Citrus Sinensis ID: 024531


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQKKNWLIIFWQLLVSLVLGLFKRKRVKAE
ccccccccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
cccccccccHHHHHHHHHHHccccEEEEEEccHHcccccccccccccccccEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccHHHcccHHHHHHHHHHHHHHHHHHccccc
mvlgkekkemtGLAIGVSSMKAGEHALLHVGwelgygkegsfsfpnvspmaDLVYEVVLIGfdetkegkarsdMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMalavknpcHLNMAACLLKLKRYEEAIGQCslvlgedenNVKALFRRGKARAELGQTDAAREDFLkagkfapedKSIARELRLLAEHEKAVYKKQKEIYkgifgprpepkqkknWLIIFWQLLVSLVLGLFkrkrvkae
mvlgkekkemtglAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDetkegkarsdmtveerigaadrrkmdgnALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCslvlgedenNVKALFRRGKaraelgqtdaAREDFLkagkfapedkSIARELRLLAEHEKavykkqkeiykgifgprpepkqkKNWLIIFWQLLVSLVlglfkrkrvkae
MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQKKNWLIIFWQLLVSLVLGLFKRKRVKAE
*************AIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFD***************************************MQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRR******************************ARELRLLAEHEKAVYKKQKEIYKGIFGP******KKNWLIIFWQLLVSLVLGLFK*******
MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQL**KYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAE*********************************WQLLVSLVLGLF*RK*****
*********MTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQKKNWLIIFWQLLVSLVLGLFKRKRVKAE
*****EKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQKKNWLIIFWQLLVSLVLGLFKRKR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQKKNWLIIFWQLLVSLVLGLFKRKRVKAE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query266 2.2.26 [Sep-21-2011]
Q9LDC0365 Peptidyl-prolyl cis-trans yes no 1.0 0.728 0.762 1e-118
Q38931551 Peptidyl-prolyl cis-trans no no 0.827 0.399 0.367 3e-26
Q9FJL3578 Peptidyl-prolyl cis-trans no no 0.842 0.387 0.358 2e-25
Q43207559 70 kDa peptidyl-prolyl is N/A no 0.834 0.397 0.361 2e-24
P30416458 Peptidyl-prolyl cis-trans yes no 0.800 0.465 0.305 2e-22
Q9QVC8458 Peptidyl-prolyl cis-trans yes no 0.800 0.465 0.305 3e-22
Q9TRY0459 Peptidyl-prolyl cis-trans yes no 0.800 0.464 0.305 5e-22
P27124458 Peptidyl-prolyl cis-trans yes no 0.800 0.465 0.310 3e-21
Q02790459 Peptidyl-prolyl cis-trans yes no 0.800 0.464 0.296 8e-21
Q3B7U9403 Peptidyl-prolyl cis-trans no no 0.819 0.540 0.301 3e-19
>sp|Q9LDC0|FKB42_ARATH Peptidyl-prolyl cis-trans isomerase FKBP42 OS=Arabidopsis thaliana GN=FKBP42 PE=1 SV=1 Back     alignment and function desciption
 Score =  424 bits (1089), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 205/269 (76%), Positives = 236/269 (87%), Gaps = 3/269 (1%)

Query: 1   MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLI 60
           +VLGKEKKE+ GLAIGV+SMK+GE AL+HVGWEL YGKEG+FSFPNV PMADL+YEV +I
Sbjct: 97  LVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVI 156

Query: 61  GFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQ 120
           GFDETKEGKARSDMTVEERIGAADRRKMDGN+LFKEEKLEEAMQQYEMAIAYMGDDFMFQ
Sbjct: 157 GFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQ 216

Query: 121 LFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAE 180
           L+GKY+DMALAVKNPCHLN+AACL+KLKRY+EAIG C++VL E+E N KALFRRGKA+AE
Sbjct: 217 LYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAE 276

Query: 181 LGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQKK 240
           LGQ D+AR+DF KA K+AP+DK+I RELR LAE EKA+Y+KQKE+YKGIF  + E   K 
Sbjct: 277 LGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQKQKEMYKGIFKGKDEGGAKS 336

Query: 241 N---WLIIFWQLLVSLVLGLFKRKRVKAE 266
               WLI+ WQ  VSL   +F+R RVKA+
Sbjct: 337 KSLFWLIVLWQWFVSLFSRIFRRHRVKAD 365




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Modulates the uptake of MRP substrates into the vacuole; reduces metolachlor-GS (MOC-GS) and enhances 17-beta-estradiol 17-(beta-D-glucuronide) (E(2)17betaG) uptake. Regulates cell elongation and orientation. Functions as a positive regulator of PGP1-mediated auxin transport. Confers drug modulation of PGP1 efflux activity as interaction with NPA or flavonol quercetin prevents its physical and functional interaction with PGP1. Required for the proper localization of auxin-related ABCB transporters. Plays a role in brassinosteroid (BR) signaling pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 Back     alignment and function description
>sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 Back     alignment and function description
>sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description
>sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|Q3B7U9|FKBP8_RAT Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Rattus norvegicus GN=Fkbp8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
356542700 370 PREDICTED: 42 kDa peptidyl-prolyl isomer 1.0 0.718 0.844 1e-130
356531669 370 PREDICTED: 42 kDa peptidyl-prolyl isomer 1.0 0.718 0.840 1e-129
255645857 370 unknown [Glycine max] 1.0 0.718 0.837 1e-129
225450073365 PREDICTED: 42 kDa peptidyl-prolyl isomer 1.0 0.728 0.857 1e-128
357470965 394 42 kDa peptidyl-prolyl isomerase [Medica 0.984 0.664 0.827 1e-126
357470971 372 42 kDa peptidyl-prolyl isomerase [Medica 0.984 0.704 0.827 1e-126
357470967 389 42 kDa peptidyl-prolyl isomerase [Medica 0.984 0.673 0.827 1e-126
357470963 384 42 kDa peptidyl-prolyl isomerase [Medica 0.984 0.682 0.827 1e-126
449464000 369 PREDICTED: peptidyl-prolyl cis-trans iso 0.981 0.707 0.830 1e-125
449516701 369 PREDICTED: peptidyl-prolyl cis-trans iso 0.981 0.707 0.830 1e-125
>gi|356542700|ref|XP_003539804.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase-like [Glycine max] Back     alignment and taxonomy information
 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/270 (84%), Positives = 249/270 (92%), Gaps = 4/270 (1%)

Query: 1   MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLI 60
           MVLGKEKKEMTGL IGV+SMKAGE AL+ VGWELGYG+EGSFSFPNV P ADLVYEV LI
Sbjct: 101 MVLGKEKKEMTGLGIGVASMKAGERALVRVGWELGYGEEGSFSFPNVPPKADLVYEVELI 160

Query: 61  GFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQ 120
           GFDETKEGKARSDMTVEERIGAADRRKMDGNAL++EEKLEEAMQQYEMAIAYMGDDFMFQ
Sbjct: 161 GFDETKEGKARSDMTVEERIGAADRRKMDGNALYQEEKLEEAMQQYEMAIAYMGDDFMFQ 220

Query: 121 LFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAE 180
           LFGKYRDMALAVKNPCHLNMAACL+KL RYEEAIGQCS+VLGEDENNVKALFRRGKARA 
Sbjct: 221 LFGKYRDMALAVKNPCHLNMAACLIKLNRYEEAIGQCSIVLGEDENNVKALFRRGKARAA 280

Query: 181 LGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQK- 239
           LGQTD AREDFLKA K+AP+DK+IA+ELRLLAEH+KAVY+KQKEIYKGIFGPRP+P  K 
Sbjct: 281 LGQTDTAREDFLKASKYAPQDKAIAKELRLLAEHDKAVYQKQKEIYKGIFGPRPQPVPKP 340

Query: 240 KNWLIIFWQLLVSLVLG---LFKRKRVKAE 266
           +NWLI+ WQ L+S+  G   LFKR+R K++
Sbjct: 341 RNWLILIWQWLLSVFYGLVTLFKRQRHKSD 370




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356531669|ref|XP_003534399.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase-like [Glycine max] Back     alignment and taxonomy information
>gi|255645857|gb|ACU23419.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225450073|ref|XP_002277668.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase isoform 2 [Vitis vinifera] gi|225450075|ref|XP_002277645.1| PREDICTED: 42 kDa peptidyl-prolyl isomerase isoform 1 [Vitis vinifera] gi|297736282|emb|CBI24920.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357470965|ref|XP_003605767.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|355506822|gb|AES87964.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357470971|ref|XP_003605770.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|355506825|gb|AES87967.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|388520749|gb|AFK48436.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357470967|ref|XP_003605768.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|355506823|gb|AES87965.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357470963|ref|XP_003605766.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] gi|355506821|gb|AES87963.1| 42 kDa peptidyl-prolyl isomerase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449464000|ref|XP_004149717.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP42-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516701|ref|XP_004165385.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP42-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
UNIPROTKB|Q2QXS0370 LOC_Os12g05090 "Os12g0145500 p 0.981 0.705 0.8 2.9e-112
TAIR|locus:2089890365 TWD1 "AT3G21640" [Arabidopsis 1.0 0.728 0.762 3.9e-108
TAIR|locus:2090265562 ROF1 "AT3G25230" [Arabidopsis 0.827 0.391 0.367 2.1e-28
TAIR|locus:2152561578 ROF2 "AT5G48570" [Arabidopsis 0.849 0.391 0.357 5e-28
UNIPROTKB|F1SK86456 FKBP4 "Uncharacterized protein 0.834 0.486 0.311 4e-26
UNIPROTKB|P27124458 FKBP4 "Peptidyl-prolyl cis-tra 0.834 0.484 0.307 2e-25
MGI|MGI:95543458 Fkbp4 "FK506 binding protein 4 0.834 0.484 0.307 2e-25
UNIPROTKB|F1MU79459 FKBP4 "Peptidyl-prolyl cis-tra 0.834 0.483 0.307 2.1e-25
UNIPROTKB|Q9TRY0459 FKBP4 "Peptidyl-prolyl cis-tra 0.834 0.483 0.307 2.1e-25
RGD|628729458 Fkbp4 "FK506 binding protein 4 0.834 0.484 0.307 2.6e-25
UNIPROTKB|Q2QXS0 LOC_Os12g05090 "Os12g0145500 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 1108 (395.1 bits), Expect = 2.9e-112, P = 2.9e-112
 Identities = 212/265 (80%), Positives = 240/265 (90%)

Query:     1 MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLI 60
             +VLGKEKKEMTGL IGVS+M++GE ALLHV WELGYGKEGSFSFPNV PMADLVYEV LI
Sbjct:   104 LVLGKEKKEMTGLGIGVSNMRSGERALLHVNWELGYGKEGSFSFPNVPPMADLVYEVELI 163

Query:    61 GFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQ 120
             GFD+ KEGKARSDMTVEERI AADRRK++GN  FKE+K EEAMQQYEMAIAYMGDDFMFQ
Sbjct:   164 GFDDVKEGKARSDMTVEERIEAADRRKIEGNEYFKEKKFEEAMQQYEMAIAYMGDDFMFQ 223

Query:   121 LFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAE 180
             LFGKYRDMALAVKNPCHLNMAACL+KLKR++EAI QC++VL EDENNVKALFRRGKARAE
Sbjct:   224 LFGKYRDMALAVKNPCHLNMAACLIKLKRFDEAIAQCTIVLSEDENNVKALFRRGKARAE 283

Query:   181 LGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQK- 239
             LGQT++AREDFLKA K++PEDK I RELR LAE +KA+Y+KQKE+YKG+FGPRPEPK K 
Sbjct:   284 LGQTESAREDFLKAKKYSPEDKEIQRELRSLAEQDKALYQKQKELYKGLFGPRPEPKPKA 343

Query:   240 KNWLIIFWQLLVSLV---LGLFKRK 261
              N+L++FW+ LVSL+   + LFKRK
Sbjct:   344 SNFLVLFWRWLVSLIGYLVKLFKRK 368




GO:0000413 "protein peptidyl-prolyl isomerization" evidence=ISS
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0005528 "FK506 binding" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0018208 "peptidyl-proline modification" evidence=ISS
TAIR|locus:2089890 TWD1 "AT3G21640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SK86 FKBP4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P27124 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:95543 Fkbp4 "FK506 binding protein 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MU79 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TRY0 FKBP4 "Peptidyl-prolyl cis-trans isomerase FKBP4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|628729 Fkbp4 "FK506 binding protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LDC0FKB42_ARATH5, ., 2, ., 1, ., 80.76201.00.7287yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-11
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 7e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 8e-04
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 57.8 bits (140), Expect = 5e-11
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 17/105 (16%)

Query: 90  GNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKR 149
           GN  +K    +EA++ YE A+         +L     D         + N+AA   KL +
Sbjct: 7   GNLYYKLGDYDEALEYYEKAL---------ELDPDNAD--------AYYNLAAAYYKLGK 49

Query: 150 YEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKA 194
           YEEA+      L  D +N KA +  G A  +LG+ + A E + KA
Sbjct: 50  YEEALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEALEAYEKA 94


Length = 100

>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 266
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 100.0
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.94
KOG0553304 consensus TPR repeat-containing protein [General f 99.88
KOG4234271 consensus TPR repeat-containing protein [General f 99.82
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.79
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.73
PRK15359144 type III secretion system chaperone protein SscB; 99.7
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.69
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.68
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.67
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.65
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.62
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.59
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.58
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.58
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.58
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.53
PRK11189296 lipoprotein NlpI; Provisional 99.52
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.51
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.49
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.49
PRK10370198 formate-dependent nitrite reductase complex subuni 99.47
PRK15359144 type III secretion system chaperone protein SscB; 99.46
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.46
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.44
KOG1126638 consensus DNA-binding cell division cycle control 99.44
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.41
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.38
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.38
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.37
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.36
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.36
PRK10370198 formate-dependent nitrite reductase complex subuni 99.36
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.32
KOG1126638 consensus DNA-binding cell division cycle control 99.32
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.32
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.32
PRK12370553 invasion protein regulator; Provisional 99.32
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.31
PRK12370553 invasion protein regulator; Provisional 99.31
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.3
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.29
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.29
PRK15331165 chaperone protein SicA; Provisional 99.28
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.28
PRK11189 296 lipoprotein NlpI; Provisional 99.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.27
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.27
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.25
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.25
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.23
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.23
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.22
KOG0553304 consensus TPR repeat-containing protein [General f 99.22
PRK10803263 tol-pal system protein YbgF; Provisional 99.19
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.19
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 99.17
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.17
KOG2076 895 consensus RNA polymerase III transcription factor 99.16
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.14
PLN02789320 farnesyltranstransferase 99.13
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.13
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.12
KOG1125579 consensus TPR repeat-containing protein [General f 99.12
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.12
PF1337173 TPR_9: Tetratricopeptide repeat 99.12
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.11
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.1
KOG4555175 consensus TPR repeat-containing protein [Function 99.09
PRK11788389 tetratricopeptide repeat protein; Provisional 99.08
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.08
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.07
PF13512142 TPR_18: Tetratricopeptide repeat 99.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.05
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.05
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.05
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.05
KOG1125579 consensus TPR repeat-containing protein [General f 99.04
KOG2003 840 consensus TPR repeat-containing protein [General f 99.04
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 99.04
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.03
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.02
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.01
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.0
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.0
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.99
PLN02789 320 farnesyltranstransferase 98.99
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.99
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.98
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.97
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.96
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.96
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.94
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.93
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.92
PRK14574 822 hmsH outer membrane protein; Provisional 98.92
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.9
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.89
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.87
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.86
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.84
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.83
PF12688120 TPR_5: Tetratrico peptide repeat 98.81
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.78
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 98.77
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.77
PF1337173 TPR_9: Tetratricopeptide repeat 98.76
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.75
KOG2076 895 consensus RNA polymerase III transcription factor 98.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.75
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.74
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.74
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.68
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 98.68
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 98.67
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.66
KOG1129478 consensus TPR repeat-containing protein [General f 98.66
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.66
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.64
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.63
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.62
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.62
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.62
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.61
KOG1310 758 consensus WD40 repeat protein [General function pr 98.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.6
PRK14574 822 hmsH outer membrane protein; Provisional 98.59
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.59
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.56
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.56
PRK11906458 transcriptional regulator; Provisional 98.55
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.55
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.55
KOG1129478 consensus TPR repeat-containing protein [General f 98.54
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.52
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.51
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.5
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.5
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.5
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.49
PRK10803263 tol-pal system protein YbgF; Provisional 98.47
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.46
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.43
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.43
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.41
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.4
PF12688120 TPR_5: Tetratrico peptide repeat 98.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.39
PF1342844 TPR_14: Tetratricopeptide repeat 98.39
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.36
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.36
PF1343134 TPR_17: Tetratricopeptide repeat 98.34
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.32
COG4700251 Uncharacterized protein conserved in bacteria cont 98.32
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 98.31
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.3
KOG4234271 consensus TPR repeat-containing protein [General f 98.3
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.29
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.29
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.29
PRK15331165 chaperone protein SicA; Provisional 98.26
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.25
PRK11906458 transcriptional regulator; Provisional 98.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.24
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.2
KOG2003840 consensus TPR repeat-containing protein [General f 98.18
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.18
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 98.16
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.15
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.12
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.11
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.11
PF1342844 TPR_14: Tetratricopeptide repeat 98.1
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.07
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.04
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.03
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 98.03
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.03
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.02
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.01
PRK10941269 hypothetical protein; Provisional 97.97
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.97
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.95
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.95
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.92
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.91
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.9
PF13512142 TPR_18: Tetratricopeptide repeat 97.89
KOG4555175 consensus TPR repeat-containing protein [Function 97.86
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.83
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.83
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 97.81
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.77
KOG0495913 consensus HAT repeat protein [RNA processing and m 97.76
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.74
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.72
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.61
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.58
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.58
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.57
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.56
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.56
KOG3364149 consensus Membrane protein involved in organellar 97.56
PF1343134 TPR_17: Tetratricopeptide repeat 97.52
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.5
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.48
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.48
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.48
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.47
KOG1586288 consensus Protein required for fusion of vesicles 97.47
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.46
COG4700251 Uncharacterized protein conserved in bacteria cont 97.45
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.44
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.43
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.39
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.38
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.36
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.3
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.25
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.23
COG2912269 Uncharacterized conserved protein [Function unknow 97.2
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.17
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.11
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.08
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.08
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.07
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.06
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.04
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.97
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.96
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.94
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.93
KOG1915 677 consensus Cell cycle control protein (crooked neck 96.93
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.93
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 96.93
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.93
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.92
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.9
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.89
PRK04841 903 transcriptional regulator MalT; Provisional 96.87
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.85
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.81
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.78
PLN03077 857 Protein ECB2; Provisional 96.76
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.75
PLN03218 1060 maturation of RBCL 1; Provisional 96.75
PLN03218 1060 maturation of RBCL 1; Provisional 96.72
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.7
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 96.66
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.64
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.61
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.57
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.55
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.55
COG3629280 DnrI DNA-binding transcriptional activator of the 96.53
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.43
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.42
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.4
PLN03077 857 Protein ECB2; Provisional 96.39
PRK04841 903 transcriptional regulator MalT; Provisional 96.34
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.28
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.28
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.26
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.26
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.19
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.05
KOG1585308 consensus Protein required for fusion of vesicles 96.04
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.03
PRK10941269 hypothetical protein; Provisional 96.03
KOG2471 696 consensus TPR repeat-containing protein [General f 95.97
KOG1586288 consensus Protein required for fusion of vesicles 95.89
KOG1915 677 consensus Cell cycle control protein (crooked neck 95.85
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.66
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.64
KOG2471 696 consensus TPR repeat-containing protein [General f 95.43
COG3947361 Response regulator containing CheY-like receiver a 95.29
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.22
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 95.21
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.2
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.16
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.15
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.13
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.0
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 94.87
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.79
KOG1585308 consensus Protein required for fusion of vesicles 94.79
KOG2300629 consensus Uncharacterized conserved protein [Funct 94.77
KOG3364149 consensus Membrane protein involved in organellar 94.62
PF1286294 Apc5: Anaphase-promoting complex subunit 5 94.45
PF1286294 Apc5: Anaphase-promoting complex subunit 5 94.28
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.27
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.18
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.99
COG3898 531 Uncharacterized membrane-bound protein [Function u 93.93
KOG1550552 consensus Extracellular protein SEL-1 and related 93.63
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.44
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.38
KOG4814 872 consensus Uncharacterized conserved protein [Funct 93.29
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.09
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 92.81
COG3898 531 Uncharacterized membrane-bound protein [Function u 92.69
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.66
COG5191 435 Uncharacterized conserved protein, contains HAT (H 92.65
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.64
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 92.41
COG2912269 Uncharacterized conserved protein [Function unknow 92.35
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.34
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 92.33
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 91.98
PHA02537230 M terminase endonuclease subunit; Provisional 91.96
PF13281374 DUF4071: Domain of unknown function (DUF4071) 91.86
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 91.85
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 91.66
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 91.6
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 91.3
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.26
KOG0529 421 consensus Protein geranylgeranyltransferase type I 91.23
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.02
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.01
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 91.0
KOG1550 552 consensus Extracellular protein SEL-1 and related 90.98
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.8
PF09986214 DUF2225: Uncharacterized protein conserved in bact 90.7
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.61
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 90.3
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 90.14
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 89.91
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 89.24
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 89.14
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 88.95
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.91
PRK01490435 tig trigger factor; Provisional 88.84
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 88.34
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 88.07
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 87.9
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 87.72
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 87.65
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 87.51
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 87.27
PF13281374 DUF4071: Domain of unknown function (DUF4071) 87.21
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 87.09
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 86.53
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 86.23
KOG1310 758 consensus WD40 repeat protein [General function pr 86.2
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 86.07
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 85.92
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 85.7
PF0421269 MIT: MIT (microtubule interacting and transport) d 85.53
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 85.34
COG3629280 DnrI DNA-binding transcriptional activator of the 85.24
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 85.23
KOG2422 665 consensus Uncharacterized conserved protein [Funct 85.21
COG4941415 Predicted RNA polymerase sigma factor containing a 85.18
COG4455 273 ImpE Protein of avirulence locus involved in tempe 85.15
KOG2300 629 consensus Uncharacterized conserved protein [Funct 84.98
KOG2047 835 consensus mRNA splicing factor [RNA processing and 84.67
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 84.67
cd0267979 MIT_spastin MIT: domain contained within Microtubu 84.43
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 83.79
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 83.76
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.53
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.99
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 82.35
KOG2422 665 consensus Uncharacterized conserved protein [Funct 82.34
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 82.28
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 82.27
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 81.75
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 81.53
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 81.43
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 80.47
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=3.9e-44  Score=302.85  Aligned_cols=256  Identities=40%  Similarity=0.557  Sum_probs=230.8

Q ss_pred             cCCCCccchhHHHHhhcCCCCcEEEEEEecCcccCCCCCCCCCCCCCCCceEEEEEEeecc-ccccCCCCCCCCHHHHHH
Q 024531            3 LGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFD-ETKEGKARSDMTVEERIG   81 (266)
Q Consensus         3 lg~~~~~~~gl~~~l~~m~~gE~~~~~i~~~~~~~~~g~~~~~~ip~~~~~~~~i~l~~~~-~~~~~~~~~~~~~~~~~~   81 (266)
                      +|++.+||.|||.||+.|++||+|.|+|+|.|+||..|. ++|.|||++++.|+|+|+++. ..++   .|.+..++++.
T Consensus       131 ~Ge~~~vi~Gle~al~~M~~GE~a~v~i~~~YayG~~~~-~~p~IPPnA~l~yEVeL~~f~~~~~~---s~~~~~~e~l~  206 (397)
T KOG0543|consen  131 EGEDIDVIEGLEIALRMMKVGEVALVTIDPKYAYGEEGG-EPPLIPPNATLLYEVELLDFELKEDE---SWKMFAEERLE  206 (397)
T ss_pred             cCCccchhHHHHHHHHhcCccceEEEEeCcccccCCCCC-CCCCCCCCceEEEEEEEEeeecCccc---ccccchHHHHH
Confidence            677558999999999999999999999999999994333 488999999999999999998 6655   89999999999


Q ss_pred             HHHHHHHHhHHHHhhccHHHHHHHHHHHHhhhccchhhhhchhHHHHHHHhhhhhhhhHHHHHHHhhCHHHHHHHHHhHh
Q 024531           82 AADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVL  161 (266)
Q Consensus        82 ~~~~~~~~g~~~~~~g~~~~A~~~y~~al~~~~~~~~~~~~~~~~~~~~~l~~~~~~n~a~~~~~~~~~~~A~~~~~~al  161 (266)
                      .+...++.||.+|+.|+|..|...|.+|+...+.....  ..+...+..++...+++|+|.||+++++|..|+..|+++|
T Consensus       207 ~A~~~ke~Gn~~fK~gk~~~A~~~Yerav~~l~~~~~~--~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~c~kvL  284 (397)
T KOG0543|consen  207 AADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRRSF--DEEEQKKAEALKLACHLNLAACYLKLKEYKEAIESCNKVL  284 (397)
T ss_pred             HHHHHHHhhhHHHhhchHHHHHHHHHHHHHHhhccccC--CHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHH
Confidence            99999999999999999999999999999998865443  3356667788899999999999999999999999999999


Q ss_pred             cCCCCchHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCCccc--
Q 024531          162 GEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQK--  239 (266)
Q Consensus       162 ~l~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~l~~l~~~~~~~~~~~~~~~~k~~~~~~~~~~~--  239 (266)
                      +++|+|.+|+||+|.|+..+|+|+.|+.+|+++++++|+|.++...|..|.++.++++.+++++|.+||+........  
T Consensus       285 e~~~~N~KALyRrG~A~l~~~e~~~A~~df~ka~k~~P~Nka~~~el~~l~~k~~~~~~kekk~y~~mF~k~~~~~~k~~  364 (397)
T KOG0543|consen  285 ELDPNNVKALYRRGQALLALGEYDLARDDFQKALKLEPSNKAARAELIKLKQKIREYEEKEKKMYANMFAKLAEESAKTK  364 (397)
T ss_pred             hcCCCchhHHHHHHHHHHhhccHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999986655444  


Q ss_pred             -chhHHHhHHHHHHHHHHHhhhhccc
Q 024531          240 -KNWLIIFWQLLVSLVLGLFKRKRVK  264 (266)
Q Consensus       240 -~~~~~~~~~~~~~~~~~~~~~~~~~  264 (266)
                       .+|....|+|..+.....+...+.+
T Consensus       365 s~~~~~~~~~~~~~~~~~~~~~~~~~  390 (397)
T KOG0543|consen  365 SEAALEDKPKEQEGLTKDKDGTARLK  390 (397)
T ss_pred             cchhcccCccchhcchhhhcchhhhh
Confidence             7777888999888887776665543



>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 1e-111
2f4e_A180 N-Terminal Domain Of Fkbp42 From Arabidopsis Thalia 5e-37
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 8e-22
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 3e-19
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-18
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-18
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 2e-16
4apo_A165 Aip Tpr Domain In Complex With Human Tomm20 Peptide 6e-13
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 4e-12
4aif_A144 Aip Tpr Domain In Complex With Human Hsp90 Peptide 1e-10
3rkv_A162 C-Terminal Domain Of Protein C56c10.10, A Putative 5e-10
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 1e-06
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure

Iteration: 1

Score = 399 bits (1025), Expect = e-111, Method: Compositional matrix adjust. Identities = 190/235 (80%), Positives = 217/235 (92%) Query: 1 MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLI 60 +VLGKEKKE+ GLAIGV+SMK+GE AL+HVGWEL YGKEG+FSFPNV PMADL+YEV +I Sbjct: 97 LVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVI 156 Query: 61 GFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQ 120 GFDETKEGKARSDMTVEERIGAADRRKMDGN+LFKEEKLEEAMQQYEMAIAYMGDDFMFQ Sbjct: 157 GFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQ 216 Query: 121 LFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAE 180 L+GKY+DMALAVKNPCHLN+AACL+KLKRY+EAIG C++VL E+E N KALFRRGKA+AE Sbjct: 217 LYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAE 276 Query: 181 LGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPE 235 LGQ D+AR+DF KA K+AP+DK+I RELR LAE EKA+Y+KQKE+YKGIF + E Sbjct: 277 LGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQKQKEMYKGIFKGKDE 331
>pdb|2F4E|A Chain A, N-Terminal Domain Of Fkbp42 From Arabidopsis Thaliana Length = 180 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 Back     alignment and structure
>pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-73
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 1e-62
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 3e-62
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-51
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 7e-49
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-37
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-28
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 6e-26
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 8e-22
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-21
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-21
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 6e-21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 6e-21
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-20
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 6e-20
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 1e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-19
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-16
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-13
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-17
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-15
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-12
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-16
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 5e-16
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-14
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-08
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 8e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-14
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-10
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-09
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 7e-06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 9e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-10
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 9e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-10
3u4t_A 272 TPR repeat-containing protein; structural genomics 1e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-11
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 1e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-09
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 6e-09
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 9e-06
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-05
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-04
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 9e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 1e-07
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 6e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 6e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-07
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-07
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-04
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 2e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-06
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 7e-06
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 1e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-05
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 3e-05
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 4e-05
2ppn_A107 FK506-binding protein 1A; high resolution protein 4e-05
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 5e-05
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 5e-05
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 7e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-05
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 1e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-04
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 6e-04
1jvw_A167 Macrophage infectivity potentiator; chagas disease 9e-04
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
 Score =  226 bits (576), Expect = 4e-73
 Identities = 191/241 (79%), Positives = 218/241 (90%)

Query: 1   MVLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLI 60
           +VLGKEKKE+ GLAIGV+SMK+GE AL+HVGWEL YGKEG+FSFPNV PMADL+YEV +I
Sbjct: 97  LVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVI 156

Query: 61  GFDETKEGKARSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQ 120
           GFDETKEGKARSDMTVEERIGAADRRKMDGN+LFKEEKLEEAMQQYEMAIAYMGDDFMFQ
Sbjct: 157 GFDETKEGKARSDMTVEERIGAADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQ 216

Query: 121 LFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAE 180
           L+GKY+DMALAVKNPCHLN+AACL+KLKRY+EAIG C++VL E+E N KALFRRGKA+AE
Sbjct: 217 LYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAE 276

Query: 181 LGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQKK 240
           LGQ D+AR+DF KA K+AP+DK+I RELR LAE EKA+Y+KQKE+YKGIF  + E   K 
Sbjct: 277 LGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQKQKEMYKGIFKGKDEGGAKS 336

Query: 241 N 241
            
Sbjct: 337 K 337


>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 100.0
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.97
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.97
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.9
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.89
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.86
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.85
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.81
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.8
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.78
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.76
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.76
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.75
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.74
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.73
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.69
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.69
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.68
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.68
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.68
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.67
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.66
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.66
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.66
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.66
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.66
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.64
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.63
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.63
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.62
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.62
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.61
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.6
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.6
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.6
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.59
3k9i_A117 BH0479 protein; putative protein binding protein, 99.59
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.57
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.57
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.57
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.56
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.55
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.55
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.55
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.54
3u4t_A272 TPR repeat-containing protein; structural genomics 99.53
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.53
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.52
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.52
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.51
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.51
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.5
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.5
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.49
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.48
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.48
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.48
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 99.48
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.48
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.48
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.47
3u4t_A272 TPR repeat-containing protein; structural genomics 99.47
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.47
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.47
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.46
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.46
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.46
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.45
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.44
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.44
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.43
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.43
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.42
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.42
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 99.42
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.41
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.4
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.4
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.39
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.38
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.38
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.36
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.36
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.36
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.34
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.33
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.32
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.32
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.32
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.31
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.31
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.3
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.3
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.3
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.29
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.29
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.29
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.28
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.28
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.27
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.27
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.27
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.25
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.25
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.24
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.24
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.24
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.24
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.24
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.22
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.22
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.22
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.21
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.21
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.21
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.21
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.2
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.19
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.19
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.18
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.18
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.17
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.17
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.16
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.16
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.16
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.15
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.15
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.15
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.14
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.14
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.13
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.13
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.13
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.13
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.12
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.12
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.11
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.1
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.09
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.07
3k9i_A117 BH0479 protein; putative protein binding protein, 99.07
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.04
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.04
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.03
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.0
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.99
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.98
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.97
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.93
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.93
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 98.92
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.92
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.92
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.9
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.89
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.88
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 98.88
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 98.88
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 98.87
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 98.87
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.87
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 98.86
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 98.86
2ppn_A107 FK506-binding protein 1A; high resolution protein 98.85
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 98.85
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 98.85
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.85
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 98.84
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.83
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 98.83
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 98.81
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 98.81
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.81
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.8
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.79
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.77
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.75
1jvw_A167 Macrophage infectivity potentiator; chagas disease 98.74
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 98.72
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 98.72
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.69
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.66
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 98.63
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 98.57
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.56
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.55
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.53
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 98.52
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.5
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 98.47
1fd9_A213 Protein (macrophage infectivity potentiator prote; 98.47
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.46
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.45
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 98.44
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 98.43
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 98.42
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.41
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.41
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.39
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.37
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.36
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.35
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.34
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 98.34
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.3
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.27
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.24
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.24
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.23
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.06
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.79
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.68
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.67
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.66
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 97.6
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.4
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.33
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 97.28
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.19
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 97.18
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 97.12
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 97.06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.05
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.05
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 97.02
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 96.97
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.94
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.89
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 96.88
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 96.77
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.33
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.29
1w26_A432 Trigger factor, TF; chaperone, protein folding, ri 96.01
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 95.97
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.9
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 95.88
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.75
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.54
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.45
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.37
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.79
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 94.44
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 93.61
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 93.2
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 93.18
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 93.08
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 92.81
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 91.75
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 90.88
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 90.62
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.65
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 88.33
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 87.99
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 87.78
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.99
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 86.85
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 86.78
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 86.52
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.03
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 84.22
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 83.95
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 83.58
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 81.45
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 81.02
1om2_A95 Protein (mitochondrial import receptor subunit TOM 80.52
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=1.9e-34  Score=249.79  Aligned_cols=238  Identities=80%  Similarity=1.252  Sum_probs=179.6

Q ss_pred             ccCCCCccchhHHHHhhcCCCCcEEEEEEecCcccCCCCCCCCCCCCCCCceEEEEEEeeccccccCCCCCCCCHHHHHH
Q 024531            2 VLGKEKKEMTGLAIGVSSMKAGEHALLHVGWELGYGKEGSFSFPNVSPMADLVYEVVLIGFDETKEGKARSDMTVEERIG   81 (266)
Q Consensus         2 ~lg~~~~~~~gl~~~l~~m~~gE~~~~~i~~~~~~~~~g~~~~~~ip~~~~~~~~i~l~~~~~~~~~~~~~~~~~~~~~~   81 (266)
                      +||.+.++|+||+.+|..|+.||++.|+|+|.++||..|...++.||+++.+.|.+.+..+....++...+.++.++++.
T Consensus        98 ~lg~~~~~i~g~e~~l~~m~~Ge~~~~~i~~~~~yg~~~~~~~~~ip~~~~l~f~v~L~~~~~~~e~~~~~~~~~~~~~~  177 (338)
T 2if4_A           98 VLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIG  177 (338)
T ss_dssp             ETTSCCGGGHHHHHHHHHCCBTCEEEEEECGGGSSCSSCCCSSSCCCTTCCEEEEEEEEEEECCCCCBTTTBCCHHHHHH
T ss_pred             EcCCCCcccHHHHHHHhcCCCCCeEEEEECHHHhcCCCCCCCCCCCCCCCcEEEEEEEEEecCCccccccccCCHHHHHH
Confidence            57876469999999999999999999999999999999976567899999999999999998887777789999999999


Q ss_pred             HHHHHHHHhHHHHhhccHHHHHHHHHHHHhhhccchhhhhchhHHHHHHHhhhhhhhhHHHHHHHhhCHHHHHHHHHhHh
Q 024531           82 AADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRYEEAIGQCSLVL  161 (266)
Q Consensus        82 ~~~~~~~~g~~~~~~g~~~~A~~~y~~al~~~~~~~~~~~~~~~~~~~~~l~~~~~~n~a~~~~~~~~~~~A~~~~~~al  161 (266)
                      .+..++..|+.++..|+|++|+..|.+++.+.|.+......+...+....+...+++|+|.||.++|+|++|+.+|+++|
T Consensus       178 ~a~~~~~~g~~~~~~g~~~~A~~~y~~Al~~~p~~~~~~~~~~~~~~~~~l~~~~~~nla~~~~~~g~~~~A~~~~~~al  257 (338)
T 2if4_A          178 AADRRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVL  257 (338)
T ss_dssp             HHHHHHHHHHHTCSSSCCHHHHHHHHHHHHHSCHHHHHTCCHHHHHHHHHHHTHHHHHHHHHHHTTTCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHhccchhhhhcccHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999987655455555566666677799999999999999999999999999


Q ss_pred             cCCCCchHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCCccc
Q 024531          162 GEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIFGPRPEPKQK  239 (266)
Q Consensus       162 ~l~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~l~~l~~~~~~~~~~~~~~~~k~~~~~~~~~~~  239 (266)
                      .++|++.++++++|.+|..+|+|++|+.+|+++++++|+++.++..|..+....+...++++.+|+++|+..+...++
T Consensus       258 ~~~p~~~~a~~~lg~a~~~~g~~~~A~~~l~~al~l~p~~~~a~~~L~~l~~~~~~~~~~a~~~~~~~l~~~p~~~~~  335 (338)
T 2if4_A          258 TEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAIRRELRALAEQEKALYQKQKEMYKGIFKGKDEGGAK  335 (338)
T ss_dssp             HHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHTTC-------------------------------------------
T ss_pred             HhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCCCCC
Confidence            999999999999999999999999999999999999999999999999998888888888889999999987766543



>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 266
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-17
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 9e-15
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 6e-13
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-08
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-05
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 9e-07
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 2e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-05
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-05
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 6e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-05
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-04
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 1e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-04
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 3e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-04
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 4e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 5e-04
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 6e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 9e-04
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 0.002
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP51, C-terminal domain
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
 Score = 75.8 bits (185), Expect = 1e-17
 Identities = 42/158 (26%), Positives = 80/158 (50%), Gaps = 2/158 (1%)

Query: 73  DMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAV 132
           +M  +E++  A   K  G   FK  K  +A+ QY   ++++  ++   L  K    + + 
Sbjct: 5   EMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEY--GLSEKESKASESF 62

Query: 133 KNPCHLNMAACLLKLKRYEEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFL 192
                LN+A C LKL+ Y +A+  C   LG D  N K L+RRG+A+  + + ++A+ DF 
Sbjct: 63  LLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE 122

Query: 193 KAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIF 230
           K  +  P++K+   ++ +  +  K   ++ +  Y  +F
Sbjct: 123 KVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMF 160


>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.95
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.94
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.92
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.86
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.82
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.74
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.67
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.63
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.6
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.6
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.55
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.55
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.54
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.54
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.53
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.53
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.45
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.44
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.41
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.4
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.4
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.17
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.16
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.14
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.13
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.1
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.08
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.08
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.08
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.07
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.05
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.99
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.97
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.96
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 98.96
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.94
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 98.93
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.92
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 98.89
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.81
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 98.72
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.7
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.68
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.63
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.61
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.58
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.56
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 98.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.27
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.23
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.87
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.5
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.43
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 97.22
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 97.09
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 93.07
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 89.97
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 89.82
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 86.13
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 85.25
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 83.85
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 83.18
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 83.12
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 80.08
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP52 (FKBP4), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2.5e-26  Score=177.84  Aligned_cols=160  Identities=29%  Similarity=0.473  Sum_probs=146.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHhHHHHhhccHHHHHHHHHHHHhhhccchhhhhchhHHHHHHHhhhhhhhhHHHHHHHhhCH
Q 024531           71 RSDMTVEERIGAADRRKMDGNALFKEEKLEEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLLKLKRY  150 (266)
Q Consensus        71 ~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~A~~~y~~al~~~~~~~~~~~~~~~~~~~~~l~~~~~~n~a~~~~~~~~~  150 (266)
                      +|+|+.+++++.+..+++.|+.+|..|+|++|+..|.++|...|.....  ..........+...+|.|+|.||+++|+|
T Consensus         1 ~~~~~~~ek~~~a~~l~~~G~~~~~~~~~~~Ai~~y~~al~~~~~~~~~--~~~~~~~~~~~~~~~~~nla~~y~k~~~~   78 (170)
T d1p5qa1           1 SWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSF--SNEEAQKAQALRLASHLNLAMCHLKLQAF   78 (170)
T ss_dssp             GGGCCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHTTTCCCC--CSHHHHHHHHHHHHHHHHHHHHHHHTTCH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHhhhcccc--chHHHhhhchhHHHHHHHHHHHHHhhhhc
Confidence            4899999999999999999999999999999999999999998865432  23344455667778899999999999999


Q ss_pred             HHHHHHHHhHhcCCCCchHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccc
Q 024531          151 EEAIGQCSLVLGEDENNVKALFRRGKARAELGQTDAAREDFLKAGKFAPEDKSIARELRLLAEHEKAVYKKQKEIYKGIF  230 (266)
Q Consensus       151 ~~A~~~~~~al~l~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~l~~l~~~~~~~~~~~~~~~~k~~  230 (266)
                      ++|+.+++++|.++|+++.+++++|.||..+|+|++|+.+|+++++++|+|+.+...+..+...+++..+.+++.|.+||
T Consensus        79 ~~A~~~~~~al~~~p~~~~a~~~~g~~~~~~g~~~~A~~~~~~al~l~P~n~~~~~~l~~~~~~~~~~~~~e~~~~~~~f  158 (170)
T d1p5qa1          79 SAAIESCNKALELDSNNEKGLSRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMF  158 (170)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccccchhhhhhhccccchhhhHHHHHHHHHhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CC
Q 024531          231 GP  232 (266)
Q Consensus       231 ~~  232 (266)
                      +.
T Consensus       159 ~~  160 (170)
T d1p5qa1         159 ER  160 (170)
T ss_dssp             HH
T ss_pred             HH
Confidence            64



>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure