Citrus Sinensis ID: 024331


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYKLKDL
ccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccEEEEEEEEcccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHccccccHHcccEEccccccccc
ccEEEEEEcccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccEEEEEcHHHHHHHHcccccHccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccHHHHccccccccccccc
MEVVQVLHmnggvggtsyasNSLVQEKVISIAKPITEEAMTklfcstsptkvaiadlgcssgpnTLLVASELIKVVNKICDKLGSQLPEFQVFlndlpgndfnTIFRSLASFQKILRKQLgsasgaagqcfftgvpgsfygrlfprnsvhlfhssyslqwlsqvpdglesnkgnifmastsppcvlTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLgrksqdpsskecCYIWELLATALNNMVSEVTKSFLLLIVFNQlnyklkdl
MEVVQVLhmnggvggtsyasnslVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTflgrksqdpssKECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYKLKDL
MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYKLKDL
*****VLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGR*******KECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYK****
*E*VQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYKLK**
MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLG********KECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYKLKDL
*EVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYKLK*L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSEVTKSFLLLIVFNQLNYKLKDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q9SPV4359 Salicylate O-methyltransf N/A no 0.881 0.660 0.616 5e-86
Q9SBK6 392 Jasmonate O-methyltransfe N/A no 0.921 0.632 0.501 9e-64
Q9FZN8369 Caffeine synthase 1 OS=Ca N/A no 0.892 0.650 0.472 9e-60
Q9AR07 389 Jasmonate O-methyltransfe no no 0.918 0.634 0.507 2e-59
Q68CM3365 Probable caffeine synthas N/A no 0.892 0.657 0.470 4e-59
Q9FYZ9 364 Benzoate carboxyl methylt N/A no 0.855 0.631 0.481 7e-57
Q9AVK1 385 Probable caffeine synthas N/A no 0.888 0.620 0.432 1e-53
Q9AVL9 385 Probable caffeine synthas N/A no 0.888 0.620 0.432 2e-53
Q8H0D2 384 3,7-dimethylxanthine N-me N/A no 0.884 0.619 0.429 3e-53
Q9AVK0372 7-methylxanthosine syntha N/A no 0.895 0.647 0.416 2e-50
>sp|Q9SPV4|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1 Back     alignment and function desciption
 Score =  317 bits (812), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 154/250 (61%), Positives = 184/250 (73%), Gaps = 13/250 (5%)

Query: 1   MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFC-STSPTKVAIADLGC 59
           M+V QVLHM GG G  SYA NS +Q +VISI KPITE A+T L+   T  T++AIADLGC
Sbjct: 1   MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGC 60

Query: 60  SSGPNTLLVASELIKVVNKICDKLGSQ-LPEFQVFLNDLPGNDFNTIFRSLASFQKILRK 118
           SSGPN L   +ELIK V ++  K+G +  PE+Q+FLNDLPGNDFN IFRSL     +   
Sbjct: 61  SSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDV--- 117

Query: 119 QLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMA 178
                    G CF  GVPGSFYGRLFPRN++H  HSSYSL WLSQVP G+ESNKGNI+MA
Sbjct: 118 --------DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIESNKGNIYMA 169

Query: 179 STSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELL 238
           +T P  VL AYY+QFQ D +LFL+CR++E+V  GRMVLT LGR+S+D +S ECC IW+LL
Sbjct: 170 NTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLL 229

Query: 239 ATALNNMVSE 248
           A ALN MVSE
Sbjct: 230 AMALNQMVSE 239




Catalyzes the methylation of the free carboxyl end of the plant hormone salicylic acid (SA). Converts SA to SA methyl ester (MSA). The volatile compound MSA is hypothesized to act as an airborne signal that triggers defense responses in uninfected plants. MSA is an important chemoattractant for moth pollinated flowering plants.
Clarkia breweri (taxid: 36903)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: nEC: 9
>sp|Q9SBK6|JMT_BRARP Jasmonate O-methyltransferase OS=Brassica rapa subsp. pekinensis GN=JMT PE=1 SV=1 Back     alignment and function description
>sp|Q9FZN8|TCS1_CAMSI Caffeine synthase 1 OS=Camellia sinensis GN=TCS1 PE=1 SV=1 Back     alignment and function description
>sp|Q9AR07|JMT_ARATH Jasmonate O-methyltransferase OS=Arabidopsis thaliana GN=JMT PE=1 SV=3 Back     alignment and function description
>sp|Q68CM3|TCS2_CAMSI Probable caffeine synthase 2 OS=Camellia sinensis GN=TCS2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FYZ9|BAMT_ANTMA Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9AVK1|CS3_COFAR Probable caffeine synthase 3 OS=Coffea arabica GN=CS3 PE=2 SV=1 Back     alignment and function description
>sp|Q9AVL9|CS4_COFAR Probable caffeine synthase 4 OS=Coffea arabica GN=CS4 PE=2 SV=1 Back     alignment and function description
>sp|Q8H0D2|DXMT1_COFAR 3,7-dimethylxanthine N-methyltransferase OS=Coffea arabica GN=DXMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9AVK0|XMT1_COFAR 7-methylxanthosine synthase 1 OS=Coffea arabica GN=XMT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
255561056366 Benzoate carboxyl methyltransferase, put 0.910 0.669 0.709 1e-102
255561060366 Benzoate carboxyl methyltransferase, put 0.910 0.669 0.713 1e-102
225430676364 PREDICTED: salicylate O-methyltransferas 0.910 0.673 0.705 1e-100
440550959367 salicylic acid carboxyl methyltransferas 0.910 0.667 0.722 1e-100
224097038364 predicted protein [Populus trichocarpa] 0.910 0.673 0.721 1e-100
297735107327 unnamed protein product [Vitis vinifera] 0.910 0.749 0.701 2e-98
359476667364 PREDICTED: salicylate O-methyltransferas 0.910 0.673 0.701 2e-98
359476672363 PREDICTED: salicylate O-methyltransferas 0.907 0.672 0.701 1e-97
297735106306 unnamed protein product [Vitis vinifera] 0.881 0.774 0.7 9e-97
351726307 370 salicylic acid methyl transferase-like p 0.903 0.656 0.678 1e-96
>gi|255561056|ref|XP_002521540.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] gi|223539218|gb|EEF40811.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/248 (70%), Positives = 203/248 (81%), Gaps = 3/248 (1%)

Query: 1   MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTKVAIADLGCS 60
           MEV QVLHMNGG+G TSYA NSLVQ+KVIS+ KPITEEAMT L+CS SP  ++IAD+GCS
Sbjct: 1   MEVGQVLHMNGGMGDTSYAQNSLVQQKVISMTKPITEEAMTNLYCSISPKSLSIADMGCS 60

Query: 61  SGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQL 120
           SGPN+L   SELI+ V  IC KLG Q PE+QVFLNDLPGNDFNTIFRSL  F++ + KQ+
Sbjct: 61  SGPNSLFAVSELIRAVETICGKLGHQSPEYQVFLNDLPGNDFNTIFRSLTGFKEQVEKQV 120

Query: 121 GSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMAST 180
                + G CFF+GVPGSFYGRLFP  ++H  HSSYSLQWLSQVPDG+E N GNI+MAS 
Sbjct: 121 ---EVSVGPCFFSGVPGSFYGRLFPSKALHFVHSSYSLQWLSQVPDGIEGNDGNIYMASD 177

Query: 181 SPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELLAT 240
           SPP VL AYY QFQ+DFS+FLKCRSEELV  GRMVLTFLGR+S+DP+SKECCYIW+LLA 
Sbjct: 178 SPPSVLQAYYRQFQKDFSMFLKCRSEELVPGGRMVLTFLGRRSEDPASKECCYIWKLLAM 237

Query: 241 ALNNMVSE 248
            L  +V E
Sbjct: 238 VLGELVLE 245




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255561060|ref|XP_002521542.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] gi|223539220|gb|EEF40813.1| Benzoate carboxyl methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225430676|ref|XP_002262676.1| PREDICTED: salicylate O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|440550959|gb|AGC11863.1| salicylic acid carboxyl methyltransferase [Camellia japonica] Back     alignment and taxonomy information
>gi|224097038|ref|XP_002310820.1| predicted protein [Populus trichocarpa] gi|118486393|gb|ABK95036.1| unknown [Populus trichocarpa] gi|222853723|gb|EEE91270.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297735107|emb|CBI17469.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476667|ref|XP_002262759.2| PREDICTED: salicylate O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476672|ref|XP_002263123.2| PREDICTED: salicylate O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735106|emb|CBI17468.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351726307|ref|NP_001237122.1| salicylic acid methyl transferase-like protein [Glycine max] gi|194136583|gb|ACF33514.1| salicylic acid methyl transferase-like protein [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
TAIR|locus:2013149 389 JMT "jasmonic acid carboxyl me 0.918 0.634 0.511 9e-61
TAIR|locus:2080747379 BSMT1 [Arabidopsis thaliana (t 0.936 0.664 0.477 3.1e-60
TAIR|locus:2144466 368 AT5G38020 [Arabidopsis thalian 0.881 0.644 0.491 1.5e-58
TAIR|locus:2154845354 AT5G66430 [Arabidopsis thalian 0.858 0.652 0.473 2.5e-58
TAIR|locus:2179929415 NAMT1 [Arabidopsis thaliana (t 0.884 0.573 0.481 2.8e-57
TAIR|locus:2179969385 AT5G04380 "AT5G04380" [Arabido 0.869 0.607 0.476 8.6e-56
TAIR|locus:2095572 368 AT3G21950 [Arabidopsis thalian 0.881 0.644 0.459 4.8e-55
TAIR|locus:2115400371 AT4G36470 [Arabidopsis thalian 0.888 0.644 0.461 1.7e-52
TAIR|locus:2053458 359 AT2G14060 [Arabidopsis thalian 0.869 0.651 0.448 1.1e-50
TAIR|locus:2161680386 IAMT1 "AT5G55250" [Arabidopsis 0.843 0.588 0.390 4.9e-37
TAIR|locus:2013149 JMT "jasmonic acid carboxyl methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 622 (224.0 bits), Expect = 9.0e-61, P = 9.0e-61
 Identities = 135/264 (51%), Positives = 169/264 (64%)

Query:     1 MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSP-TKVAIADLGC 59
             MEV++VLHMN G G TSYA NS  Q  +IS+ + + +EA+ KL  S S  + + IADLGC
Sbjct:     1 MEVMRVLHMNKGNGETSYAKNSTAQSNIISLGRRVMDEALKKLMMSNSEISSIGIADLGC 60

Query:    60 SSGPNTLLVASELIKVVNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKIL--- 116
             SSGPN+LL  S ++  ++ +C  L   +PE +V LNDLP NDFN I  SL  F   +   
Sbjct:    61 SSGPNSLLSISNIVDTIHNLCPDLDRPVPELRVSLNDLPSNDFNYICASLPEFYDRVNNN 120

Query:   117 RKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVP-------D--- 166
             ++ LG   G    CF + VPGSFYGRLFPR S+H  HSS SL WLSQVP       D   
Sbjct:   121 KEGLGFGRGGGESCFVSAVPGSFYGRLFPRRSLHFVHSSSSLHWLSQVPCREAEKEDRTI 180

Query:   167 --GLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQ 224
                LE N G I+++ TSP     AY  QFQ DF +FL+ RSEELV  GRMVL+FLGR+S 
Sbjct:   181 TADLE-NMGKIYISKTSPKSAHKAYALQFQTDFWVFLRSRSEELVPGGRMVLSFLGRRSL 239

Query:   225 DPSSKECCYIWELLATALNNMVSE 248
             DP+++E CY WELLA AL +M  E
Sbjct:   240 DPTTEESCYQWELLAQALMSMAKE 263




GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=NAS
GO:0009611 "response to wounding" evidence=IEP;RCA
GO:0009694 "jasmonic acid metabolic process" evidence=IDA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA;IDA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA;IMP
GO:0030795 "jasmonate O-methyltransferase activity" evidence=IMP;IDA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009620 "response to fungus" evidence=RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
TAIR|locus:2080747 BSMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144466 AT5G38020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154845 AT5G66430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179929 NAMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179969 AT5G04380 "AT5G04380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095572 AT3G21950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115400 AT4G36470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053458 AT2G14060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161680 IAMT1 "AT5G55250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
pfam03492331 pfam03492, Methyltransf_7, SAM dependent carboxyl 1e-109
PLN02668386 PLN02668, PLN02668, indole-3-acetate carboxyl meth 2e-52
>gnl|CDD|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase Back     alignment and domain information
 Score =  318 bits (816), Expect = e-109
 Identities = 123/221 (55%), Positives = 146/221 (66%), Gaps = 19/221 (8%)

Query: 36  TEEAMTKLFC-STSPTKVAIADLGCSSGPNTLLVASELIKVVNKICDKLG-SQLPEFQVF 93
            EEA+++L   +  P  + IADLGCSSGPNT L  S +I  V K   K    + PEFQVF
Sbjct: 1   LEEAISELLLRNLFPNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKENILEPPEFQVF 60

Query: 94  LNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFH 153
            NDLP NDFNT+F+ L  FQK  R             F +GVPGSFYGRLFPRNS+H  H
Sbjct: 61  FNDLPSNDFNTLFKLLPPFQKKKRS-----------YFVSGVPGSFYGRLFPRNSLHFVH 109

Query: 154 SSYSLQWLSQVPDGLES------NKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEE 207
           SSYSL WLSQVP GLE       NKGNI+++  SP  V  AY +QF++DFSLFL+ R+EE
Sbjct: 110 SSYSLHWLSQVPKGLEDKESPAWNKGNIYISGASPEEVYKAYLDQFKKDFSLFLRARAEE 169

Query: 208 LVAEGRMVLTFLGRKSQDPSSKECCYIWELLATALNNMVSE 248
           LV+ G MVLTFLGR S DPS  EC   W+LL  ALN++VSE
Sbjct: 170 LVSGGLMVLTFLGRPSVDPSETECGIFWDLLGDALNDLVSE 210


This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331

>gnl|CDD|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
PLN02668386 indole-3-acetate carboxyl methyltransferase 100.0
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 100.0
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.22
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.2
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.1
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.04
PLN02233261 ubiquinone biosynthesis methyltransferase 98.91
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.9
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.88
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.83
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.76
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.75
PLN02244340 tocopherol O-methyltransferase 98.68
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.66
PRK06922677 hypothetical protein; Provisional 98.59
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.57
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.57
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.57
PLN02336475 phosphoethanolamine N-methyltransferase 98.55
PRK08317241 hypothetical protein; Provisional 98.48
PRK11207197 tellurite resistance protein TehB; Provisional 98.48
PLN02336 475 phosphoethanolamine N-methyltransferase 98.46
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.46
PRK05785226 hypothetical protein; Provisional 98.46
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.45
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.44
KOG2940 325 consensus Predicted methyltransferase [General fun 98.43
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.43
PRK12335287 tellurite resistance protein TehB; Provisional 98.43
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.37
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.36
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.34
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.33
PRK06202232 hypothetical protein; Provisional 98.33
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.3
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.29
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.27
PLN02490340 MPBQ/MSBQ methyltransferase 98.26
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.26
TIGR03438301 probable methyltransferase. This model represents 98.25
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.24
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.23
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.23
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.21
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.2
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.19
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.18
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.17
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.14
TIGR00452314 methyltransferase, putative. Known examples to dat 98.13
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.09
PTZ00146293 fibrillarin; Provisional 98.05
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.02
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.0
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.97
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.97
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.94
PRK04266226 fibrillarin; Provisional 97.93
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.88
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 97.88
KOG3010261 consensus Methyltransferase [General function pred 97.86
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.83
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.83
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.82
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 97.82
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.81
KOG4300252 consensus Predicted methyltransferase [General fun 97.79
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.75
COG4123248 Predicted O-methyltransferase [General function pr 97.75
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.74
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.72
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.68
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.68
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.64
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.63
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 97.61
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.55
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.54
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.52
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 97.5
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.49
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.49
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.44
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 97.44
PRK14967223 putative methyltransferase; Provisional 97.42
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.4
TIGR00536284 hemK_fam HemK family putative methylases. The gene 97.4
KOG3045325 consensus Predicted RNA methylase involved in rRNA 97.37
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.34
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.29
TIGR00438188 rrmJ cell division protein FtsJ. 97.29
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.28
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 97.28
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.27
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.25
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.23
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.21
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.21
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 97.19
KOG2361264 consensus Predicted methyltransferase [General fun 97.16
PRK10901427 16S rRNA methyltransferase B; Provisional 97.14
PRK14968188 putative methyltransferase; Provisional 97.01
PLN03075296 nicotianamine synthase; Provisional 96.99
PRK14903431 16S rRNA methyltransferase B; Provisional 96.94
PRK14901434 16S rRNA methyltransferase B; Provisional 96.92
PHA03411279 putative methyltransferase; Provisional 96.91
PLN02232160 ubiquinone biosynthesis methyltransferase 96.79
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 96.78
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.73
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.72
COG2890280 HemK Methylase of polypeptide chain release factor 96.71
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 96.69
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 96.68
PRK14902444 16S rRNA methyltransferase B; Provisional 96.67
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.67
PRK14904445 16S rRNA methyltransferase B; Provisional 96.61
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 96.54
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 96.53
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 96.53
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.51
KOG2904328 consensus Predicted methyltransferase [General fun 96.47
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.47
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 96.29
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 96.28
KOG1331293 consensus Predicted methyltransferase [General fun 96.24
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 96.17
PRK07402196 precorrin-6B methylase; Provisional 96.16
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 96.15
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 96.14
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 96.03
smart00650169 rADc Ribosomal RNA adenine dimethylases. 95.98
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 95.98
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 95.88
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 95.84
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 95.7
PRK13256226 thiopurine S-methyltransferase; Reviewed 95.69
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 95.62
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 95.55
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 95.35
PLN02672 1082 methionine S-methyltransferase 95.3
PRK00811283 spermidine synthase; Provisional 95.29
PRK03612521 spermidine synthase; Provisional 95.17
PHA03412241 putative methyltransferase; Provisional 94.95
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 94.9
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 94.53
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 94.49
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 94.42
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 94.36
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 94.29
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 94.26
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 94.1
PRK04457262 spermidine synthase; Provisional 94.07
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 94.05
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 93.86
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 93.54
PLN02366308 spermidine synthase 93.5
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 92.79
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 92.47
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 92.39
PRK01581374 speE spermidine synthase; Validated 92.01
PRK10611287 chemotaxis methyltransferase CheR; Provisional 90.59
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 90.35
PF13679141 Methyltransf_32: Methyltransferase domain 89.6
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 89.14
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 89.05
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 88.12
PLN02589247 caffeoyl-CoA O-methyltransferase 87.94
PLN02476278 O-methyltransferase 87.48
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 87.46
KOG2899288 consensus Predicted methyltransferase [General fun 87.37
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 87.09
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 86.88
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 86.76
COG4122219 Predicted O-methyltransferase [General function pr 86.53
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 86.46
COG2263198 Predicted RNA methylase [Translation, ribosomal st 86.04
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 83.59
COG4976287 Predicted methyltransferase (contains TPR repeat) 83.12
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 83.04
PRK04148134 hypothetical protein; Provisional 83.04
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 82.12
PTZ00338294 dimethyladenosine transferase-like protein; Provis 81.73
KOG1271227 consensus Methyltransferases [General function pre 81.69
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 81.19
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 80.34
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 80.03
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
Probab=100.00  E-value=7e-83  Score=604.57  Aligned_cols=261  Identities=37%  Similarity=0.622  Sum_probs=237.8

Q ss_pred             CcccceeeccCCCCCchHHHhcHHHHHHHHHHHHHHHHHHHhhcccCCC-CceEEEeecCCCCcccHHHHHHHHHHHHHH
Q 024331            1 MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSP-TKVAIADLGCSSGPNTLLVASELIKVVNKI   79 (269)
Q Consensus         1 ~~~~~~l~M~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~~~-~~~~IaD~GCs~G~Ns~~~~~~ii~~i~~~   79 (269)
                      |+++++|||+||+|++||++||.+|+.++..++|+|+++|++++....+ ++++|||||||+|+||+.++++||++|+++
T Consensus        13 m~~~~~l~M~gG~g~~SYa~nS~~Q~~~~~~~k~~leeai~~~~~~~~p~~~~~iaDlGcs~G~ntl~~vs~iI~~i~~~   92 (386)
T PLN02668         13 MKLEKLLCMKGGKGEGSYANNSQAQALHARSMLHLLEETLDNVHLNSSPEVPFTAVDLGCSSGSNTIHIIDVIVKHMSKR   92 (386)
T ss_pred             ceeccccccCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCcceeEEEecCCCCccHHHHHHHHHHHHHHH
Confidence            7899999999999999999999999999999999999999998654434 689999999999999999999999999999


Q ss_pred             HHhcCCCCCcceEEecCCCCCchHHHHHhhHHHHHHH--HHh----cCCCCCCCCceEEeecCCCccCCCCCCCceeeEe
Q 024331           80 CDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKIL--RKQ----LGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFH  153 (269)
Q Consensus        80 ~~~~~~~~p~~qv~~nDLP~NDFntLF~~l~~~~~~~--~~~----~~~~~~~~~~~f~~~vpgSFy~~lfP~~Svd~~~  153 (269)
                      |.+.+..+|++||||||||+||||+||++|+.+.+.+  ..+    .+.     ++||++|||||||+||||++|+||+|
T Consensus        93 ~~~~~~~~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~-----~~~f~~gvpGSFY~RLfP~~Slh~~~  167 (386)
T PLN02668         93 YESAGLDPPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGH-----RSYFAAGVPGSFYRRLFPARSIDVFH  167 (386)
T ss_pred             hhhcCCCCCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCC-----CceEEEecCccccccccCCCceEEEE
Confidence            9887778899999999999999999999999876532  111    111     35999999999999999999999999


Q ss_pred             ccccccccccCCCCCCC------CCcceEEcCCCCHHHHHHHHHHHHHHHHHHHhhhhhhhccCCeEEEEecccCCCCCC
Q 024331          154 SSYSLQWLSQVPDGLES------NKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPS  227 (269)
Q Consensus       154 Ss~alHWLS~~P~~l~~------nkg~i~~~~~s~~~v~~ay~~Q~~~D~~~FL~~Ra~EL~pGG~lv~~~~g~~~~~~~  227 (269)
                      |++|||||||+|+.+.+      |||+||+.+++ ++|.+||++||++||..||++||+||+|||+|+++++||++.++.
T Consensus       168 Ss~slHWLS~vP~~l~d~~s~~~Nkg~iyi~~~s-~~v~~aY~~Qf~~D~~~FL~~Ra~ELvpGG~mvl~~~Gr~~~~~~  246 (386)
T PLN02668        168 SAFSLHWLSQVPESVTDKRSAAYNKGRVFIHGAS-ESTANAYKRQFQADLAGFLRARAQEMKRGGAMFLVCLGRTSVDPT  246 (386)
T ss_pred             eeccceecccCchhhccCCcccccCCceEecCCC-HHHHHHHHHHHHHHHHHHHHHHHHHhccCcEEEEEEecCCCCCcc
Confidence            99999999999999874      99999999887 789999999999999999999999999999999999999887777


Q ss_pred             Chh-hhHHHHH-HHHHHHHHHHccCcccccccceeccccccc
Q 024331          228 SKE-CCYIWEL-LATALNNMVSEVTKSFLLLIVFNQLNYKLK  267 (269)
Q Consensus       228 ~~~-~~~~~~~-l~~~l~~mv~eG~i~~~~~d~FnlP~~~~~  267 (269)
                      .++ .+.+|+. ++++|+|||.||+|++|++|+||+|.|.+.
T Consensus       247 ~~~~~~~~~~~~l~~al~dlv~eGlI~eek~dsFniP~Y~ps  288 (386)
T PLN02668        247 DQGGAGLLFGTHFQDAWDDLVQEGLVTSEKRDSFNIPVYAPS  288 (386)
T ss_pred             cCCchhHHHHHHHHHHHHHHHHcCCCCHHHHhcccCcccCCC
Confidence            655 5667887 999999999999999999999999999874



>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1m6e_X359 Crystal Structure Of Salicylic Acid Carboxyl Methyl 4e-87
2eg5_A372 The Structure Of Xanthosine Methyltransferase Lengt 2e-51
2efj_A 384 The Structure Of 1,7 Dimethylxanthine Methyltransfe 2e-50
3b5i_A374 Crystal Structure Of Indole-3-Acetic Acid Methyltra 5e-40
>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359 Back     alignment and structure

Iteration: 1

Score = 317 bits (812), Expect = 4e-87, Method: Compositional matrix adjust. Identities = 154/250 (61%), Positives = 184/250 (73%), Gaps = 13/250 (5%) Query: 1 MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFC-STSPTKVAIADLGC 59 M+V QVLHM GG G SYA NS +Q +VISI KPITE A+T L+ T T++AIADLGC Sbjct: 1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGC 60 Query: 60 SSGPNTLLVASELIKVVNKICDKLGSQ-LPEFQVFLNDLPGNDFNTIFRSLASFQKILRK 118 SSGPN L +ELIK V ++ K+G + PE+Q+FLNDLPGNDFN IFRSL + Sbjct: 61 SSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDV--- 117 Query: 119 QLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMA 178 G CF GVPGSFYGRLFPRN++H HSSYSL WLSQVP G+ESNKGNI+MA Sbjct: 118 --------DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIESNKGNIYMA 169 Query: 179 STSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELL 238 +T P VL AYY+QFQ D +LFL+CR++E+V GRMVLT LGR+S+D +S ECC IW+LL Sbjct: 170 NTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLL 229 Query: 239 ATALNNMVSE 248 A ALN MVSE Sbjct: 230 AMALNQMVSE 239
>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372 Back     alignment and structure
>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384 Back     alignment and structure
>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 2e-93
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 3e-92
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 2e-87
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359 Back     alignment and structure
 Score =  278 bits (713), Expect = 2e-93
 Identities = 153/250 (61%), Positives = 183/250 (73%), Gaps = 13/250 (5%)

Query: 1   MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTS-PTKVAIADLGC 59
           M+V QVLHM GG G  SYA NS +Q +VISI KPITE A+T L+   +  T++AIADLGC
Sbjct: 1   MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGC 60

Query: 60  SSGPNTLLVASELIKVVNKICDKLGSQL-PEFQVFLNDLPGNDFNTIFRSLASFQKILRK 118
           SSGPN L   +ELIK V ++  K+G +  PE+Q+FLNDLPGNDFN IFRSL         
Sbjct: 61  SSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIEND---- 116

Query: 119 QLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMA 178
                    G CF  GVPGSFYGRLFPRN++H  HSSYSL WLSQVP G+ESNKGNI+MA
Sbjct: 117 -------VDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIESNKGNIYMA 169

Query: 179 STSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELL 238
           +T P  VL AYY+QFQ D +LFL+CR++E+V  GRMVLT LGR+S+D +S ECC IW+LL
Sbjct: 170 NTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLL 229

Query: 239 ATALNNMVSE 248
           A ALN MVSE
Sbjct: 230 AMALNQMVSE 239


>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 100.0
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 100.0
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 100.0
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.02
3f4k_A257 Putative methyltransferase; structural genomics, P 99.01
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.0
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.94
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.9
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.9
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.85
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.79
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.78
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.77
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.77
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.76
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.75
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.75
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.73
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.72
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.72
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.72
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.71
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.71
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.71
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.7
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.7
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.66
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.65
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.65
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.64
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.63
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.61
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.61
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.61
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.6
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.6
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.6
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.6
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.59
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.58
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.56
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.56
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.56
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.56
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.56
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.55
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.55
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.54
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.54
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.53
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.53
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.53
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.53
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.53
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.53
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.52
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.52
3lcc_A235 Putative methyl chloride transferase; halide methy 98.51
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.51
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.49
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.48
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.47
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.47
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.47
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.45
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.44
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.44
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.44
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.43
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.43
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.42
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.41
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.41
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.4
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.39
3ocj_A305 Putative exported protein; structural genomics, PS 98.39
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.39
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.38
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.36
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.36
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.36
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.35
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.34
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.34
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.33
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.33
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.32
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.31
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.31
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.3
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.3
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.29
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.29
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.29
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.29
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.29
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.27
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.27
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.26
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.26
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.26
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.26
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.26
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.23
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.23
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.22
3cc8_A230 Putative methyltransferase; structural genomics, j 98.2
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.2
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.19
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.18
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.18
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.17
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.16
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.16
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.15
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.15
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.13
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.13
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.12
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.11
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.11
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.11
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.09
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.08
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.06
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.05
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.05
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.03
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.01
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.0
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.0
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.98
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.98
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.98
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.98
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.97
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.96
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.94
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.94
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.92
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.91
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.91
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.89
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.88
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.88
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 97.87
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.85
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.84
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.84
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.83
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.81
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 97.81
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.81
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.8
3lpm_A259 Putative methyltransferase; structural genomics, p 97.78
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.78
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.77
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 97.76
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.76
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.75
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.7
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.7
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.7
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 97.68
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 97.67
1yb2_A275 Hypothetical protein TA0852; structural genomics, 97.67
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.67
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 97.65
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 97.65
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.63
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.62
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 97.6
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.6
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.6
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.6
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.59
1ws6_A171 Methyltransferase; structural genomics, riken stru 97.58
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.57
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.49
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.49
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.49
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 97.48
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.48
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.47
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 97.46
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.45
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 97.41
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.4
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.39
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.37
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.36
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.35
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 97.35
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.35
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.33
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.33
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 97.32
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 97.32
2h00_A254 Methyltransferase 10 domain containing protein; st 97.29
3gjy_A317 Spermidine synthase; APC62791, structural genomics 97.28
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 97.25
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 97.17
2b25_A336 Hypothetical protein; structural genomics, methyl 97.16
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.15
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.15
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.14
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 97.13
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 97.12
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.08
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.03
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 97.0
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 97.0
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.99
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 96.96
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 96.96
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.92
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 96.89
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.87
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 96.86
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.85
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.84
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.83
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.81
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 96.79
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.78
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.7
2i7c_A283 Spermidine synthase; transferase, structural genom 96.69
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.68
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 96.66
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 96.61
1ne2_A200 Hypothetical protein TA1320; structural genomics, 96.6
2pt6_A321 Spermidine synthase; transferase, structural genom 96.55
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 96.47
2o07_A304 Spermidine synthase; structural genomics, structur 96.38
2b78_A385 Hypothetical protein SMU.776; structure genomics, 96.37
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 96.36
2qm3_A373 Predicted methyltransferase; putative methyltransf 96.27
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 96.26
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.2
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 96.11
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 96.08
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.0
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 96.0
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 95.78
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 95.69
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 95.64
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 95.62
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 95.39
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 95.38
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 95.3
2cmg_A262 Spermidine synthase; transferase, putrescine amino 95.28
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 94.83
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 94.79
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 94.51
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 94.26
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 93.93
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 93.84
3fut_A271 Dimethyladenosine transferase; methyltransferase, 93.7
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 93.68
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 93.36
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 93.22
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 92.91
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 92.89
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 92.72
3khk_A544 Type I restriction-modification system methylation 92.35
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 91.83
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 90.79
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 90.5
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 90.19
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 89.97
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 89.8
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 89.15
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 89.09
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 88.85
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 88.67
3k6r_A278 Putative transferase PH0793; structural genomics, 87.85
3lkd_A 542 Type I restriction-modification system methyltrans 87.39
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 87.32
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 84.31
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 80.37
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
Probab=100.00  E-value=5.3e-83  Score=602.33  Aligned_cols=256  Identities=61%  Similarity=1.010  Sum_probs=242.3

Q ss_pred             CcccceeeccCCCCCchHHHhcHHHHHHHHHHHHHHHHHHHhhcccC-CCCceEEEeecCCCCcccHHHHHHHHHHHHHH
Q 024331            1 MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCST-SPTKVAIADLGCSSGPNTLLVASELIKVVNKI   79 (269)
Q Consensus         1 ~~~~~~l~M~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~-~~~~~~IaD~GCs~G~Ns~~~~~~ii~~i~~~   79 (269)
                      |+++++|||+||+|++||++||.+|++++..++|++++||++++... .+++++|||||||+|+||+.+++.||++|+++
T Consensus         1 m~~~~~~~m~gg~G~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~~~~~~~~~IaDlGCs~G~Nt~~~v~~ii~~i~~~   80 (359)
T 1m6e_X            1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGCSSGPNALFAVTELIKTVEEL   80 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSSSSSEECCEEESCCSSTTTTTGGGTTHHHHHHH
T ss_pred             CCcccccccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCceEEEecCCCCCcchHHHHHHHHHHHHHH
Confidence            88999999999999999999999999999999999999999998765 67899999999999999999999999999999


Q ss_pred             HHhcCC-CCCcceEEecCCCCCchHHHHHhhHHHHHHHHHhcCCCCCCCCceEEeecCCCccCCCCCCCceeeEeccccc
Q 024331           80 CDKLGS-QLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSL  158 (269)
Q Consensus        80 ~~~~~~-~~p~~qv~~nDLP~NDFntLF~~l~~~~~~~~~~~~~~~~~~~~~f~~~vpgSFy~~lfP~~Svd~~~Ss~al  158 (269)
                      |.+.++ ++|+|||||||||+||||+||++|+.+.    ++.       ++||++|||||||+||||++|+|++||++||
T Consensus        81 ~~~~~~~~~pe~~v~~nDLp~NDFntlF~~L~~~~----~~~-------~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aL  149 (359)
T 1m6e_X           81 RKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIEN----DVD-------GVCFINGVPGSFYGRLFPRNTLHFIHSSYSL  149 (359)
T ss_dssp             HHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSC----SCT-------TCEEEEEEESCSSSCCSCTTCBSCEEEESCT
T ss_pred             HHhcCCCCCCceEEEecCCCchHHHHHHHhcchhc----ccC-------CCEEEEecchhhhhccCCCCceEEEEehhhh
Confidence            987776 7899999999999999999999998753    110       3699999999999999999999999999999


Q ss_pred             cccccCCCCCCCCCcceEEcCCCCHHHHHHHHHHHHHHHHHHHhhhhhhhccCCeEEEEecccCCCCCCChhhhHHHHHH
Q 024331          159 QWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELL  238 (269)
Q Consensus       159 HWLS~~P~~l~~nkg~i~~~~~s~~~v~~ay~~Q~~~D~~~FL~~Ra~EL~pGG~lv~~~~g~~~~~~~~~~~~~~~~~l  238 (269)
                      ||||++|+.+.+|||+||++++++++|.++|++||++||..||++|++||||||+|+++++|+.+.++.+++.+.+|+.|
T Consensus       150 HWls~~p~~l~~nkg~i~~~~~~p~~v~~ay~~Qf~~D~~~FL~~Ra~EL~pGG~mvl~~~gr~~~~~~~~~~~~~~~~l  229 (359)
T 1m6e_X          150 MWLSQVPIGIESNKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLL  229 (359)
T ss_dssp             TBCSSCCSCCCCCTTTTSSCSSSCCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTTTSTTTHHH
T ss_pred             hhcccCchhhhccCCceEecCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCceEEEEEecCCCCCccccchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999888887777889999


Q ss_pred             HHHHHHHHHccCcccccccceeccccccc
Q 024331          239 ATALNNMVSEVTKSFLLLIVFNQLNYKLK  267 (269)
Q Consensus       239 ~~~l~~mv~eG~i~~~~~d~FnlP~~~~~  267 (269)
                      .++|++||.||+|++|++|+||+|.|.+.
T Consensus       230 ~~al~~mv~eGli~~ek~d~f~~P~y~ps  258 (359)
T 1m6e_X          230 AMALNQMVSEGLIEEEKMDKFNIPQYTPS  258 (359)
T ss_dssp             HHHHHHHHHTTCSCCSTTGGGCCCCBCCC
T ss_pred             HHHHHHHHHccccchhhhhccCCCccCCC
Confidence            99999999999999999999999999874



>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1m6ex_359 c.66.1.35 (X:) Salicylic acid carboxyl methyltrans 1e-113
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]
 Score =  328 bits (842), Expect = e-113
 Identities = 153/250 (61%), Positives = 183/250 (73%), Gaps = 13/250 (5%)

Query: 1   MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCSTSPTK-VAIADLGC 59
           M+V QVLHM GG G  SYA NS +Q +VISI KPITE A+T L+   + T  +AIADLGC
Sbjct: 1   MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGC 60

Query: 60  SSGPNTLLVASELIKVVNKICDKLGSQ-LPEFQVFLNDLPGNDFNTIFRSLASFQKILRK 118
           SSGPN L   +ELIK V ++  K+G +  PE+Q+FLNDLPGNDFN IFRSL     +   
Sbjct: 61  SSGPNALFAVTELIKTVEELRKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIENDV--- 117

Query: 119 QLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNIFMA 178
                    G CF  GVPGSFYGRLFPRN++H  HSSYSL WLSQVP G+ESNKGNI+MA
Sbjct: 118 --------DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIESNKGNIYMA 169

Query: 179 STSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELL 238
           +T P  VL AYY+QFQ D +LFL+CR++E+V  GRMVLT LGR+S+D +S ECC IW+LL
Sbjct: 170 NTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLL 229

Query: 239 ATALNNMVSE 248
           A ALN MVSE
Sbjct: 230 AMALNQMVSE 239


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.35
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.07
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.07
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.04
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.98
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.98
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.96
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.95
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.95
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.94
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.89
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.88
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.84
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.83
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.83
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.81
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.79
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.79
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.75
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.71
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.68
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.65
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.53
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.52
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.48
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.46
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.46
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.44
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.41
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.39
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.36
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.35
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.31
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.3
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.22
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.2
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.19
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.17
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.15
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.09
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.06
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.0
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.97
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.96
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.85
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.82
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.72
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.7
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.57
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.54
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.47
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.41
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.36
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.13
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.93
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 96.58
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 96.51
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 96.39
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.34
d2h00a1250 Methyltransferase 10 domain containing protein MET 95.6
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 95.35
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 94.07
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 92.8
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 91.97
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 91.54
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 91.38
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 91.03
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 90.23
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 89.61
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 87.95
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 87.87
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 87.8
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 87.63
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 81.47
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 80.85
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 80.74
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]
Probab=100.00  E-value=1.6e-88  Score=636.94  Aligned_cols=256  Identities=61%  Similarity=1.020  Sum_probs=241.0

Q ss_pred             CcccceeeccCCCCCchHHHhcHHHHHHHHHHHHHHHHHHHhhccc-CCCCceEEEeecCCCCcccHHHHHHHHHHHHHH
Q 024331            1 MEVVQVLHMNGGVGGTSYASNSLVQEKVISIAKPITEEAMTKLFCS-TSPTKVAIADLGCSSGPNTLLVASELIKVVNKI   79 (269)
Q Consensus         1 ~~~~~~l~M~gG~g~~sY~~nS~~Q~~~~~~~~~~l~~ai~~~~~~-~~~~~~~IaD~GCs~G~Ns~~~~~~ii~~i~~~   79 (269)
                      |+++++|||+||+|++||++||.+|+++++.++|+|++||.+++.. ..+++++|||||||+|+||+.+++.||++|+++
T Consensus         1 m~~~~~l~M~gG~G~~SYa~NS~~Q~~~i~~~kp~leeai~~~~~~~~~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~~~   80 (359)
T d1m6ex_           1 MDVRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTVTTRLAIADLGCSSGPNALFAVTELIKTVEEL   80 (359)
T ss_dssp             CCCHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSSSSSSEECCEEESCCSSTTTTTGGGTTHHHHHHH
T ss_pred             CCccEeeccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCCceEEEEeCCCCCccHHHHHHHHHHHHHHH
Confidence            8999999999999999999999999999999999999999998754 357889999999999999999999999999999


Q ss_pred             HHhcCC-CCCcceEEecCCCCCchHHHHHhhHHHHHHHHHhcCCCCCCCCceEEeecCCCccCCCCCCCceeeEeccccc
Q 024331           80 CDKLGS-QLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSL  158 (269)
Q Consensus        80 ~~~~~~-~~p~~qv~~nDLP~NDFntLF~~l~~~~~~~~~~~~~~~~~~~~~f~~~vpgSFy~~lfP~~Svd~~~Ss~al  158 (269)
                      |++.+. ++|+|||||||||+||||+||++||...        ..   .++||++|||||||+||||++||||+||++||
T Consensus        81 ~~~~~~~~~pe~qvf~nDLP~NDFNtLF~~L~~~~--------~~---~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~al  149 (359)
T d1m6ex_          81 RKKMGRENSPEYQIFLNDLPGNDFNAIFRSLPIEN--------DV---DGVCFINGVPGSFYGRLFPRNTLHFIHSSYSL  149 (359)
T ss_dssp             HHSSSCSSCCEEEEEEEECTTSCHHHHHTTTTTSC--------SC---TTCEEEEEEESCSSSCCSCTTCBSCEEEESCT
T ss_pred             HHhcCCCCCCeEEEEeCCCCcchHHHHHHhccccc--------cC---CCCeEEEecCCchhhhcCCCCceEEeeehhhh
Confidence            988774 5799999999999999999999997531        11   15799999999999999999999999999999


Q ss_pred             cccccCCCCCCCCCcceEEcCCCCHHHHHHHHHHHHHHHHHHHhhhhhhhccCCeEEEEecccCCCCCCChhhhHHHHHH
Q 024331          159 QWLSQVPDGLESNKGNIFMASTSPPCVLTAYYEQFQRDFSLFLKCRSEELVAEGRMVLTFLGRKSQDPSSKECCYIWELL  238 (269)
Q Consensus       159 HWLS~~P~~l~~nkg~i~~~~~s~~~v~~ay~~Q~~~D~~~FL~~Ra~EL~pGG~lv~~~~g~~~~~~~~~~~~~~~~~l  238 (269)
                      |||||+|+.+.+|||+||+.++++++|.+||++||++||.+||++||+||+|||+|+++++||+++++.+++.+.+|+++
T Consensus       150 HWLS~vP~~l~~n~~~i~~~~~~~~~v~~ay~~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~~~~~~~~~~~~~~~l  229 (359)
T d1m6ex_         150 MWLSQVPIGIESNKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRASTECCLIWQLL  229 (359)
T ss_dssp             TBCSSCCSCCCCCTTTTSSCSSSCCTTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSSTTTSTTTHHH
T ss_pred             hhhhcCCccccCCCCcEEEcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEEEEEeccCCCCCCCCccchHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999998888877777899999


Q ss_pred             HHHHHHHHHccCcccccccceeccccccc
Q 024331          239 ATALNNMVSEVTKSFLLLIVFNQLNYKLK  267 (269)
Q Consensus       239 ~~~l~~mv~eG~i~~~~~d~FnlP~~~~~  267 (269)
                      +++|+|||.||+|++|++|+||+|.|.+.
T Consensus       230 ~~al~dmv~eGlI~eek~dsfn~P~Y~ps  258 (359)
T d1m6ex_         230 AMALNQMVSEGLIEEEKMDKFNIPQYTPS  258 (359)
T ss_dssp             HHHHHHHHHTTCSCCSTTGGGCCCCBCCC
T ss_pred             HHHHHHHHHcCCCCHHHHHhccCccccCC
Confidence            99999999999999999999999999874



>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure