Citrus Sinensis ID: 024259

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MNIAVKAAIFNPQNHFINLRAALFHSTPVLERKRRSHWHTPRSHHNFNSYSKRFRRVQSKKSLLRNISAFADHLFQHWQEEINDDDPSSSRGTSWFKKDYGRSKQTRYQGHHGGGRRGAWINEELDEDEGFVDIEHVFESLFGRRQRSHWSFTYEDNTGRRSSYSYGYNYWDHQNWRSRDRQNWRFRVEEDYEFEEESESSESDMASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDKLAVD
ccHHHHHHHcccccHHHHHHHHcccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccc
cHHHHHHHHcccccccHHHHHHHcccccHHHHHHccccccccccccccEHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccc
MNIAVKAaifnpqnhFINLRAAlfhstpvlerkrrshwhtprshhnfnsYSKRFRRVQSKKSLLRNISAFADHLFQHWQeeindddpsssrgtswfkkdygrskqtryqghhgggrrgawineeldedegfvDIEHVFESLFgrrqrshwsftyedntgrrssysygynywdhqnwrsrdrqNWRFRVeedyefeeesessesdmasdrqtlglcasgplkleDVKLAYRVCAlkwhpdrhqgsskAVAEEKFKLCSAAYQSLCDKLAVD
mniavkaaifnpqnhfINLRAALFHSTPVLERKrrshwhtprshhnfnsyskrFRRVQSKKSLLRNISAFADHLFQHWQeeindddpsssrgtswfkkdygrskqtryqghhgggrrgAWINEELDEDEGFVDIEHVFEslfgrrqrshwsftyedntgrrsSYSYgynywdhqnwrsrdrqnWRFRVEEDYEfeeesessesdmasdrQTLGLCASGPLKLEDVKLAYRVCALkwhpdrhqgsskAVAEEKFKLCSAAYQSLCDKLAVD
MNIAVKAAIFNPQNHFINLRAALFHSTPVLERKRRSHWHTPRSHHNFNSYSKRFRRVQSKKSLLRNISAFADHLFQHWQEEINDDDPSSSRGTSWFKKDYGRSKQTRYQghhgggrrgAWINEELDEDEGFVDIEHVFESLFGRRQRSHWSFTYEDNTgrrssysygyNYWDHQNWRSRDRQNWRFRVeedyefeeesessesDMASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDKLAVD
***AVKAAIFNPQNHFINLRAALFHSTPVLER*****************************SLLRNISAFADHLFQHWQ************************************RRGAWINEELDEDEGFVDIEHVFESLFGRRQRSHWSFTYEDNTGRRSSYSYGYNYWDHQNWRSRDRQNWRFRV***********************LGLCASGPLKLEDVKLAYRVCALKWHPD***********EKFKLCSAAYQSLCD*****
************QNHFINLRAALFHSTPV***************************************AFADHLF********************************************WINEELDEDEGFVDIEHVFESLFGRRQRSHWSF********************************************************RQTLGLCASGP***EDVKLAYRVCALKWHPDRHQG*****AEEKFKLCSAAYQSLCDKL***
MNIAVKAAIFNPQNHFINLRAALFHSTPVLERKRRSHWHTPRSHHNFNSYSKRFRRVQSKKSLLRNISAFADHLFQHWQEE***********TSWFKKDYGR*************RRGAWINEELDEDEGFVDIEHVFESLFGRRQRSHWSFTYEDNTGRRSSYSYGYNYWDHQNWRSRDRQNWRFRVEE******************RQTLGLCASGPLKLEDVKLAYRVCALKWHP**********AEEKFKLCSAAYQSLCDKLAVD
*****K******QNHFINLRAALFHSTPVLERKRRSHWHTPRSHHNFNSYSKRFRRVQSKKSLLRNISAFADHLFQHW***************************************GAWINEELDEDEGFVDIEHVFESLFGRRQRSHWSFTYE**************************************************ASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDKLA**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIAVKAAIFNPQNHFINLRAALFHSTPVLERKRRSHWHTPRSHHNFNSYSKRFRRVQSKKSLLRNISAFADHLFQHWQEEINDDDPSSSRGTSWFKKDYGRSKQTRYQGHHGGGRRGAWINEELDEDEGFVDIEHVFESLFGRRQRSHWSFTYEDNTGRRSSYSYGYNYWDHQNWRSRDRQNWRFRVEEDYEFEEESESSESDMASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDKLAVD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query270 2.2.26 [Sep-21-2011]
Q8NHS0 232 DnaJ homolog subfamily B yes no 0.214 0.25 0.491 3e-06
Q9QYI7 227 DnaJ homolog subfamily B yes no 0.214 0.255 0.459 2e-05
A9BNG6 380 Chaperone protein DnaJ OS yes no 0.159 0.113 0.534 4e-05
A1VMG1 380 Chaperone protein DnaJ OS yes no 0.159 0.113 0.534 5e-05
Q87BS9 368 Chaperone protein DnaJ OS yes no 0.151 0.111 0.534 7e-05
B2I6F5 368 Chaperone protein DnaJ OS yes no 0.151 0.111 0.534 7e-05
B0U3J7 368 Chaperone protein DnaJ OS yes no 0.151 0.111 0.534 7e-05
Q9PB06 368 Chaperone protein DnaJ OS yes no 0.151 0.111 0.534 7e-05
B9KFK6 373 Chaperone protein DnaJ OS yes no 0.144 0.104 0.585 8e-05
Q4R7Y5 241 DnaJ homolog subfamily B N/A no 0.155 0.174 0.534 9e-05
>sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 205 MASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLC 264
           MA+  + LG+ AS     ED+K AYR  AL+WHPD++   +K  AE+KFKL S AY+ L 
Sbjct: 1   MANYYEVLGVQASA--SPEDIKKAYRKLALRWHPDKNP-DNKEEAEKKFKLVSEAYEVLS 57

Query: 265 D 265
           D
Sbjct: 58  D 58

Homo sapiens (taxid: 9606)
>sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 Back     alignment and function description
>sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q87BS9|DNAJ_XYLFT Chaperone protein DnaJ OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B2I6F5|DNAJ_XYLF2 Chaperone protein DnaJ OS=Xylella fastidiosa (strain M23) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B0U3J7|DNAJ_XYLFM Chaperone protein DnaJ OS=Xylella fastidiosa (strain M12) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9PB06|DNAJ_XYLFA Chaperone protein DnaJ OS=Xylella fastidiosa (strain 9a5c) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B9KFK6|DNAJ_CAMLR Chaperone protein DnaJ OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
255579747252 heat shock protein binding protein, puta 0.922 0.988 0.567 9e-71
449437573267 PREDICTED: uncharacterized protein LOC10 0.948 0.958 0.490 3e-60
147790737338 hypothetical protein VITISV_009634 [Viti 0.951 0.760 0.514 9e-60
225441457261 PREDICTED: uncharacterized protein LOC10 0.948 0.980 0.512 2e-59
359807024254 uncharacterized protein LOC100807880 [Gl 0.929 0.988 0.520 2e-57
297827875263 DNAJ heat shock N-terminal domain-contai 0.974 1.0 0.474 3e-56
15227500263 DNAJ heat shock N-terminal domain-contai 0.974 1.0 0.470 8e-56
356500431241 PREDICTED: uncharacterized protein LOC10 0.859 0.962 0.465 4e-50
186511163254 DnaJ domain-containing protein [Arabidop 0.9 0.956 0.434 1e-43
297817136250 predicted protein [Arabidopsis lyrata su 0.888 0.96 0.417 8e-43
>gi|255579747|ref|XP_002530712.1| heat shock protein binding protein, putative [Ricinus communis] gi|223529726|gb|EEF31666.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  272 bits (696), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 152/268 (56%), Positives = 184/268 (68%), Gaps = 19/268 (7%)

Query: 1   MNIAVKAAIFNPQNHFINLRAALFHSTPVLERKRRSHWHTPRSHHNFNSYSKRFRRVQSK 60
           MN   KAAIF PQ++   LRAALFHSTPVLERKRR+ W   RS    N YS+R R +  K
Sbjct: 2   MNSGTKAAIFIPQSNCFQLRAALFHSTPVLERKRRNFWDC-RS----NGYSRRSRNLHGK 56

Query: 61  KSLLRNISAFADHLFQHWQEEINDDDPSSSRGTSWFKKDYGRSKQTRYQGHHGGGRRGAW 120
           +SLLRN+SA+AD+LFQ W+++ ++DD SSSRGTSWF+K Y +  +    G  G  R G  
Sbjct: 57  QSLLRNVSAYADYLFQSWKDDFDEDDTSSSRGTSWFRKQYSKGSRRNSTGSQGSRRAGRS 116

Query: 121 INEELDEDEGFVDIEHVFESLFGRRQRSHWSFTYEDNTGRRSSYSYGYNYWDHQNWRSRD 180
              +  EDE  VD+E +F S FG  +  +WSF  E+N   R S +Y  NY++        
Sbjct: 117 F--QFCEDE--VDVESIFRSAFGGNRYFYWSFINEENPHWRRSSNYS-NYYE-------- 163

Query: 181 RQNWRFRVEEDYEFEEESESSESDMASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDR 240
            + WR R E DY+   ES+S  SD+ASDR  LGL ASGPLK+EDVK AYR CALKWHPDR
Sbjct: 164 -RTWRHRFEHDYDSSPESDSLGSDLASDRLALGLSASGPLKIEDVKNAYRACALKWHPDR 222

Query: 241 HQGSSKAVAEEKFKLCSAAYQSLCDKLA 268
           HQGSSKA+AEEKFKLCSAAYQSLCDKLA
Sbjct: 223 HQGSSKAIAEEKFKLCSAAYQSLCDKLA 250

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449437573|ref|XP_004136566.1| PREDICTED: uncharacterized protein LOC101221203 [Cucumis sativus] gi|449511332|ref|XP_004163928.1| PREDICTED: uncharacterized LOC101221203 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147790737|emb|CAN63574.1| hypothetical protein VITISV_009634 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225441457|ref|XP_002279725.1| PREDICTED: uncharacterized protein LOC100250423 [Vitis vinifera] gi|297739831|emb|CBI30013.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359807024|ref|NP_001241336.1| uncharacterized protein LOC100807880 [Glycine max] gi|255636268|gb|ACU18474.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297827875|ref|XP_002881820.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327659|gb|EFH58079.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15227500|ref|NP_181738.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|1871176|gb|AAB63536.1| unknown protein [Arabidopsis thaliana] gi|22531201|gb|AAM97104.1| unknown protein [Arabidopsis thaliana] gi|25083942|gb|AAN72139.1| unknown protein [Arabidopsis thaliana] gi|330254974|gb|AEC10068.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356500431|ref|XP_003519035.1| PREDICTED: uncharacterized protein LOC100812123 [Glycine max] Back     alignment and taxonomy information
>gi|186511163|ref|NP_191361.2| DnaJ domain-containing protein [Arabidopsis thaliana] gi|19423977|gb|AAL87325.1| unknown protein [Arabidopsis thaliana] gi|332646209|gb|AEE79730.1| DnaJ domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297817136|ref|XP_002876451.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322289|gb|EFH52710.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query270
TAIR|locus:2064622263 AT2G42080 "AT2G42080" [Arabido 0.970 0.996 0.439 3.4e-54
TAIR|locus:2095818254 AT3G58020 [Arabidopsis thalian 0.929 0.988 0.410 5e-44
TAIR|locus:504955938268 AT2G18465 "AT2G18465" [Arabido 0.9 0.906 0.310 4e-19
WB|WBGene00001042 249 dnj-24 [Caenorhabditis elegans 0.2 0.216 0.491 1.2e-05
TAIR|locus:2174170128 AT5G16650 [Arabidopsis thalian 0.151 0.320 0.511 1.2e-05
GENEDB_PFALCIPARUM|PFE0055c 402 PFE0055c "heat shock protein, 0.162 0.109 0.511 5.6e-05
UNIPROTKB|Q8I489 402 PFE0055c "Heat shock protein, 0.162 0.109 0.511 5.6e-05
UNIPROTKB|C9J2C4 228 DNAJB6 "DnaJ homolog subfamily 0.155 0.184 0.534 0.00014
UNIPROTKB|Q4R7Y5 241 DNAJB6 "DnaJ homolog subfamily 0.155 0.174 0.534 0.00017
UNIPROTKB|Q0III6 242 DNAJB6 "DnaJ homolog subfamily 0.155 0.173 0.534 0.00017
TAIR|locus:2064622 AT2G42080 "AT2G42080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 560 (202.2 bits), Expect = 3.4e-54, P = 3.4e-54
 Identities = 119/271 (43%), Positives = 161/271 (59%)

Query:     1 MNIAVKAAIFNPQNHFINLRAALFHSTPVLERKRRSHWHTPRSHHNFNSYSKRFRRVQSK 60
             MN A++AAI  PQ++   L+ A FHSTPVLERKRR+ W +  + H      KRFRR++ K
Sbjct:     1 MNAAIRAAILRPQSYSSQLKTAFFHSTPVLERKRRTSWESKANVHK-----KRFRRMREK 55

Query:    61 KSLLRNISAFADHLFQHWQEEINDDDPSSSRGTSWFKKDYGRSKQTRYQXXXXXXXXXAW 120
             + LLRN++AFA ++F  W +E +DD PSS + TSWFKK Y +  +   Q           
Sbjct:    56 QELLRNVNAFAANMFTSWHDEFDDDGPSSRKQTSWFKKQYSKEPKGN-QNNKHGPYTWGK 114

Query:   121 INEELDE-DEGFVDIEHVFESLFGRRQRSHWSFTYEDNTXXXXXXXXXXNYWDHQNWRSR 179
              N +  E DE F D+++VF + FG  +   +SFT+E++           +   +++WRS+
Sbjct:   115 RNFDFCEVDEDF-DVDYVFRTAFGGSRGFSFSFTHEEDEPRWRHHSSRFSNNSNRSWRSK 173

Query:   180 DRQNWRFRVXXXXXXXXXXXXXXXDMASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPD 239
              R +                    +  S RQ LGL  SGPL L+DVK AYR CALKWHPD
Sbjct:   174 YRLD-EDEEEEDYTSDSSDSESEPNQVSHRQALGLSPSGPLNLKDVKHAYRTCALKWHPD 232

Query:   240 RHQGSSKAVAEEKFKLCSAAYQSLCDKLAVD 270
             RHQGS+K  AE KFKLCS AYQSLC+KL+V+
Sbjct:   233 RHQGSTKEAAEAKFKLCSVAYQSLCEKLSVN 263
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
TAIR|locus:2095818 AT3G58020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955938 AT2G18465 "AT2G18465" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00001042 dnj-24 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2174170 AT5G16650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFE0055c PFE0055c "heat shock protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I489 PFE0055c "Heat shock protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|C9J2C4 DNAJB6 "DnaJ homolog subfamily B member 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7Y5 DNAJB6 "DnaJ homolog subfamily B member 6" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q0III6 DNAJB6 "DnaJ homolog subfamily B member 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 7e-11
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 6e-10
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-10
pfam0022663 pfam00226, DnaJ, DnaJ domain 9e-09
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-08
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 7e-08
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 7e-08
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 8e-07
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 8e-07
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 4e-06
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 7e-06
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-05
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 4e-05
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 5e-05
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 7e-05
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 7e-05
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-05
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-04
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-04
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 1e-04
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 2e-04
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-04
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 7e-04
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 8e-04
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 0.001
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 0.001
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 0.002
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 0.003
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information 
 Score = 56.1 bits (136), Expect = 7e-11
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 212 LGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDK 266
           LG+     L  +++K AYR  ALK+HPD++ G  K  AEEKFK  + AY+ L D 
Sbjct: 7   LGVPRDASL--DEIKKAYRKLALKYHPDKNPG-DKEEAEEKFKEINEAYEVLSDP 58

Length = 60
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 270
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.78
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.71
PRK14288 369 chaperone protein DnaJ; Provisional 99.63
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.62
PRK14296 372 chaperone protein DnaJ; Provisional 99.61
PRK14279 392 chaperone protein DnaJ; Provisional 99.59
PRK14286 372 chaperone protein DnaJ; Provisional 99.58
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.58
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
PRK14282 369 chaperone protein DnaJ; Provisional 99.56
PRK14285 365 chaperone protein DnaJ; Provisional 99.55
PRK14287 371 chaperone protein DnaJ; Provisional 99.55
PRK14295 389 chaperone protein DnaJ; Provisional 99.54
PRK14277 386 chaperone protein DnaJ; Provisional 99.54
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.54
PRK14283 378 chaperone protein DnaJ; Provisional 99.53
PRK14297 380 chaperone protein DnaJ; Provisional 99.53
PRK14278 378 chaperone protein DnaJ; Provisional 99.53
PRK14276 380 chaperone protein DnaJ; Provisional 99.53
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.52
PRK14301 373 chaperone protein DnaJ; Provisional 99.52
PRK14299 291 chaperone protein DnaJ; Provisional 99.52
PRK14298 377 chaperone protein DnaJ; Provisional 99.52
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.52
PRK14294 366 chaperone protein DnaJ; Provisional 99.51
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
PRK10767 371 chaperone protein DnaJ; Provisional 99.51
PRK14280 376 chaperone protein DnaJ; Provisional 99.51
PRK14284 391 chaperone protein DnaJ; Provisional 99.51
PRK14291 382 chaperone protein DnaJ; Provisional 99.5
PRK14281 397 chaperone protein DnaJ; Provisional 99.5
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
PRK14290 365 chaperone protein DnaJ; Provisional 99.48
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.46
PRK14289 386 chaperone protein DnaJ; Provisional 99.45
PRK14292 371 chaperone protein DnaJ; Provisional 99.45
PRK14300 372 chaperone protein DnaJ; Provisional 99.44
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.44
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.43
PRK14293 374 chaperone protein DnaJ; Provisional 99.41
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.4
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.36
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.33
PRK05014 171 hscB co-chaperone HscB; Provisional 99.32
PRK00294 173 hscB co-chaperone HscB; Provisional 99.26
PRK01356166 hscB co-chaperone HscB; Provisional 99.26
PRK03578 176 hscB co-chaperone HscB; Provisional 99.25
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.25
PHA03102153 Small T antigen; Reviewed 99.22
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.18
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.18
PTZ00100116 DnaJ chaperone protein; Provisional 99.16
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.09
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.04
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.01
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 98.99
PRK01773 173 hscB co-chaperone HscB; Provisional 98.87
PHA02624 647 large T antigen; Provisional 98.83
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.82
TIGR00714 157 hscB Fe-S protein assembly co-chaperone HscB. This 98.66
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 98.54
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 98.53
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.33
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.17
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 97.84
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.16
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.8
KOG0431453 consensus Auxilin-like protein and related protein 96.52
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 96.08
COG1076 174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.73
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 85.33
PF1344662 RPT: A repeated domain in UCH-protein 83.02
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.78  E-value=2.1e-19  Score=172.33  Aligned_cols=61  Identities=39%  Similarity=0.536  Sum_probs=57.9

Q ss_pred             ccccchhcCcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHHHHHHHccCCCCC
Q 024259          205 MASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDKLAV  269 (270)
Q Consensus       205 ~~d~YeVLGL~~~a~lt~~eIKkAYRkLAlk~HPDK~~~~~k~~AeekFk~I~eAYevLsDp~k~  269 (270)
                      ..+||+||||+++|  +.+|||+|||+||++||||+++++  ++|+++|++|++||+||+||+|.
T Consensus         3 ~~dyYeiLGV~k~A--s~~EIKkAYRkLA~kyHPD~n~g~--~~AeeKFKEI~eAYEVLsD~eKR   63 (371)
T COG0484           3 KRDYYEILGVSKDA--SEEEIKKAYRKLAKKYHPDRNPGD--KEAEEKFKEINEAYEVLSDPEKR   63 (371)
T ss_pred             ccchhhhcCCCCCC--CHHHHHHHHHHHHHHhCCCCCCCC--HHHHHHHHHHHHHHHHhCCHHHH
Confidence            47899999999999  999999999999999999999964  78999999999999999999875

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 8e-07
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 6e-05
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 3e-04
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 4e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 5e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 3/61 (4%)
Query: 205 MASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLC 264
           MA+  + LG+ AS     ED+K AYR  AL+WHPD++   +K  AE+KFKL S AY+ L 
Sbjct: 8   MANYYEVLGVQASA--SPEDIKKAYRKLALRWHPDKNP-DNKEEAEKKFKLVSEAYEVLS 64
Query: 265 D 265
           D
Sbjct: 65  D 65
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query270
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 3e-11
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-11
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 5e-11
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 4e-10
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 6e-10
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 8e-10
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 1e-09
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-09
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-09
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 2e-09
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 3e-09
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-09
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 6e-09
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-08
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-08
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 4e-08
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-08
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-07
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-07
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 4e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-07
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 1e-06
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 1e-06
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 4e-06
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 9e-06
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-05
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-05
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 9e-05
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 1e-04
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-04
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 3e-04
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
 Score = 57.3 bits (139), Expect = 3e-11
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 223 EDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDK 266
           E +K AYR  ALKWHPD++   +K  AE +FK  + AY+ L D 
Sbjct: 24  EAIKKAYRKLALKWHPDKNPE-NKEEAERRFKQVAEAYEVLSDA 66
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.67
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.66
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.66
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.66
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.65
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.65
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.65
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.65
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.64
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.63
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.62
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.62
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.62
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.61
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.6
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.58
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.57
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.56
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.55
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.54
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.54
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.53
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.52
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 99.51
2guz_A71 Mitochondrial import inner membrane translocase su 99.5
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.49
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 99.48
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.48
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.46
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.45
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.32
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 99.3
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.72
2guz_B65 Mitochondrial import inner membrane translocase su 98.52
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 82.24
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.67  E-value=4.5e-17  Score=122.78  Aligned_cols=64  Identities=38%  Similarity=0.560  Sum_probs=57.8

Q ss_pred             CCCccccchhcCcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHHHHHHHccCCCC
Q 024259          202 ESDMASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDKLA  268 (270)
Q Consensus       202 ~~~~~d~YeVLGL~~~a~lt~~eIKkAYRkLAlk~HPDK~~~~~k~~AeekFk~I~eAYevLsDp~k  268 (270)
                      .....++|+||||++++  +.++||+||++|+++||||+++.. .+.++++|++|++||++|+||.+
T Consensus         5 ~~~~~~~y~iLgv~~~a--s~~eIk~ayr~l~~~~HPDk~~~~-~~~a~~~f~~i~~Ay~~L~d~~~   68 (82)
T 2ej7_A            5 SSGMVDYYEVLDVPRQA--SSEAIKKAYRKLALKWHPDKNPEN-KEEAERRFKQVAEAYEVLSDAKK   68 (82)
T ss_dssp             CSSSCCHHHHTTCCTTC--CHHHHHHHHHHHHTTSCTTTCSTT-HHHHHHHHHHHHHHHHHHSSTTH
T ss_pred             CCCCcCHHHHcCCCCCC--CHHHHHHHHHHHHHHHCcCCCCCc-HHHHHHHHHHHHHHHHHHCCHHH
Confidence            34567999999999999  999999999999999999998764 35789999999999999999975
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 270
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-04
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-04
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 38.0 bits (88), Expect = 1e-04
 Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 223 EDVKLAYRVCALKWHPDRHQGS-SKAVAEEKFKLCSAAYQSLCDK 266
           E VK  YR   L  HPD+  G   +  A+  F   + A+    ++
Sbjct: 48  EQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQ 92
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query270
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.72
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.65
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.61
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.59
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.58
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.53
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.49
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.72  E-value=3.7e-18  Score=126.65  Aligned_cols=59  Identities=36%  Similarity=0.580  Sum_probs=55.1

Q ss_pred             cccchhcCcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHHHHHHHccCCCC
Q 024259          206 ASDRQTLGLCASGPLKLEDVKLAYRVCALKWHPDRHQGSSKAVAEEKFKLCSAAYQSLCDKLA  268 (270)
Q Consensus       206 ~d~YeVLGL~~~a~lt~~eIKkAYRkLAlk~HPDK~~~~~k~~AeekFk~I~eAYevLsDp~k  268 (270)
                      .+||+||||++++  +.++||+|||+|+++||||+++++  +.++++|++|++||+||+||.+
T Consensus         3 ~dyY~vLgv~~~A--s~~eIk~aYr~l~~~~HPDk~~~~--~~~~~~f~~i~~Ay~vL~d~~~   61 (75)
T d1xbla_           3 QDYYEILGVSKTA--EEREIRKAYKRLAMKYHPDRNQGD--KEAEAKFKEIKEAYEVLTDSQK   61 (75)
T ss_dssp             CCTTTTTCCSSSC--CHHHHHHHHHHHHHHTCCTTCTTT--CHHHHHHHHHHHHHHHTTSSHH
T ss_pred             CCHHHHcCCCCCc--CHHHHHHHHHHHHhhhhhhccCCC--hHHHHHHHHHHHHHHhcCCHHH
Confidence            5899999999999  999999999999999999999865  4688899999999999999975
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure