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.28
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.28
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 97.26
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.25
1lnq_A336 MTHK channels, potassium channel related protein; 97.22
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 97.21
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 97.2
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 97.19
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.19
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.17
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 97.13
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.12
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 97.12
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 97.11
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 97.11
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.1
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 97.1
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.09
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.08
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.03
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.03
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 97.01
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 96.99
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.93
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.92
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 96.91
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 96.91
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.9
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 96.9
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 96.88
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.84
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.83
4gx0_A565 TRKA domain protein; membrane protein, ION channel 96.83
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 96.83
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 96.82
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.8
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.8
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 96.74
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.74
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 96.74
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 96.69
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 96.67
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.66
4g65_A461 TRK system potassium uptake protein TRKA; structur 96.63
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.6
2csu_A 457 457AA long hypothetical protein; structural genomi 96.58
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 96.56
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.55
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 96.52
1xq6_A253 Unknown protein; structural genomics, protein stru 96.49
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 96.48
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 96.45
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 96.45
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.45
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 96.42
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.38
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 96.37
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 96.36
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 96.34
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 96.33
3h2z_A382 Mannitol-1-phosphate 5-dehydrogenase; PSI- protein 96.25
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 96.23
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.22
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.2
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.16
1p3d_A 475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 96.14
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.13
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 96.13
2f00_A 491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 96.1
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.09
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 96.07
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.02
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 95.99
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 95.99
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 95.98
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 95.98
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 95.97
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 95.95
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 95.95
3tjr_A301 Short chain dehydrogenase; structural genomics, se 95.92
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 95.92
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 95.88
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.87
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 95.84
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 95.84
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 95.8
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 95.8
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 95.77
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 95.76
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 95.72
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 95.72
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 95.71
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 95.7
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 95.7
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 95.69
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 95.69
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 95.65
4hb9_A 412 Similarities with probable monooxygenase; flavin, 95.61
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 95.6
3imf_A257 Short chain dehydrogenase; structural genomics, in 95.59
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.58
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 95.57
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 95.57
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 95.56
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 95.56
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 95.56
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.56
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.56
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 95.55
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 95.54
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 95.51
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 95.51
4dqx_A277 Probable oxidoreductase protein; structural genomi 95.51
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 95.51
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 95.5
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 95.5
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 95.49
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 95.49
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 95.49
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 95.48
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 95.48
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 95.47
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 95.46
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 95.46
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.46
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 95.45
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.45
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 95.45
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 95.43
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 95.42
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 95.42
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 95.41
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.4
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 95.39
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 95.39
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 95.39
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 95.37
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.37
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 95.36
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.36
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 95.36
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 95.36
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 95.35
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 95.35
2x5o_A 439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 95.33
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 95.33
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 95.31
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 95.31
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 95.3
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 95.29
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 95.29
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 95.29
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 95.29
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 95.27
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 95.27
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 95.26
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 95.24
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 95.24
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 95.22
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 95.19
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 95.19
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.17
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.17
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 95.16
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
Probab=100.00  E-value=4.6e-50  Score=340.93  Aligned_cols=262  Identities=38%  Similarity=0.591  Sum_probs=245.9

Q ss_pred             CCCeEEEEcccHHHHHHHHHHHhCCCCCCCcEEEEeCCCHHHHHHHHH-cCceeecCchhhhccCCEEEEeeCcccHHHH
Q 024121            9 ESFILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFES-IGVKVLSDNNAVVEYSDVVVFSVKPQVVKDV   87 (272)
Q Consensus         9 ~~~~IgiIG~G~mG~~la~~l~~~g~~~~~~V~v~~~r~~~~~~~l~~-~g~~~~~~~~~~~~~aDivil~v~~~~~~~v   87 (272)
                      ++|||+|||+|+||++|+.+|.++|+ ++.+|++| +|++++++++.+ .|+..+.++.++++++|+||+||||+.+.++
T Consensus         2 ~~~~I~iIG~G~mG~aia~~l~~~g~-~~~~V~v~-dr~~~~~~~l~~~~gi~~~~~~~~~~~~aDvVilav~p~~~~~v   79 (280)
T 3tri_A            2 NTSNITFIGGGNMARNIVVGLIANGY-DPNRICVT-NRSLDKLDFFKEKCGVHTTQDNRQGALNADVVVLAVKPHQIKMV   79 (280)
T ss_dssp             CCSCEEEESCSHHHHHHHHHHHHTTC-CGGGEEEE-CSSSHHHHHHHHTTCCEEESCHHHHHSSCSEEEECSCGGGHHHH
T ss_pred             CCCEEEEEcccHHHHHHHHHHHHCCC-CCCeEEEE-eCCHHHHHHHHHHcCCEEeCChHHHHhcCCeEEEEeCHHHHHHH
Confidence            56899999999999999999999996 66689999 999999999887 5998888888999999999999999999999


Q ss_pred             HHHhchh-cCCCCEEEEEcCCCCHHHHHHHhC-CCCEEEEccCchhhhcCCceEEEeCCCCCHHHHHHHHHHhhhcCCeE
Q 024121           88 AMQIRPL-LSRKKLLVSVAAGVKLKDLQEWTG-HSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIW  165 (272)
Q Consensus        88 ~~~l~~~-l~~~~~iis~~~~~~~~~l~~~~~-~~~~~~~~p~~~~~~~~g~~~~~~~~~~~~~~~~~v~~ll~~~G~~~  165 (272)
                      ++++.++ ++++++|||+++|++.+.+++.++ +.+++|+|||+|..++.|.+.+++++..++++.+.++++|+.+|+.+
T Consensus        80 l~~l~~~~l~~~~iiiS~~agi~~~~l~~~l~~~~~vvr~mPn~p~~v~~g~~~l~~~~~~~~~~~~~v~~l~~~iG~~~  159 (280)
T 3tri_A           80 CEELKDILSETKILVISLAVGVTTPLIEKWLGKASRIVRAMPNTPSSVRAGATGLFANETVDKDQKNLAESIMRAVGLVI  159 (280)
T ss_dssp             HHHHHHHHHTTTCEEEECCTTCCHHHHHHHHTCCSSEEEEECCGGGGGTCEEEEEECCTTSCHHHHHHHHHHHGGGEEEE
T ss_pred             HHHHHhhccCCCeEEEEecCCCCHHHHHHHcCCCCeEEEEecCChHHhcCccEEEEeCCCCCHHHHHHHHHHHHHCCCeE
Confidence            9999998 888889999999999999999887 47899999999999999999999888889999999999999999876


Q ss_pred             Ec-CcccchhHHHch--HHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHhcCCCcchHH
Q 024121          166 RA-DEKLFDAITGLS--GPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGKHPGQLKDDVASPGGTTI  242 (272)
Q Consensus       166 ~~-~e~~~~~~~~~~--~~~~~~~~~~~l~~~~~~~Gl~~~~a~~~~~~~~~g~~~~~~~~~~~~~~l~~~~~~~~g~t~  242 (272)
                      ++ +|+++|.+++++  +|+|++.+++++.+++.+.|++++++++++.+++.|+.+++.+++.+|..|++++++|||+|+
T Consensus       160 ~v~~E~~~d~~talsgsgpa~~~~~~eal~~a~v~~Gl~~~~a~~l~~~t~~G~a~~~~~~~~~p~~l~~~v~spgGtT~  239 (280)
T 3tri_A          160 WVSSEDQIEKIAALSGSGPAYIFLIMEALQEAAEQLGLTKETAELLTEQTVLGAARMALETEQSVVQLRQFVTSPGGTTE  239 (280)
T ss_dssp             ECSSHHHHHHHHHHTTSHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHTCSSCHHHHHHHHCCTTSHHH
T ss_pred             EECCHHHhhHHHHHhccHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHhccCCChHHH
Confidence            65 788999999988  899999999999999999999999999999999999999999889999999999999999999


Q ss_pred             HHHHHHHhCCHHHHHHHHHHHHHHHHhhcC
Q 024121          243 AGIHELEKSGFRGILMNAVVAAAKRSRELS  272 (272)
Q Consensus       243 ~~l~~l~~~~~~~~~~~~~~~~~~r~~~~~  272 (272)
                      ++++.|+++||+..+.++++++++|++||+
T Consensus       240 ~~l~~le~~g~~~~~~~av~aa~~r~~el~  269 (280)
T 3tri_A          240 QAIKVLESGNLRELFIKALTAAVNRAKELS  269 (280)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCChHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999974



>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3h2z_A Mannitol-1-phosphate 5-dehydrogenase; PSI- protein structure initiative, structural genomics, midwest for structural genomics (MCSG); 1.90A {Shigella flexneri 2a str} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 272
d1yqga1111 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate red 7e-35
d2ahra1104 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate red 3e-33
d1yqga2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 1e-19
d2ahra2152 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductas 3e-16
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 9e-10
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 6e-08
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 3e-06
>d1yqga1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Length = 111 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: ProC C-terminal domain-like
domain: Pyrroline-5-carboxylate reductase ProC
species: Neisseria meningitidis, serogroup B [TaxId: 487]
 Score =  119 bits (300), Expect = 7e-35
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 2/107 (1%)

Query: 168 DEKLFDAITGL--SGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTKSGK 225
           DE+    ITG+  SGPAY+F  ++AL +  +  G     A  L+  T  GA ++  ++G+
Sbjct: 1   DEEKMHGITGISGSGPAYVFYLLDALQNAAIRQGFDMAEARALSLATFKGAVALAEQTGE 60

Query: 226 HPGQLKDDVASPGGTTIAGIHELEKSGFRGILMNAVVAAAKRSRELS 272
              +L+ +V S GGTT   +    +      +   V A  +RS+E+ 
Sbjct: 61  DFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQEME 107


>d2ahra1 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Length = 104 Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Length = 152 Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Length = 152 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query272
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.97
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.96
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.9
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.9
d1yqga1111 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.88
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.86
d2ahra1104 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.86
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.86
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.86
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.83
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.82
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.75
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.75
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.74
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.73
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.71
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.69
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.64
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.62
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.59
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.28
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.19
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 99.15
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 99.02
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 98.9
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.88
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.87
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 98.84
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.83
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.81
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.79
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 98.78
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.76
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 98.71
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.69
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.68
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 98.68
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.68
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.67
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 98.66
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.66
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.66
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.66
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 98.65
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.63
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 98.62
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 98.62
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 98.6
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.57
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 98.55
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 98.52
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 98.49
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.49
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 98.48
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.48
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 98.41
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 98.4
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.39
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 98.35
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 98.33
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 98.31
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 98.29
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 98.28
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 98.27
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 98.25
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 98.25
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 98.21
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.2
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.17
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 98.16
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 98.15
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 98.14
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 98.12
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.09
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 98.09
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 98.07
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 98.07
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 98.05
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.05
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 98.04
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 98.04
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.01
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 98.0
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.99
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 97.99
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.97
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.9
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 97.88
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.86
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.83
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.83
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 97.73
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.71
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.68
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.65
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 97.61
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 97.61
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.55
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.51
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.47
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.46
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 97.44
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.38
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.38
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.36
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.34
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.3
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.27
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 97.2
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 97.18
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.11
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.09
d2f1ka1114 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.05
d2g5ca1110 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.05
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.99
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.98
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.97
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.88
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.83
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.81
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.8
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.8
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.76
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.7
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.69
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 96.64
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.63
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.63
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.62
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.61
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.6
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.59
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.58
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.53
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.49
d2pv7a1128 Prephenate dehydrogenase TyrA {Haemophilus influen 96.48
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.44
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.43
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.43
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.42
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.39
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.39
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.29
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.22
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 96.14
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 96.13
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.1
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 96.09
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 96.04
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 96.02
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 95.97
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 95.92
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.92
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.9
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.87
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 95.86
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.86
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 95.85
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.84
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.83
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.82
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 95.81
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 95.81
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.8
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.79
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.76
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.76
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 95.73
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 95.7
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.7
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 95.7
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.65
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.61
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.6
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.56
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 95.55
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.55
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 95.53
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 95.53
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 95.5
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.48
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 95.48
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.44
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 95.38
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.35
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.26
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.24
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.13
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.06
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 95.03
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 95.0
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.93
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.9
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.89
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 94.89
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.82
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 94.8
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.72
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.72
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.71
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 94.71
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.69
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.69
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.65
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 94.63
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 94.61
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 94.56
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.53
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 94.49
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 94.46
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 94.45
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 94.43
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.43
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 94.35
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 94.33
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 94.33
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 94.28
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 94.25
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 94.23
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.23
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 94.21
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.17
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 94.16
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.11
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 94.09
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.08
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.06
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.02
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 94.0
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 93.99
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.93
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 93.84
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 93.84
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 93.82
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 93.76
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.74
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 93.72
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.71
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.68
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.67
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 93.67
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 93.61
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 93.28
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.19
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 93.16
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.11
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.08
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 92.91
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 92.9
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 92.9
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 92.87
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 92.79
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 92.79
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.73
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 92.72
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 92.64
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 92.63
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 92.56
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 92.55
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.45
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 92.42
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 92.41
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 92.39
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 92.36
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 92.34
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.32
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 92.09
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 92.03
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 92.0
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 92.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 91.86
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 91.83
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 91.75
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 91.71
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.62
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 91.55
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.46
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 91.29
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.28
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 91.27
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 91.25
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 91.22
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 91.17
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 91.0
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.96
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 90.95
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 90.9
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 90.78
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 90.76
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 90.69
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 90.63
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 90.36
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 90.33
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 90.31
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 90.3
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 90.12
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 90.0
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 89.87
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 89.76
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.76
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 89.55
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 89.48
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 89.37
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 89.37
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 89.33
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.27
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 89.22
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.93
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 88.91
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.84
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 88.59
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 88.53
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 88.5
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 88.4
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 88.07
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 87.75
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.62
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 87.44
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 87.41
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.28
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 87.07
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 86.8
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 86.61
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 86.46
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 86.39
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 86.29
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 85.94
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 85.84
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 85.81
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 85.44
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 85.38
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 85.36
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 85.29
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 85.07
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 84.95
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 84.91
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 84.71
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 84.68
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 84.66
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 84.35
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.32
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 84.18
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 84.12
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.01
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 83.93
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 83.9
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 83.34
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 83.17
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 82.75
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 82.53
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 82.1
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.96
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 81.78
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.25
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 81.03
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 80.94
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 80.86
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 80.7
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 80.61
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 80.35
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.19
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Pyrroline-5-carboxylate reductase ProC
species: Streptococcus pyogenes [TaxId: 1314]
Probab=99.97  E-value=1.4e-30  Score=199.42  Aligned_cols=150  Identities=25%  Similarity=0.461  Sum_probs=137.8

Q ss_pred             CeEEEEcccHHHHHHHHHHHhCCCCCCCcEEEEeCCCHHHHHHHHH-cCceeecCchhhhccCCEEEEeeCcccHHHHHH
Q 024121           11 FILGFIGAGKMAESIAKGVAKSGVLPPDRICTAVHSNLKRRDAFES-IGVKVLSDNNAVVEYSDVVVFSVKPQVVKDVAM   89 (272)
Q Consensus        11 ~~IgiIG~G~mG~~la~~l~~~g~~~~~~V~v~~~r~~~~~~~l~~-~g~~~~~~~~~~~~~aDivil~v~~~~~~~v~~   89 (272)
                      |||||||+|+||++|+++|.++|+    ++++| +|++++.+++.+ .|+..+.+++++++++|+||+||+|++++++++
T Consensus         1 MkIg~IG~G~mG~al~~~l~~~~~----~i~v~-~r~~~~~~~l~~~~g~~~~~~~~~~~~~~dvIilavkp~~~~~vl~   75 (152)
T d2ahra2           1 MKIGIIGVGKMASAIIKGLKQTPH----ELIIS-GSSLERSKEIAEQLALPYAMSHQDLIDQVDLVILGIKPQLFETVLK   75 (152)
T ss_dssp             CEEEEECCSHHHHHHHHHHTTSSC----EEEEE-CSSHHHHHHHHHHHTCCBCSSHHHHHHTCSEEEECSCGGGHHHHHT
T ss_pred             CEEEEEeccHHHHHHHHHHHhCCC----eEEEE-cChHHhHHhhccccceeeechhhhhhhccceeeeecchHhHHHHhh
Confidence            799999999999999999999999    99999 999999988866 788888899999999999999999999998886


Q ss_pred             HhchhcCCCCEEEEEcCCCCHHHHHHHhC-CCCEEEEccCchhhhcCCceEEEeCCCCCHHHHHHHHHHhhhcCCeEEcC
Q 024121           90 QIRPLLSRKKLLVSVAAGVKLKDLQEWTG-HSRFIRVMPNTPSAVGEAATVMSLGGTATEEDGELIGKLFGSVGKIWRAD  168 (272)
Q Consensus        90 ~l~~~l~~~~~iis~~~~~~~~~l~~~~~-~~~~~~~~p~~~~~~~~g~~~~~~~~~~~~~~~~~v~~ll~~~G~~~~~~  168 (272)
                      .    ++++++++|+.+|++.+.+++.++ +.+++|+|||.|..++.|.+.++.+...+++..+.++++|+.+|+.++++
T Consensus        76 ~----l~~~~~iis~~agi~~~~l~~~l~~~~~ivr~mPN~~~~v~~g~~~~~~~~~~~~~~~~~v~~l~~~~G~~~~v~  151 (152)
T d2ahra2          76 P----LHFKQPIISMAAGISLQRLATFVGQDLPLLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDIS  151 (152)
T ss_dssp             T----SCCCSCEEECCTTCCHHHHHHHHCTTSCEEEEECCGGGGGTCEEEEEEECTTCCHHHHHHHHHHHHTTEEEEECC
T ss_pred             h----cccceeEecccccccHHHHHhhhcccccchhhccchhhhcCccceEEEeCCCCCHHHHHHHHHHHHhCCCEEEec
Confidence            5    457899999999999999999887 57899999999999999999999888889999999999999999987776


Q ss_pred             c
Q 024121          169 E  169 (272)
Q Consensus       169 e  169 (272)
                      |
T Consensus       152 E  152 (152)
T d2ahra2         152 E  152 (152)
T ss_dssp             G
T ss_pred             C
Confidence            4



>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yqga1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ahra1 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2f1ka1 a.100.1.12 (A:166-279) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2g5ca1 a.100.1.12 (A:201-310) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2pv7a1 a.100.1.12 (A:244-371) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure