Citrus Sinensis ID: 024629

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
cccEEEEEEccccHHHHHHHHHHccccEEEEEEcccccccccEEEEcccccccccccccEEEEEcccEEEEccEEEEEEEEccccccccccccccEEEEcccccccHHHHHHHHcccccEEEEccccccccEEEEEEccccccccccEEEEcccccccccHHHHHcccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHcccccccccccEEEEEccccccEEEEEEEEccccccHHHHHHHHc
cccEEEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHcccccccccccEEEEcEccEEEEccEEEEEEccccHHHccHHHHcccEEEEcccccccHHHHHHHHcccccEEEEccccccccEccccccHHHccccccEEEcccHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccEccccccccccHHHcEcccccEEEcccHHHHHHHHcHHHcccEEEEEEEccccccEEEEEEEEEcccccHHHHHHHHH
mgkvkigingFGRIGRLVARVILqrddvelvavndpfittdYMTYMFKYdsvhgqwkhhelkvkddktllfgekpvtvfgvrnpeeipwaetgAEYVVestgvftdkDKAAAHLKGGAKKVIisapskdapmfvvgvneneykpelnivsnascttnclaPLAKVIHDKFGIVEGLMTTVHSITatqktvdgpsskdwrggraasfniipsstgaaKAVGKvlpalngkltgmafrvptvdvSVVDLTVRLEKDASYDEIKAAIK
mgkvkigingfgrigRLVARVilqrddvelvavndpFITTDYMTYMFKYDSVHGQWKHHElkvkddktllfgekpvtvfgvrnpeeipwaeTGAEYVVESTGVFTDKDKAAAHLKGGAKKViisapskdaPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSItatqktvdgpsskdwrgGRAASFniipsstgaaKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTvrlekdasydeikaaik
MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTdkdkaaahlkggakkVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
***VKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQ*************GRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEK************
*GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQ************GGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
*GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query265 2.2.26 [Sep-21-2011]
P34783360 Glyceraldehyde-3-phosphat N/A no 1.0 0.736 0.928 1e-144
P26518341 Glyceraldehyde-3-phosphat N/A no 0.992 0.771 0.942 1e-143
P26520337 Glyceraldehyde-3-phosphat N/A no 1.0 0.786 0.916 1e-143
Q7FAH2337 Glyceraldehyde-3-phosphat yes no 1.0 0.786 0.920 1e-142
Q9FX54338 Glyceraldehyde-3-phosphat yes no 0.992 0.778 0.912 1e-142
P25858338 Glyceraldehyde-3-phosphat yes no 0.992 0.778 0.912 1e-141
P04796338 Glyceraldehyde-3-phosphat N/A no 0.992 0.778 0.912 1e-141
Q42671337 Glyceraldehyde-3-phosphat N/A no 1.0 0.786 0.905 1e-140
P34922338 Glyceraldehyde-3-phosphat N/A no 0.992 0.778 0.912 1e-140
Q43247337 Glyceraldehyde-3-phosphat N/A no 1.0 0.786 0.894 1e-140
>sp|P34783|G3P_ATRNU Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1 Back     alignment and function desciption
 Score =  512 bits (1318), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 246/265 (92%), Positives = 259/265 (97%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE 60
           M KVKIGINGFGRIGRLVARVILQ DD ELVA+NDPFITTDYMTYMFKYDSVHGQWKHHE
Sbjct: 1   MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHGQWKHHE 60

Query: 61  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 120
           LKVKD+KTLLFGE+PVTVFG RNPEEIPW +TGA+YVVESTGVFTDKDKAAAHLKGGAKK
Sbjct: 61  LKVKDEKTLLFGERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTDKDKAAAHLKGGAKK 120

Query: 121 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 180
           VIISAPSKDAPMFVVGVNE+EYK ELNIVSNASCTTNCLAPLAKVI+DKFGIVEGLMTTV
Sbjct: 121 VIISAPSKDAPMFVVGVNEHEYKSELNIVSNASCTTNCLAPLAKVINDKFGIVEGLMTTV 180

Query: 181 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 240
           HSITATQKTVDGPS+KDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGM+FRVPTV
Sbjct: 181 HSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 240

Query: 241 DVSVVDLTVRLEKDASYDEIKAAIK 265
           DVSVVDLTVRLEK+A+Y++IKAAIK
Sbjct: 241 DVSVVDLTVRLEKEATYEQIKAAIK 265

Atriplex nummularia (taxid: 3553)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|P26518|G3PC_MAGLI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P26520|G3PC_PETHY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|Q7FAH2|G3PC2_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FX54|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Arabidopsis thaliana GN=GAPC2 PE=1 SV=1 Back     alignment and function description
>sp|P25858|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Arabidopsis thaliana GN=GAPC1 PE=1 SV=2 Back     alignment and function description
>sp|P04796|G3PC_SINAL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2 Back     alignment and function description
>sp|Q42671|G3PC_CRAPL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1 Back     alignment and function description
>sp|P34922|G3PC_PEA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pisum sativum GN=GAPC1 PE=2 SV=1 Back     alignment and function description
>sp|Q43247|G3PC3_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Zea mays GN=GAPC3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
211906518336 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.788 0.947 1e-144
418731090337 glyceraldehyde 3-phosphate dehydrogenase 1.0 0.786 0.939 1e-144
211906470340 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.779 0.939 1e-144
4539543337 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.786 0.935 1e-143
257815169337 NAD-dependent glyceraldehyde 3-P dehydro 1.0 0.786 0.920 1e-143
224119602338 predicted protein [Populus trichocarpa] 1.0 0.784 0.932 1e-143
386278568277 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.956 0.935 1e-143
346682873337 glyceraldehyde-3-phosphate dehydrogenase 1.0 0.786 0.928 1e-143
359491599337 PREDICTED: glyceraldehyde-3-phosphate de 1.0 0.786 0.928 1e-143
462141360 RecName: Full=Glyceraldehyde-3-phosphate 1.0 0.736 0.928 1e-143
>gi|211906518|gb|ACJ11752.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  518 bits (1334), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/265 (94%), Positives = 258/265 (97%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE 60
           MGK+KIGINGFGRIGRLVARV LQ DD+ELVAVNDPFITT+YMTYMFKYDSVHGQWKHHE
Sbjct: 1   MGKIKIGINGFGRIGRLVARVALQSDDIELVAVNDPFITTEYMTYMFKYDSVHGQWKHHE 60

Query: 61  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 120
           LKVKD KTLLFGEKPVTVFG+RNPEEIPWAE GAEYVVESTGVFTDKDKAAAHLKGGAKK
Sbjct: 61  LKVKDSKTLLFGEKPVTVFGIRNPEEIPWAEAGAEYVVESTGVFTDKDKAAAHLKGGAKK 120

Query: 121 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 180
           VIISAPSKDAPMFVVGVNE EYKP+LNIVSNASCTTNCLAPLAKVI+DKFGIVEGLMTTV
Sbjct: 121 VIISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLAPLAKVINDKFGIVEGLMTTV 180

Query: 181 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 240
           HSITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV
Sbjct: 181 HSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 240

Query: 241 DVSVVDLTVRLEKDASYDEIKAAIK 265
           DVSVVDLTVRLEK A+YDEIKAAIK
Sbjct: 241 DVSVVDLTVRLEKKATYDEIKAAIK 265

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|418731090|gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|211906470|gb|ACJ11728.1| glyceraldehyde-3-phosphate dehydrogenase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|4539543|emb|CAB39974.1| glyceraldehyde-3-phosphate dehydrogenase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|257815169|gb|ACV69976.1| NAD-dependent glyceraldehyde 3-P dehydrogenase [Solanum chacoense] Back     alignment and taxonomy information
>gi|224119602|ref|XP_002318114.1| predicted protein [Populus trichocarpa] gi|118482565|gb|ABK93203.1| unknown [Populus trichocarpa] gi|222858787|gb|EEE96334.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|386278568|gb|AFJ04516.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Vernicia fordii] Back     alignment and taxonomy information
>gi|346682873|gb|AEO45785.1| glyceraldehyde-3-phosphate dehydrogenase C [Scoparia dulcis] Back     alignment and taxonomy information
>gi|359491599|ref|XP_002263145.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Vitis vinifera] Back     alignment and taxonomy information
>gi|462141|sp|P34783.1|G3P_ATRNU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH gi|409575|gb|AAA03442.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia] gi|414607|emb|CAA53269.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query265
TAIR|locus:2010007338 GAPC2 "glyceraldehyde-3-phosph 0.992 0.778 0.855 1.8e-119
TAIR|locus:2103085338 GAPC1 "glyceraldehyde-3-phosph 0.992 0.778 0.855 2.3e-119
TAIR|locus:2032810420 GAPCP-2 "glyceraldehyde-3-phos 0.992 0.626 0.715 2.9e-96
TAIR|locus:2206435422 GAPCP-1 "glyceraldehyde-3-phos 0.992 0.623 0.704 1.2e-95
CGD|CAL0005657335 TDH3 [Candida albicans (taxid: 0.981 0.776 0.690 8.1e-92
UNIPROTKB|Q5ADM7335 TDH3 "Glyceraldehyde-3-phospha 0.981 0.776 0.690 8.1e-92
UNIPROTKB|Q5RAB4335 GAPDH "Glyceraldehyde-3-phosph 0.992 0.785 0.664 1.7e-89
UNIPROTKB|P04406335 GAPDH "Glyceraldehyde-3-phosph 0.992 0.785 0.656 2.2e-89
UNIPROTKB|G4NCH2336 MGG_01084 "Glyceraldehyde-3-ph 0.981 0.773 0.671 5.3e-88
UNIPROTKB|Q9N2D5333 GAPDH "Glyceraldehyde-3-phosph 0.981 0.780 0.660 5.3e-88
TAIR|locus:2010007 GAPC2 "glyceraldehyde-3-phosphate dehydrogenase C2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1176 (419.0 bits), Expect = 1.8e-119, P = 1.8e-119
 Identities = 225/263 (85%), Positives = 242/263 (92%)

Query:     3 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELK 62
             K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYMFKYDSVHGQWKHHELK
Sbjct:     5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK 64

Query:    63 VKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVI 122
             VKDDKTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFT               V+
Sbjct:    65 VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV 124

Query:   123 ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHS 182
             ISAPSKDAPMFVVGVNE+EYK +L+IVSNASCTTNCLAPLAKVI+D+FGIVEGLMTTVHS
Sbjct:   125 ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS 184

Query:   183 ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDV 242
             ITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLP+LNGKLTGM+FRVPTVDV
Sbjct:   185 ITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDV 244

Query:   243 SVVDLTVRLEKDASYDEIKAAIK 265
             SVVDLTVRLEK A+YDEIK AIK
Sbjct:   245 SVVDLTVRLEKAATYDEIKKAIK 267
GO:0005737 "cytoplasm" evidence=ISM
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS;RCA;TAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0006979 "response to oxidative stress" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA;TAS
GO:0006094 "gluconeogenesis" evidence=RCA;TAS
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0042742 "defense response to bacterium" evidence=IEP
GO:0016020 "membrane" evidence=IDA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0051049 "regulation of transport" evidence=RCA
TAIR|locus:2103085 GAPC1 "glyceraldehyde-3-phosphate dehydrogenase C subunit 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0005657 TDH3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ADM7 TDH3 "Glyceraldehyde-3-phosphate dehydrogenase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAB4 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|P04406 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G4NCH2 MGG_01084 "Glyceraldehyde-3-phosphate dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q9N2D5 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Felis catus (taxid:9685)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34923G3PC_PHYPA1, ., 2, ., 1, ., 1, 20.79840.98860.7660N/Ano
Q7FAH2G3PC2_ORYSJ1, ., 2, ., 1, ., 1, 20.92071.00.7863yesno
P54270G3PC_GRAGA1, ., 2, ., 1, ., 1, 20.71260.97730.7731N/Ano
Q42671G3PC_CRAPL1, ., 2, ., 1, ., 1, 20.90561.00.7863N/Ano
P08477G3PC2_HORVU1, ., 2, ., 1, ., 1, 20.88840.87920.7639N/Ano
P0CN74G3P_CRYNJ1, ., 2, ., 1, ., 1, 20.72510.98110.7669yesno
P0CN75G3P_CRYNB1, ., 2, ., 1, ., 1, 20.72510.98110.7669N/Ano
P29497G3P_COCHE1, ., 2, ., 1, ., 1, 20.70220.98110.7715N/Ano
P04796G3PC_SINAL1, ., 2, ., 1, ., 1, 20.91250.99240.7781N/Ano
A2YQT7G3PC_ORYSI1, ., 2, ., 1, ., 1, 20.87541.00.7863N/Ano
P09317G3P_USTMA1, ., 2, ., 1, ., 1, 20.70180.99240.7804N/Ano
Q00640G3P_ERYGR1, ., 2, ., 1, ., 1, 20.70940.99240.7781N/Ano
P26518G3PC_MAGLI1, ., 2, ., 1, ., 1, 20.94290.99240.7712N/Ano
P26519G3PC_PETCR1, ., 2, ., 1, ., 1, 20.88970.99240.7827N/Ano
P04406G3P_HUMAN2, ., 6, ., 9, 9, ., -0.69050.99240.7850yesno
P26517G3PC1_HORVU1, ., 2, ., 1, ., 1, 20.88671.00.7863N/Ano
Q43247G3PC3_MAIZE1, ., 2, ., 1, ., 1, 20.89431.00.7863N/Ano
P34924G3PC_PINSY1, ., 2, ., 1, ., 1, 20.87870.99620.7764N/Ano
Q6K5G8G3PC3_ORYSJ1, ., 2, ., 1, ., 1, 20.90181.00.7863nono
P34922G3PC_PEA1, ., 2, ., 1, ., 1, 20.91250.99240.7781N/Ano
Q9FX54G3PC2_ARATH1, ., 2, ., 1, ., 1, 20.91250.99240.7781yesno
P34921G3PC_DIACA1, ., 2, ., 1, ., 1, 20.89811.00.7840N/Ano
Q9UR38G3P_LENED1, ., 2, ., 1, ., 1, 20.70220.98110.7715N/Ano
P32636G3P2_AGABI1, ., 2, ., 1, ., 1, 20.70220.98110.7692N/Ano
Q9P8C0G3P_PHANO1, ., 2, ., 1, ., 1, 20.70220.98110.7715N/Ano
P25861G3PC_ANTMA1, ., 2, ., 1, ., 1, 20.90561.00.7863N/Ano
P09094G3PC_TOBAC1, ., 2, ., 1, ., 1, 20.92120.95840.7791N/Ano
Q8TFJ2G3P_OMPOL1, ., 2, ., 1, ., 1, 20.73280.98110.7715N/Ano
Q09054G3PC2_MAIZE1, ., 2, ., 1, ., 1, 20.88301.00.7863N/Ano
Q92211G3P_CANAW1, ., 2, ., 1, ., 1, 20.71370.98110.7761N/Ano
Q6CCU7G3P_YARLI1, ., 2, ., 1, ., 1, 20.71750.98110.7692yesno
Q39769G3PC_GINBI1, ., 2, ., 1, ., 1, 20.89770.99620.7764N/Ano
O01360G3P_ONCVO1, ., 2, ., 1, ., 1, 20.70580.98490.7699N/Ano
P34783G3P_ATRNU1, ., 2, ., 1, ., 1, 20.92831.00.7361N/Ano
Q41595G3PC_TAXBA1, ., 2, ., 1, ., 1, 20.8750.99620.7764N/Ano
P26521G3PC_RANAC1, ., 2, ., 1, ., 1, 20.89390.99620.7810N/Ano
P26520G3PC_PETHY1, ., 2, ., 1, ., 1, 20.91691.00.7863N/Ano
P28844G3P_COCLU1, ., 2, ., 1, ., 1, 20.70220.98110.7715N/Ano
Q6BMK0G3P_DEBHA1, ., 2, ., 1, ., 1, 20.72130.98110.7761yesno
P17878G3PC_MESCR1, ., 2, ., 1, ., 1, 20.88301.00.7863N/Ano
Q5RAB4G3P_PONAB2, ., 6, ., 9, 9, ., -0.69810.99240.7850yesno
Q9C136G3P1_MUCCL1, ., 2, ., 1, ., 1, 20.70610.98110.7715N/Ano
Q96UF2G3P2_MUCCL1, ., 2, ., 1, ., 1, 20.70880.97730.7662N/Ano
P08735G3PC1_MAIZE1, ., 2, ., 1, ., 1, 20.87541.00.7863N/Ano
P25858G3PC1_ARATH1, ., 2, ., 1, ., 1, 20.91250.99240.7781yesno
P16858G3P_MOUSE2, ., 6, ., 9, 9, ., -0.70220.98110.7807yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.120.979
4th Layer1.2.1.59LOW CONFIDENCE prediction!
3rd Layer1.2.10.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XII1463
SubName- Full=Putative uncharacterized protein; (338 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0154005402
phosphoglycerate kinase (EC-2.7.7.2 2.7.2.3) (402 aa)
•  • •• 0.956
eugene3.00080776
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (402 aa)
•  • •• 0.956
estExt_fgenesh4_pm.C_LG_VIII0335
phosphoglycerate kinase (481 aa)
•  • •• 0.946
estExt_fgenesh4_pm.C_LG_X0655
phosphoglycerate kinase (481 aa)
•  • •• 0.945
estExt_Genewise1_v1.C_LG_IV0988
hypothetical protein (256 aa)
••   •• 0.929
grail3.0049021504
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (254 aa)
••   •• 0.928
estExt_fgenesh4_pg.C_LG_I1744
triose-phosphate isomerase (EC-5.3.1.1) (255 aa)
••   •• 0.927
estExt_Genewise1_v1.C_LG_X2172
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (256 aa)
••   •• 0.927
eugene3.00091331
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (264 aa)
••   •• 0.923
estExt_Genewise1_v1.C_LG_IX1362
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (315 aa)
••   •• 0.913

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 1e-174
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 1e-168
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 1e-138
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 1e-138
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 1e-136
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 1e-107
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 1e-104
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 2e-98
PLN02237 442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 9e-88
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 4e-87
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 8e-87
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 3e-73
pfam00044148 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh 4e-73
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de 5e-72
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 8e-66
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 5e-64
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 1e-63
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 2e-62
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 2e-47
COG0136334 COG0136, Asd, Aspartate-semialdehyde dehydrogenase 7e-08
PRK04207341 PRK04207, PRK04207, glyceraldehyde-3-phosphate deh 2e-04
pfam01113122 pfam01113, DapB_N, Dihydrodipicolinate reductase, 3e-04
TIGR01296338 TIGR01296, asd_B, aspartate-semialdehyde dehydroge 5e-04
TIGR00978341 TIGR00978, asd_EA, aspartate-semialdehyde dehydrog 0.002
PRK00048257 PRK00048, PRK00048, dihydrodipicolinate reductase; 0.002
COG0289266 COG0289, DapB, Dihydrodipicolinate reductase [Amin 0.003
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  483 bits (1245), Expect = e-174
 Identities = 240/263 (91%), Positives = 257/263 (97%)

Query: 3   KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELK 62
           K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYMFKYDSVHGQWKHHELK
Sbjct: 5   KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHHELK 64

Query: 63  VKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVI 122
           VKDDKTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFTDKDKAAAHLKGGAKKV+
Sbjct: 65  VKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVV 124

Query: 123 ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTVHS 182
           ISAPSKDAPMFVVGVNE+EYK +L+IVSNASCTTNCLAPLAKVI+D+FGIVEGLMTTVHS
Sbjct: 125 ISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHS 184

Query: 183 ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDV 242
           ITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLP+LNGKLTGM+FRVPTVDV
Sbjct: 185 ITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDV 244

Query: 243 SVVDLTVRLEKDASYDEIKAAIK 265
           SVVDLTVRLEK A+YDEIK AIK
Sbjct: 245 SVVDLTVRLEKAATYDEIKKAIK 267

Length = 338
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179786 PRK04207, PRK04207, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|233220 TIGR00978, asd_EA, aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>gnl|CDD|234595 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>gnl|CDD|223366 COG0289, DapB, Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 265
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
PRK08040336 putative semialdehyde dehydrogenase; Provisional 100.0
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 100.0
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 100.0
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 100.0
PLN02383344 aspartate semialdehyde dehydrogenase 100.0
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 100.0
KOG0657285 consensus Glyceraldehyde 3-phosphate dehydrogenase 100.0
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 100.0
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 100.0
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 100.0
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 100.0
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 100.0
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 100.0
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 100.0
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 100.0
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 100.0
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 99.97
KOG4354340 consensus N-acetyl-gamma-glutamyl-phosphate reduct 99.93
KOG4777361 consensus Aspartate-semialdehyde dehydrogenase [Am 99.9
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 99.81
PRK08300302 acetaldehyde dehydrogenase; Validated 99.72
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 99.71
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.55
PF02774184 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer 99.35
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 98.97
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.95
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 98.84
PRK00048257 dihydrodipicolinate reductase; Provisional 98.77
PRK13303265 L-aspartate dehydrogenase; Provisional 98.74
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 98.62
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.61
PRK11579 346 putative oxidoreductase; Provisional 98.61
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 98.61
TIGR00036266 dapB dihydrodipicolinate reductase. 98.59
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.42
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 98.39
COG0673 342 MviM Predicted dehydrogenases and related proteins 98.37
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.36
PRK06349 426 homoserine dehydrogenase; Provisional 98.32
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 98.32
PRK10206 344 putative oxidoreductase; Provisional 98.26
PRK06270341 homoserine dehydrogenase; Provisional 98.22
PLN02775286 Probable dihydrodipicolinate reductase 98.06
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 97.75
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.73
PRK08374336 homoserine dehydrogenase; Provisional 97.68
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.68
PRK06813346 homoserine dehydrogenase; Validated 97.68
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 97.68
PRK06392326 homoserine dehydrogenase; Provisional 97.66
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 97.59
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 97.57
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 97.53
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 97.46
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 97.42
COG2344211 AT-rich DNA-binding protein [General function pred 97.37
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.33
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 97.29
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.26
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 97.24
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.19
PLN02700 377 homoserine dehydrogenase family protein 97.14
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 97.02
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.98
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 96.95
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.78
PTZ00431260 pyrroline carboxylate reductase; Provisional 96.76
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.69
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.68
PRK07417279 arogenate dehydrogenase; Reviewed 96.63
PLN02256304 arogenate dehydrogenase 96.6
COG3804350 Uncharacterized conserved protein related to dihyd 96.59
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 96.56
COG2910211 Putative NADH-flavin reductase [General function p 96.45
CHL00194317 ycf39 Ycf39; Provisional 96.44
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.43
PRK08818 370 prephenate dehydrogenase; Provisional 96.42
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 96.42
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 96.38
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.35
PRK07502307 cyclohexadienyl dehydrogenase; Validated 96.33
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 96.22
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.21
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.17
PRK06223307 malate dehydrogenase; Reviewed 96.15
PRK09414445 glutamate dehydrogenase; Provisional 96.09
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.03
PLN02688266 pyrroline-5-carboxylate reductase 96.02
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 95.99
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 95.98
PRK08507275 prephenate dehydrogenase; Validated 95.97
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 95.86
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.82
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.78
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.77
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 95.74
PRK08618325 ornithine cyclodeaminase; Validated 95.68
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.64
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 95.56
PTZ00082321 L-lactate dehydrogenase; Provisional 95.52
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 95.44
PRK06046326 alanine dehydrogenase; Validated 95.41
PLN02602350 lactate dehydrogenase 95.39
PTZ00117319 malate dehydrogenase; Provisional 95.39
PLN02712 667 arogenate dehydrogenase 95.39
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 95.39
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 95.34
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 95.3
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.26
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 95.25
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 95.25
PRK07680273 late competence protein ComER; Validated 95.25
PLN02712667 arogenate dehydrogenase 95.22
PTZ00325321 malate dehydrogenase; Provisional 95.19
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.16
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 95.12
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.11
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 95.08
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 95.06
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 95.05
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.05
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 95.05
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 94.99
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 94.95
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 94.94
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 94.88
PLN00016378 RNA-binding protein; Provisional 94.87
PRK07574385 formate dehydrogenase; Provisional 94.86
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 94.81
PRK08306296 dipicolinate synthase subunit A; Reviewed 94.73
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 94.71
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.69
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 94.58
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 94.5
PRK12921305 2-dehydropantoate 2-reductase; Provisional 94.47
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 94.46
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.43
PRK08605332 D-lactate dehydrogenase; Validated 94.42
PRK05479330 ketol-acid reductoisomerase; Provisional 94.42
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 94.28
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 94.26
PLN03139386 formate dehydrogenase; Provisional 94.25
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 94.25
PRK05086312 malate dehydrogenase; Provisional 94.24
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 94.21
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 94.21
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 94.18
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.11
PRK06444197 prephenate dehydrogenase; Provisional 94.08
PRK08655 437 prephenate dehydrogenase; Provisional 93.98
PRK13403335 ketol-acid reductoisomerase; Provisional 93.96
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 93.92
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 93.84
PLN00106323 malate dehydrogenase 93.8
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 93.79
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.76
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 93.75
PRK06545359 prephenate dehydrogenase; Validated 93.74
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 93.71
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 93.7
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.64
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 93.49
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 93.39
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 93.36
PRK15059292 tartronate semialdehyde reductase; Provisional 93.29
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 93.22
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 93.22
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 93.21
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 93.0
PLN00112444 malate dehydrogenase (NADP); Provisional 92.97
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 92.97
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.96
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 92.92
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 92.87
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 92.71
PRK06719157 precorrin-2 dehydrogenase; Validated 92.68
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 92.64
cd01483143 E1_enzyme_family Superfamily of activating enzymes 92.54
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.47
PLN02166436 dTDP-glucose 4,6-dehydratase 92.46
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 92.41
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 92.31
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 92.31
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 92.3
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 92.25
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 92.19
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 92.12
PRK14031444 glutamate dehydrogenase; Provisional 92.03
TIGR00243 389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 91.88
PLN00203519 glutamyl-tRNA reductase 91.86
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.82
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 91.79
PRK05442326 malate dehydrogenase; Provisional 91.64
PLN02206442 UDP-glucuronate decarboxylase 91.43
KOG2733 423 consensus Uncharacterized membrane protein [Functi 91.42
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 91.29
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 91.25
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 91.07
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 90.96
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 90.95
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 90.89
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 90.84
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.77
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 90.66
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 90.63
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 90.36
PRK06487317 glycerate dehydrogenase; Provisional 90.36
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 90.31
PRK12320 699 hypothetical protein; Provisional 90.22
PRK11908347 NAD-dependent epimerase/dehydratase family protein 90.21
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 90.2
PRK14030445 glutamate dehydrogenase; Provisional 90.16
PRK08291330 ectoine utilization protein EutC; Validated 90.14
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.12
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 90.1
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 90.02
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 90.0
PRK06932314 glycerate dehydrogenase; Provisional 89.97
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 89.97
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 89.89
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 89.72
PRK06407301 ornithine cyclodeaminase; Provisional 89.65
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 89.65
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 89.63
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.6
COG5322351 Predicted dehydrogenase [General function predicti 89.57
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.4
PRK08219227 short chain dehydrogenase; Provisional 89.24
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 89.18
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 89.18
PRK05708305 2-dehydropantoate 2-reductase; Provisional 89.11
PLN02353 473 probable UDP-glucose 6-dehydrogenase 89.09
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 89.06
PRK07236 386 hypothetical protein; Provisional 89.06
PRK06436303 glycerate dehydrogenase; Provisional 88.7
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.67
PLN02928347 oxidoreductase family protein 88.59
COG0743 385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 88.46
KOG0455 364 consensus Homoserine dehydrogenase [Amino acid tra 88.43
PLN03209 576 translocon at the inner envelope of chloroplast su 88.42
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 88.41
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 88.41
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 88.35
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 88.29
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 88.28
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 88.24
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 88.24
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 88.21
PRK11730 715 fadB multifunctional fatty acid oxidation complex 88.08
PRK06199379 ornithine cyclodeaminase; Validated 88.06
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 88.05
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 87.99
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 87.96
PRK12480330 D-lactate dehydrogenase; Provisional 87.89
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 87.81
PLN02858 1378 fructose-bisphosphate aldolase 87.74
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 87.65
KOG2711372 consensus Glycerol-3-phosphate dehydrogenase/dihyd 87.61
PRK08223287 hypothetical protein; Validated 87.54
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 87.54
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 87.46
PRK13243333 glyoxylate reductase; Reviewed 87.45
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.43
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 87.38
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.31
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 87.17
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.12
PLN02858 1378 fructose-bisphosphate aldolase 87.12
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 87.11
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 87.06
KOG2742 367 consensus Predicted oxidoreductase [General functi 86.99
PRK05865 854 hypothetical protein; Provisional 86.87
PLN00125300 Succinyl-CoA ligase [GDP-forming] subunit alpha 86.85
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 86.74
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 86.72
PLN02427 386 UDP-apiose/xylose synthase 86.71
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 86.43
COG0569225 TrkA K+ transport systems, NAD-binding component [ 86.39
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 86.34
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 86.11
PRK06141314 ornithine cyclodeaminase; Validated 86.07
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 85.94
PRK05562223 precorrin-2 dehydrogenase; Provisional 85.93
PRK09496 453 trkA potassium transporter peripheral membrane com 85.87
PRK07340304 ornithine cyclodeaminase; Validated 85.82
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 85.78
PLN02477410 glutamate dehydrogenase 85.69
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 85.65
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 85.64
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 85.59
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 85.24
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 85.09
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 84.94
PRK06823315 ornithine cyclodeaminase; Validated 84.94
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 84.91
PRK09880343 L-idonate 5-dehydrogenase; Provisional 84.86
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.66
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.34
PRK15116268 sulfur acceptor protein CsdL; Provisional 84.32
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 84.27
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.23
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 84.2
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 84.18
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 83.88
PLN02306386 hydroxypyruvate reductase 83.84
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 83.76
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 83.24
PRK13940414 glutamyl-tRNA reductase; Provisional 83.22
PRK12549284 shikimate 5-dehydrogenase; Reviewed 83.12
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 82.95
PRK04965 377 NADH:flavorubredoxin oxidoreductase; Provisional 82.69
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 82.62
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 82.6
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 82.55
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 82.5
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.39
PLN02695370 GDP-D-mannose-3',5'-epimerase 82.22
PRK09754 396 phenylpropionate dioxygenase ferredoxin reductase 82.22
PRK11259 376 solA N-methyltryptophan oxidase; Provisional 82.21
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 81.99
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.98
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 81.86
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 81.8
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 81.72
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 81.7
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 81.64
PRK05600370 thiamine biosynthesis protein ThiF; Validated 81.55
PRK07589346 ornithine cyclodeaminase; Validated 81.52
PLN02240352 UDP-glucose 4-epimerase 81.5
PRK07877 722 hypothetical protein; Provisional 81.43
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.33
PLN00198338 anthocyanidin reductase; Provisional 81.23
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 81.21
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 81.14
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.12
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 81.11
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 80.9
PRK14989 847 nitrite reductase subunit NirD; Provisional 80.72
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.63
PRK09126 392 hypothetical protein; Provisional 80.51
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 80.31
PRK13512 438 coenzyme A disulfide reductase; Provisional 80.27
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 80.23
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 80.22
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3e-60  Score=419.35  Aligned_cols=262  Identities=68%  Similarity=1.073  Sum_probs=244.7

Q ss_pred             CCccEEEEEccChhHHHHHHHHHcCCCeEEEEEeccCCChhhhhhheeeecccCcccccceeeeCCceEEECCEEEEEEe
Q 024629            1 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFG   80 (265)
Q Consensus         1 m~~~~V~IiG~G~~G~~l~r~L~~~p~~el~~i~~~~~~~~~~a~l~~~~~~~~~~~~~~v~~~~~~~l~~~g~~i~~~~   80 (265)
                      |+ +||||+|||+|||.++|++.+++++|+++|+++..+.+.++|||+|||+||+|+ +.+..+++ .|.++|+.|++++
T Consensus         1 m~-~ki~INGfGRIGr~v~r~~~~~~~~~vvaiNd~~~~~~~~ayll~yDS~hG~~~-~~v~~~~~-~l~i~g~~i~~~~   77 (337)
T PTZ00023          1 MV-VKLGINGFGRIGRLVFRAALEREDVEVVAINDPFMTLDYMCYLLKYDSVHGSLP-AEVSVTDG-FLMIGSKKVHVFF   77 (337)
T ss_pred             Cc-eEEEEECcChHHHHHHHHHHhcCCeEEEEecCCCCChHHhhhhheeecCCCCCC-CcEEecCC-EEEECCeEEEEEe
Confidence            54 899999999999999999888889999999997778999999999999999998 77776655 6999999999999


Q ss_pred             cCCCCCCCccccCccEEEEecCCcccHHHHHHHHhCCCcEEEEcCCCC-CCceEEeeeCcccccCCCCeEEcCCccchhh
Q 024629           81 VRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSK-DAPMFVVGVNENEYKPELNIVSNASCTTNCL  159 (265)
Q Consensus        81 ~~d~~~~~~~~~~~DvV~~atp~~~~~~~~~~~~~~g~~~vviS~~~~-~~~~~v~gvn~~~i~~~~~~V~~p~C~~ta~  159 (265)
                      ..||+++||.+.++|+||+|||.+.++++++.++++|+|+|++|++.+ ++|++|||+|++.++...++||||+|+|+++
T Consensus        78 ~~dp~~lpW~~~gvDiVle~tG~~~s~~~a~~~l~aGak~V~iSap~~~~vp~vV~gVN~~~~~~~~~IISnasCTTn~L  157 (337)
T PTZ00023         78 EKDPAAIPWGKNGVDVVCESTGVFLTKEKAQAHLKGGAKKVIMSAPPKDDTPIYVMGVNHTQYDKSQRIVSNASCTTNCL  157 (337)
T ss_pred             CCChhhCCccccCCCEEEEecchhcCHHHHHHHhhCCCEEEEeCCCCCCCCCeEEcccCHHHhCCCCCEEECCccHHHHH
Confidence            999999999989999999999999999999999999999898998743 4799999999999976567999999999999


Q ss_pred             hhHHHHHHHhcCeeEEEEEEEeeccccccccCCCC--CccccCccccccccccccCChhhhHhhhcccCCCceeEEEEEe
Q 024629          160 APLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPS--SKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRV  237 (265)
Q Consensus       160 ~l~L~pL~~~~~i~~~~~~~~~~~sg~~~~~d~~~--~~~~~~g~~~~~n~~p~~~~~~~~~~~~~~e~~~~v~~~~~~v  237 (265)
                      +|+|+||+++|||+++.+||+|++|..|..+|+++  +++++++|++++|++|+.+|.++++.+++|+++++++++++||
T Consensus       158 ap~lk~L~~~fgI~~~~~TT~ha~T~~Q~lld~~~~~~kd~r~~r~~a~NiIP~~tGaakav~kVlPeL~gkl~g~avRV  237 (337)
T PTZ00023        158 APLAKVVNDKFGIVEGLMTTVHASTANQLTVDGPSKGGKDWRAGRCAGVNIIPASTGAAKAVGKVIPELNGKLTGMAFRV  237 (337)
T ss_pred             HHHHHHHHHhcCeeEEEEEEEEecCCCceecCCcCcccCCCcccceeeccccccCCCcchhhhheecccCCcEEEEEEEe
Confidence            99999999999999999999999999998889875  4688999999999999999999999999999999999999999


Q ss_pred             eecceEEEEEEEEeCCCCCHHHHHHHhC
Q 024629          238 PTVDVSVVDLTVRLEKDASYDEIKAAIK  265 (265)
Q Consensus       238 P~~~G~~~~~~~~l~~~~~~~~v~~~~~  265 (265)
                      |+++||+.+++++++++++.||++++|+
T Consensus       238 Pt~~~s~~dltv~l~k~vt~eev~~al~  265 (337)
T PTZ00023        238 PVPDVSVVDLTCKLAKPAKYEEIVAAVK  265 (337)
T ss_pred             cccCeEEEEEEEEECCCCCHHHHHHHHH
Confidence            9999999999999999999999999874

>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>KOG0455 consensus Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>KOG2742 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 1e-129
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 1e-128
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 7e-98
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 1e-97
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 2e-96
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 6e-96
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 1e-95
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 1e-95
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 2e-94
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-94
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 4e-94
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 5e-94
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 6e-94
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 1e-93
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 2e-89
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 4e-89
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 5e-88
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 5e-88
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 9e-87
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 4e-86
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 4e-86
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 4e-86
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 4e-85
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 7e-85
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 2e-82
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 5e-82
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 6e-77
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 2e-75
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-72
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 8e-71
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 5e-70
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 5e-70
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 1e-66
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 4e-66
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 9e-66
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-65
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-65
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 8e-62
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 1e-59
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 1e-57
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-56
2pkq_O 368 Crystal Structure Of The Photosynthetic A2b2-Glycer 5e-54
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 8e-54
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 3e-53
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 8e-52
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 8e-52
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 9e-52
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 9e-52
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 2e-51
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-51
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 2e-51
2pkr_O 365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 2e-51
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 4e-51
1cer_O331 Determinants Of Enzyme Thermostability Observed In 5e-51
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 5e-51
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 6e-51
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 1e-50
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 2e-50
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 5e-50
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 9e-50
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 1e-49
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 5e-47
2d2i_A 380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 5e-47
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 4e-46
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 2e-45
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 2e-41
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 2e-41
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 7e-39
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure 
Iteration: 1

 Score =  456 bits (1173), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 218/265 (82%), Positives = 237/265 (89%)
Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE 60
           MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYMFKYD+VHGQWKH +
Sbjct: 1   MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD 60
Query: 61  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXX 120
           +K+KD KTLL GEKPVTVFG+RNP+EIPWAE GAEYVVESTGVFT               
Sbjct: 61  IKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK 120
Query: 121 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 180
           V+ISAPSKDAPMFV GVNE++Y  +++IVSNASCTTNCLAPLAKVIHD FGI+EGLMTTV
Sbjct: 121 VVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTV 180
Query: 181 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 240
           H+ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLP LNGKLTGM+FRVPTV
Sbjct: 181 HAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTV 240
Query: 241 DVSVVDLTVRLEKDASYDEIKAAIK 265
           DVSVVDLTVR+EK ASYD IK+AIK
Sbjct: 241 DVSVVDLTVRIEKAASYDAIKSAIK 265
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query265
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 0.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 0.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 0.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 0.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 0.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 0.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 0.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 0.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 1e-166
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1e-164
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 1e-160
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 1e-160
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 1e-158
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 1e-157
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 1e-155
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 1e-155
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 1e-154
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 1e-152
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 1e-144
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 1e-138
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 1e-137
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 1e-110
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 1e-106
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 1e-104
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 4e-68
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 2e-08
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 9e-08
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 1e-05
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 2e-05
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 2e-05
3euw_A344 MYO-inositol dehydrogenase; protein structure init 3e-05
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 3e-05
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 9e-05
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 1e-04
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 1e-04
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 2e-04
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 3e-04
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 3e-04
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 4e-04
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 4e-04
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 4e-04
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 4e-04
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 5e-04
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 7e-04
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 7e-04
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
 Score =  554 bits (1430), Expect = 0.0
 Identities = 232/265 (87%), Positives = 252/265 (95%)

Query: 1   MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHE 60
           MGK+KIGINGFGRIGRLVARV LQ +DVELVAVNDPFITTDYMTYMFKYD+VHGQWKH +
Sbjct: 1   MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD 60

Query: 61  LKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKK 120
           +K+KD KTLL GEKPVTVFG+RNP+EIPWAE GAEYVVESTGVFTDK+KAAAHLKGGAKK
Sbjct: 61  IKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK 120

Query: 121 VIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 180
           V+ISAPSKDAPMFV GVNE++Y  +++IVSNASCTTNCLAPLAKVIHD FGI+EGLMTTV
Sbjct: 121 VVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTV 180

Query: 181 HSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV 240
           H+ITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLP LNGKLTGM+FRVPTV
Sbjct: 181 HAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTV 240

Query: 241 DVSVVDLTVRLEKDASYDEIKAAIK 265
           DVSVVDLTVR+EK ASYD IK+AIK
Sbjct: 241 DVSVVDLTVRIEKAASYDAIKSAIK 265
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Length = 320 Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Length = 304 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Length = 350 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Length = 308 Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Length = 315 Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Length = 344 Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Length = 319 Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Length = 294 Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Length = 344 Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Length = 354 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Length = 357 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Length = 359 Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Length = 288 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Length = 346 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Length = 344 Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Length = 444 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Length = 359 Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Length = 336 Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Length = 387 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Length = 354 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 100.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 100.0
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 100.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 100.0
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 100.0
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 100.0
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 100.0
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 100.0
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 100.0
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 100.0
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 100.0
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 100.0
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 100.0
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 100.0
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 100.0
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 100.0
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 100.0
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 100.0
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 100.0
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 100.0
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 99.29
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 99.08
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 99.01
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 98.88
4had_A350 Probable oxidoreductase protein; structural genomi 98.84
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.84
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 98.82
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 98.81
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 98.8
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 98.8
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.79
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 98.78
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.78
4h3v_A 390 Oxidoreductase domain protein; structural genomics 98.77
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.75
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.75
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.74
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 98.74
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.73
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.72
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.71
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 98.7
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 98.7
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.69
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 98.68
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 98.68
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.65
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 98.65
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 98.64
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.64
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 98.64
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 98.61
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 98.6
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.6
1ydw_A 362 AX110P-like protein; structural genomics, protein 98.59
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 98.58
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 98.57
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 98.57
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 98.55
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.53
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.52
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 98.52
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.51
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 98.49
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 98.49
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 98.48
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 98.48
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 98.48
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 98.47
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 98.46
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 98.45
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 98.41
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 98.38
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 98.38
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 98.37
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 98.36
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 98.32
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 98.32
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 98.31
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.28
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 98.21
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 98.18
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.16
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.12
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 98.03
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 98.02
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 98.0
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.98
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 97.93
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.89
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.82
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.74
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 97.68
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.49
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.47
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.46
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 97.4
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.37
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 97.32
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 97.28
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.24
2duw_A145 Putative COA-binding protein; ligand binding prote 97.23
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 97.22
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 97.19
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.18
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.18
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.17
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.16
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 97.1
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 97.05
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.98
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.96
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.93
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.9
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.87
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 96.86
1iuk_A140 Hypothetical protein TT1466; structural genomics, 96.85
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 96.84
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.83
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 96.77
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 96.76
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 96.69
1vpd_A299 Tartronate semialdehyde reductase; structural geno 96.68
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 96.66
3slg_A372 PBGP3 protein; structural genomics, seattle struct 96.66
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 96.65
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 96.65
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.65
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.64
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.63
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.61
4ezb_A317 Uncharacterized conserved protein; structural geno 96.6
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 96.58
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 96.56
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.56
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 96.53
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.52
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.51
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.51
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 96.51
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 96.5
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.5
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.47
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 96.44
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.37
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.36
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.36
1yb4_A295 Tartronic semialdehyde reductase; structural genom 96.31
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.24
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.21
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.21
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.2
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 96.19
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 96.18
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 96.17
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.15
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 96.13
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 96.12
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.09
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 96.09
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 96.06
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 96.04
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.03
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.02
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 96.0
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 95.99
3c7a_A 404 Octopine dehydrogenase; L) stereospecific opine de 95.98
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.97
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.96
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.95
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.88
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.88
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.87
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.8
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 95.75
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 95.72
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 95.69
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 95.67
3l6d_A306 Putative oxidoreductase; structural genomics, prot 95.67
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.66
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 95.65
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.63
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.62
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 95.6
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 95.59
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 95.57
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 95.52
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.52
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 95.51
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.47
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.47
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 95.42
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 95.4
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.39
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.39
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 95.39
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 95.37
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 95.36
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 95.22
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.21
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.2
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 95.18
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 95.17
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 95.15
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 95.07
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 95.05
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 95.03
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.96
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 94.95
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 94.94
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 94.91
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 94.9
2csu_A 457 457AA long hypothetical protein; structural genomi 94.87
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 94.87
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 94.75
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 94.75
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 94.74
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 94.62
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 94.61
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.61
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 94.58
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.54
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 94.52
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 94.52
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 94.51
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 94.5
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 94.48
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 94.47
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 94.45
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.4
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 94.3
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.24
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 94.21
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 94.19
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 94.17
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 94.13
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 94.13
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 94.12
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 94.1
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.09
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 93.12
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 93.94
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 93.81
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 93.76
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 93.67
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.61
3mwd_B334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, 93.46
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 93.38
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 93.27
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 93.15
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 93.14
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 93.13
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.08
1lss_A140 TRK system potassium uptake protein TRKA homolog; 92.91
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 92.79
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 92.72
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 92.59
1xq6_A253 Unknown protein; structural genomics, protein stru 92.51
2y1e_A 398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 92.49
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.45
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.42
1q0q_A 406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 92.37
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 92.24
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 92.15
3au8_A 488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 91.74
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 91.7
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 91.59
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 91.57
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 91.41
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 91.2
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 91.14
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 91.11
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.74
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 90.72
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 90.72
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 90.67
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 90.55
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 90.53
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 90.51
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 90.24
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 90.21
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 90.08
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 90.07
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 89.99
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 89.8
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 89.66
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 89.61
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.54
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 89.29
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 89.23
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 88.99
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 88.97
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 88.88
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 88.75
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 88.75
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 88.69
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 88.43
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 88.36
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 88.32
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 88.28
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 88.17
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 88.13
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 88.1
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 88.01
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.97
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 87.97
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 87.94
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 87.92
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 87.89
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 87.87
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 87.8
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 87.74
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 87.7
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 87.62
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 87.61
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 87.46
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 87.42
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 87.42
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 87.32
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 87.28
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 87.25
3tl2_A315 Malate dehydrogenase; center for structural genomi 86.97
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 86.91
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 86.85
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 86.84
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 86.74
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 86.71
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 86.68
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 86.56
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 86.36
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 86.19
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 86.12
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 86.12
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 86.06
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 86.01
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 86.0
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 85.98
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 85.86
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 85.73
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 85.73
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 85.67
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 85.65
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 85.43
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 85.26
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 85.13
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 85.09
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 84.91
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 84.79
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 84.62
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 84.43
2ywl_A180 Thioredoxin reductase related protein; uncharacter 84.39
4hb9_A 412 Similarities with probable monooxygenase; flavin, 84.38
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 84.25
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 84.04
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 83.69
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 83.68
2cul_A232 Glucose-inhibited division protein A-related PROT 83.65
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 83.64
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 83.58
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 83.57
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 83.54
3d1c_A 369 Flavin-containing putative monooxygenase; NP_37310 83.53
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 83.49
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 83.42
4g65_A461 TRK system potassium uptake protein TRKA; structur 83.2
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 83.12
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 83.08
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 83.02
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 82.96
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 82.8
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 82.41
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 82.28
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 82.27
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 82.26
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 82.22
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 82.21
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 82.19
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 82.15
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 82.06
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 82.01
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 81.93
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 81.85
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 81.66
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 81.25
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 81.24
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 81.24
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 81.16
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 81.1
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 81.05
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 80.81
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 80.79
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 80.75
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 80.71
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 80.67
4g65_A 461 TRK system potassium uptake protein TRKA; structur 80.56
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 80.53
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 80.52
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 80.26
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 80.04
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
Probab=100.00  E-value=4.8e-64  Score=441.14  Aligned_cols=264  Identities=88%  Similarity=1.351  Sum_probs=250.3

Q ss_pred             CCccEEEEEccChhHHHHHHHHHcCCCeEEEEEeccCCChhhhhhheeeecccCccccc-ceeeeCCceEEECCEEEEEE
Q 024629            1 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHH-ELKVKDDKTLLFGEKPVTVF   79 (265)
Q Consensus         1 m~~~~V~IiG~G~~G~~l~r~L~~~p~~el~~i~~~~~~~~~~a~l~~~~~~~~~~~~~-~v~~~~~~~l~~~g~~i~~~   79 (265)
                      |+++||||+|||+|||.++|++.+++++|+++|+|...+.++++|||+|||+||+|+ + .+..++++.|.++|+.+.++
T Consensus         1 m~~~kv~INGfGrIGr~v~R~~~~~~~~~ivaiNd~~~d~~~~a~l~kyDS~hG~f~-~~~v~~~~~~~l~i~Gk~I~v~   79 (337)
T 3v1y_O            1 MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWK-HSDIKIKDSKTLLLGEKPVTVF   79 (337)
T ss_dssp             -CCEEEEEECCSHHHHHHHHHHHTCSSEEEEEEECTTSCHHHHHHHHHCCTTTCCCC-SSCEEEEETTEEEETTEEEEEE
T ss_pred             CCceEEEEECCChHHHHHHHHHHhCCCcEEEEEeCCCCCHHHHHHHhhhccCCCccc-CceEEEcCCcEEEECCEEEEEE
Confidence            778999999999999999999999999999999998779999999999999999999 7 77776554699999999999


Q ss_pred             ecCCCCCCCccccCccEEEEecCCcccHHHHHHHHhCCCcEEEEcCCCCCCceEEeeeCcccccCCCCeEEcCCccchhh
Q 024629           80 GVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCL  159 (265)
Q Consensus        80 ~~~d~~~~~~~~~~~DvV~~atp~~~~~~~~~~~~~~g~~~vviS~~~~~~~~~v~gvn~~~i~~~~~~V~~p~C~~ta~  159 (265)
                      +..||++++|.+.++|+||+|||.+++++.++.++++|+|+|+||++++|+|++|||+|++.++.+.++||||+|+|+++
T Consensus        80 ~e~dp~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d~p~vV~gVN~~~~~~~~~IISnasCTTn~L  159 (337)
T 3v1y_O           80 GIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCL  159 (337)
T ss_dssp             CCSSGGGCCHHHHTCCEEEECSSSCCSHHHHTHHHHTTCCEEEESSCCSSSCBCCTTTTGGGCCTTCCEEECCCHHHHHH
T ss_pred             EecCcccCCccccCCcEEEEeccccCCHHHHHHHHHcCCCEEEECCCCCCCCeECCCCCHHHcCCCCcEEecCchhhhhH
Confidence            88899999998889999999999999999999999999999999999888999999999999986678999999999999


Q ss_pred             hhHHHHHHHhcCeeEEEEEEEeeccccccccCCCCCccccCccccccccccccCChhhhHhhhcccCCCceeEEEEEeee
Q 024629          160 APLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPT  239 (265)
Q Consensus       160 ~l~L~pL~~~~~i~~~~~~~~~~~sg~~~~~d~~~~~~~~~g~~~~~n~~p~~~~~~~~~~~~~~e~~~~v~~~~~~vP~  239 (265)
                      +++|+||+++|||+++.+||+|++||+|+.+|++++++|+++|++++|++|+.+|.++++.+++||++++++.+++|||+
T Consensus       160 ap~lkvL~d~fGI~~g~mTTvha~T~~q~~~Dg~~~kd~r~~r~~a~NiIP~~tGaakav~kVlPeL~gkltg~avRVPv  239 (337)
T 3v1y_O          160 APLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPT  239 (337)
T ss_dssp             HHHHHHHHHHHCEEEEEEEEEECCCTTSBSSSCCCTTCGGGGSBGGGCCEEEECCHHHHHHHHSGGGTTSEEEEEEECSC
T ss_pred             HHHHHHHHHhcCeEEEEEeeeeeccchhhhccCCccccccccccccceeecCCCChHHHHHHhccccCCcEEEEEEEcCC
Confidence            99999999999999999999999999999999988789999999999999999999999999999999999999999999


Q ss_pred             cceEEEEEEEEeCCCCCHHHHHHHhC
Q 024629          240 VDVSVVDLTVRLEKDASYDEIKAAIK  265 (265)
Q Consensus       240 ~~G~~~~~~~~l~~~~~~~~v~~~~~  265 (265)
                      ++||+.+++++|+++++.||++++|+
T Consensus       240 ~~~s~~dlt~~lek~~t~eei~~~lk  265 (337)
T 3v1y_O          240 VDVSVVDLTVRIEKAASYDAIKSAIK  265 (337)
T ss_dssp             SSCEEEEEEEEESSCCCHHHHHHHHH
T ss_pred             CCcEEEEEEEEECCCCcHHHHHHHHH
Confidence            99999999999999999999999874
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 265
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 2e-70
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 9e-69
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 2e-65
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 1e-62
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 6e-62
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 7e-62
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 3e-61
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 8e-61
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 3e-59
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 3e-59
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 2e-57
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 1e-54
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 2e-52
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 1e-51
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 2e-50
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 5e-50
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 1e-49
d2czca2172 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp 3e-49
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 2e-44
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 3e-35
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 6e-35
d1f06a1170 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid de 4e-08
d2czca1162 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate de 4e-07
d1ydwa1184 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductas 5e-06
d2g17a1179 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamy 3e-05
d1nvmb1157 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge 3e-05
d1diha1162 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate re 7e-05
d1vkna1176 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamy 1e-04
d1tlta1164 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM 2e-04
d1lc0a1172 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { 2e-04
d1zh8a1181 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein T 4e-04
d1yl7a1135 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate re 0.003
d2cvoa1183 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde 0.004
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Human(Homo sapiens), liver isoform [TaxId: 9606]

 Score =  212 bits (540), Expect = 2e-70
 Identities = 89/164 (54%), Positives = 116/164 (70%), Gaps = 2/164 (1%)

Query: 3   KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELK 62
           KVK+G+NGFGRIGRLV R       V++VA+NDPFI  +YM YMF+YDS HG++ H  +K
Sbjct: 1   KVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKF-HGTVK 59

Query: 63  VKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVI 122
            ++ K L+    P+T+F  R+P +I W + GAEYVVESTGVFT  +KA AHL+GGAK+VI
Sbjct: 60  AENGK-LVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI 118

Query: 123 ISAPSKDAPMFVVGVNENEYKPELNIVSNASCTTNCLAPLAKVI 166
           ISAPS DAPMFV+GVN  +Y   L I+SNAS        +  ++
Sbjct: 119 ISAPSADAPMFVMGVNHEKYDNSLKIISNASNEFGYSNRVVDLM 162
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Length = 170 Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 162 Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 184 Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Length = 179 Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Length = 176 Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Length = 181 Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Length = 183 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query265
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.95
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.93
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.93
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.93
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.93
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.93
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.92
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.92
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.91
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.9
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.9
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.9
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.9
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.89
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.8
d1t4ba2221 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.79
d1mb4a2222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.79
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.79
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.75
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.75
d2gz1a2202 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.72
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.67
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.64
d2g17a2155 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.55
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.5
d2cvoa2165 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.48
d1vkna2163 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.45
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 99.2
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.82
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.69
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.68
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 98.67
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 98.56
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 98.51
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 98.46
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 98.38
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 98.26
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 98.03
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.99
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 97.88
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.74
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 97.57
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.52
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.47
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.26
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.25
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 97.19
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.18
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.17
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.17
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.09
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.04
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.98
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 96.96
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.89
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.87
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.77
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.69
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.69
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.55
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.55
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.53
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 96.49
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.35
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.32
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.24
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.22
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.07
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.04
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.02
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 95.92
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.87
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 95.87
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.74
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.72
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.58
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.36
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 95.33
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.22
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.18
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 95.06
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.88
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 94.8
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 94.8
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.65
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.45
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.41
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.97
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 93.83
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.69
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 93.49
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.36
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.15
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.05
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 93.05
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 92.93
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 92.78
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.69
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.53
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.35
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.33
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.14
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 91.54
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.36
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 91.26
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.21
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.2
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 91.08
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.04
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 90.95
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 90.94
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.94
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.86
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.83
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 90.82
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.82
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 90.59
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 90.49
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 90.43
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 90.28
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 90.23
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.07
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 90.06
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 90.05
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 90.03
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 89.96
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 89.88
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 89.73
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 89.72
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 89.65
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 89.55
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 89.54
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.25
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 89.13
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.74
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 88.73
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 88.63
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 88.3
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.28
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.22
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 88.21
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 88.0
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.19
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 87.16
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.94
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 86.68
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 86.66
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 86.55
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 86.31
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 86.14
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.09
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 85.97
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 85.9
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 84.99
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 84.82
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 84.42
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 84.12
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 83.92
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 83.67
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 83.6
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 83.39
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 82.95
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 82.7
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 82.69
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 82.58
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 82.56
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 82.46
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 82.31
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 82.2
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 82.06
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 81.69
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.65
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 81.33
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.24
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 81.21
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 80.98
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 80.47
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 80.43
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 80.37
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 80.33
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 80.02
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.8e-39  Score=254.40  Aligned_cols=162  Identities=45%  Similarity=0.798  Sum_probs=150.8

Q ss_pred             ccEEEEEccChhHHHHHHHHHcCCCeEEEEEeccCCChhhhhhheeeecccCcccccceeeeCCceEEECCEEEEEEecC
Q 024629            3 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVR   82 (265)
Q Consensus         3 ~~~V~IiG~G~~G~~l~r~L~~~p~~el~~i~~~~~~~~~~a~l~~~~~~~~~~~~~~v~~~~~~~l~~~g~~i~~~~~~   82 (265)
                      ++||||+||||+||.++|++.++|++++++|++. .+.+.++|||+|||+||+|. +.+..+++ .|.++|+.+++++..
T Consensus         1 tikigINGFGRIGR~v~R~~~~~~~i~ivaINd~-~~~~~~ayLl~yDSvhG~~~-~~v~~~~~-~l~ing~~I~i~~~~   77 (166)
T d1gado1           1 TIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDL-LDADYMAYMLKYDSTHGRFD-GTVEVKDG-HLIVNGKKIRVTAER   77 (166)
T ss_dssp             CEEEEEECCSHHHHHHHHHHHTCSSEEEEEEECS-SCHHHHHHHHHCCTTTCSCS-SCEEEETT-EEEETTEEEEEECCS
T ss_pred             CeEEEEECCcHHHHHHHHHHhhCCCeEEEEEeCC-CCHHHHhhhheecCCCCCcC-CeEEEeCC-EEEECCEEEEEEeCC
Confidence            4799999999999999999999999999999997 48899999999999999999 77776665 799999999999888


Q ss_pred             CCCCCCccccCccEEEEecCCcccHHHHHHHHhCCCcEEEEcCCCCC-CceEEeeeCcccccCCCCeEEcCCccchhhhh
Q 024629           83 NPEEIPWAETGAEYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKD-APMFVVGVNENEYKPELNIVSNASCTTNCLAP  161 (265)
Q Consensus        83 d~~~~~~~~~~~DvV~~atp~~~~~~~~~~~~~~g~~~vviS~~~~~-~~~~v~gvn~~~i~~~~~~V~~p~C~~ta~~l  161 (265)
                      +|++++|...++|+|+||||.+.+++.+..++++|+|+|++|++.+| .+++|||+|++.+++ .++||++||+|+|++|
T Consensus        78 ~p~~i~W~~~gvDiViEcTG~f~t~~~~~~hl~~gakkViiSaP~~d~~~~iV~GvN~~~~~~-~~iiS~aSCTTnclaP  156 (166)
T d1gado1          78 DPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAG-QDIVSNASNETGYSNK  156 (166)
T ss_dssp             SGGGGCHHHHTCSEEEECSSSCCSHHHHTHHHHTTCSEEEESSCCSSSCCBCCTTTTGGGCCS-CSEEECCCTTHHHHHH
T ss_pred             ChHHCCccccCCCEEEEccccccCHHHHHHHhcCCCceEEeeccccccCCEEEeCccccccCC-CCEEEeccHHHhHHHH
Confidence            99999998889999999999999999999999999999999999665 899999999999985 6899999999999999


Q ss_pred             HHHHHHH
Q 024629          162 LAKVIHD  168 (265)
Q Consensus       162 ~L~pL~~  168 (265)
                      .++.|.+
T Consensus       157 v~kvl~~  163 (166)
T d1gado1         157 VLDLIAH  163 (166)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9999865
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure