Citrus Sinensis ID: 024658

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
Protein Sequence
MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRDFGDLFSDDEIGCSSRPVTNEEAAASMSSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITGICRLSRDHQTR
Secondary Structure (PSIPRED)
cccccccccccEEEEccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHcccccccccHHHHcccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccc
Secondary Structure Prediction (SSPRO)
ccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcccccccccccccccccEHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEHHcccccccccccccccccccccccccccccccccccccccccHccccccccccccccHHEHHHHHHHHcccccccccHHHHHHHHHHcccccccc
Coil and Loop (DISEMBL)
mrkcelcecparmycesdqaslcwdcdekvhCANFLVAKHLRCLLCHvcqsltpwkasgpklgptvSVCDACVAAarcgvndddkavvrggsqserisghdetdddddyededddddddedpdeeeeeeddenqvvpwsgddsqsppqpppppvssscssiseedfSLKRMrdfgdlfsddeigcssrpvtneEAAAsmssyrplkqprptisdcdrdhgqsvsrSTAIISSLRglqnqtmtdqGDAAAAITGICRLSRDHQTR
Flexible Loop (DISEMBL)
mrkcelcecpaRMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAArcgvndddkavvrggsqserisghdetdddddyedeDDDDDDdedpdeeeeeeddenqvvpWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRDFGDLFSDDEIGCSSRPVTNEEAAasmssyrplkqprpTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITGICRLSRDHQTR
Low Complexity Region (SEG)
MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHdetdddddyededddddddedpdeeeeeeddeNQVVPWSGDDsqsppqpppppvssscssISEEDFSLKRMRDFGDLFSDDEIGCSSRPVTNEEAAASMSSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITGICRLSRDHQTR
Disordered region (IsUnstruct)
***CELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVND***********************************************************************************************************************************************************************AITGIC*********
Disordered Region (DISOPRED)
MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDD*********************************************************************************************************************************************************************AITGIC**S******
Disordered Region (DISEMBL)
MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK*****************************************************************************EEDFSLKRMRDFGDLFSDDEIGCSSRPVTNEEAAASMSSYRPLKQ******************STAIISSLRGLQNQTMTDQGDAAAAITGICRLSRDHQTR
Disordered Region (DISPRO)
**KCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK********************************************************************************F******DFGDLFSDD**********************************************AIISSLRGLQNQTMTDQGDAAAAITGICRLS******
Transmembrane Helix (TMHMM)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
Transmembrane Helix (MEMSAT)
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
TM Helix, Signal Peptide (MEMSAT_SVM)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
TM Helix, Signal Peptide (Phobius)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRDFGDLFSDDEIGCSSRPVTNEEAAASMSSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITGICRLSRDHQTR
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	264	2.2.26 [Sep-21-2011]
O82256	332	Zinc finger protein CONST	no	no	0.185	0.147	0.5	6e-06
Q9C9F4	356	Putative zinc finger prot	no	no	0.189	0.140	0.490	6e-06
Q9SK53	294	Zinc finger protein CONST	no	no	0.185	0.166	0.46	8e-06
O23379	330	Putative zinc finger prot	no	no	0.268	0.215	0.413	1e-05
Q940T9	362	Zinc finger protein CONST	no	no	0.185	0.135	0.44	2e-05
Q9SYM2	299	Probable salt tolerance-l	no	no	0.181	0.160	0.431	4e-05
Q96502	347	Zinc finger protein CONST	no	no	0.189	0.144	0.431	6e-05
O22800	402	Zinc finger protein CONST	no	no	0.174	0.114	0.468	8e-05
Q9LJ44	364	Zinc finger protein CONST	no	no	0.185	0.134	0.48	8e-05
Q9C7E8	433	Zinc finger protein CONST	no	no	0.174	0.106	0.446	0.0002

>sp|O82256|COL13_ARATH Zinc finger protein CONSTANS-LIKE 13 OS=Arabidopsis thaliana GN=COL13 PE=2 SV=1

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 2  RKCELCECP-ARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQ 50
          R C+ C+   A +YC++D A LC  CD++VH AN L AKH R LLC  C 
Sbjct: 11 RLCDYCDSSVALVYCKADSAKLCLACDKQVHVANQLFAKHFRSLLCDSCN 60

Arabidopsis thaliana (taxid: 3702)

>sp|Q9C9F4|COLX_ARATH Putative zinc finger protein At1g68190 OS=Arabidopsis thaliana GN=At1g68190 PE=2 SV=1

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 2  RKCELCECP-ARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQS 51
          R CE C+   A +YC +D A+LC  CD KVH AN L  +HLR +LC  C++
Sbjct: 12 RVCEFCKAYRAVVYCIADTANLCLTCDAKVHSANSLSGRHLRTVLCDSCKN 62

Arabidopsis thaliana (taxid: 3702)

>sp|Q9SK53|COL3_ARATH Zinc finger protein CONSTANS-LIKE 3 OS=Arabidopsis thaliana GN=COL3 PE=1 SV=1

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 2  RKCELCE-CPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQ 50
          R C+ C+   A ++C +D A LC DCD K+H AN L ++H R  LC VC+
Sbjct: 6  RLCDSCKSTAATLFCRADAAFLCGDCDGKIHTANKLASRHERVWLCEVCE 55

Arabidopsis thaliana (taxid: 3702)

>sp|O23379|COL11_ARATH Putative zinc finger protein CONSTANS-LIKE 11 OS=Arabidopsis thaliana GN=COL11 PE=3 SV=2

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 3  KCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
          +C+ C    A +YC+SD A LC +CD  VH AN L  +H R LLC  C SL P       
Sbjct: 4  RCDFCGTEKALIYCKSDSAKLCLNCDVNVHSANPLSQRHTRSLLCEKC-SLQPTAVHC-- 60

Query: 62 LGPTVSVCDACVAAA 76
          +   VS+C  C   A
Sbjct: 61 MNENVSLCQGCQWTA 75

Arabidopsis thaliana (taxid: 3702)

>sp|Q940T9|COL4_ARATH Zinc finger protein CONSTANS-LIKE 4 OS=Arabidopsis thaliana GN=COL4 PE=2 SV=2

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 2  RKCELCE-CPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQ 50
          + C+ C+   A +YC  D A LC  CD KVH AN L ++H R  +C VC+
Sbjct: 4  KLCDSCKSATAALYCRPDAAFLCLSCDSKVHAANKLASRHARVWMCEVCE 53

Arabidopsis thaliana (taxid: 3702)

>sp|Q9SYM2|STHY_ARATH Probable salt tolerance-like protein At1g78600 OS=Arabidopsis thaliana GN=At1g78600 PE=1 SV=2

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 10/58 (17%)

Query: 3  KCELCECP-ARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL---------CHVCQ 50
          +C +CE   A + C +D+A+LCW CDEK+H AN L  KH R  L         C +CQ
Sbjct: 4  QCNVCEAAEATVLCCADEAALCWACDEKIHAANKLAGKHQRVPLSASASSIPKCDICQ 61

Arabidopsis thaliana (taxid: 3702)

>sp|Q96502|COL2_ARATH Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis thaliana GN=COL2 PE=1 SV=1

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 2  RKCELCECPA-RMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQS 51
          R C+ C   A  +YCE+D A LC  CD +VH AN + ++H R  +C  C+S
Sbjct: 14 RACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQSCES 64

Putative transcription factor. Does not affect flowering time.

Arabidopsis thaliana (taxid: 3702)

>sp|O22800|COL14_ARATH Zinc finger protein CONSTANS-LIKE 14 OS=Arabidopsis thaliana GN=COL14 PE=2 SV=2

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 4  CELC-ECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVC 49
          CE C E  A ++C +D A LC  CD+ VH AN L  KH+R  +C  C
Sbjct: 12 CEFCGERTAVLFCRADTAKLCLPCDQHVHSANLLSRKHVRSQICDNC 58

Arabidopsis thaliana (taxid: 3702)

>sp|Q9LJ44|COL12_ARATH Zinc finger protein CONSTANS-LIKE 12 OS=Arabidopsis thaliana GN=COL12 PE=2 SV=2

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 3  KCELCECP-ARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQS 51
          KC+ C    A +YC+SD A LC +CD  VH AN L  +H+R L+C  C S
Sbjct: 4  KCDHCATSQALIYCKSDLAKLCLNCDVHVHSANPLSHRHIRSLICEKCFS 53

Arabidopsis thaliana (taxid: 3702)

>sp|Q9C7E8|COL15_ARATH Zinc finger protein CONSTANS-LIKE 15 OS=Arabidopsis thaliana GN=COL15 PE=2 SV=1

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 4  CELC-ECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVC 49
          C+ C E  A ++C +D A LC  CD++VH AN L  KH+R  +C  C
Sbjct: 9  CDFCGERTAVLFCRADTAKLCLPCDQQVHTANLLSRKHVRSQICDNC 55

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	264
449476704	269	PREDICTED: uncharacterized protein LOC10	0.965	0.947	0.498	5e-43
255569661	268	transcription factor, putative [Ricinus	0.973	0.958	0.494	2e-42
449458205	274	PREDICTED: uncharacterized protein LOC10	0.984	0.948	0.509	1e-41
297803370	191	hypothetical protein ARALYDRAFT_913814 [	0.670	0.926	0.502	2e-36
356554959	152	PREDICTED: uncharacterized protein LOC10	0.484	0.842	0.5	1e-32
225447717	299	PREDICTED: uncharacterized protein LOC10	0.912	0.806	0.41	1e-32
15237049	223	B-box type zinc finger-containing protei	0.719	0.852	0.473	2e-31
118489756	220	unknown [Populus trichocarpa x Populus d	0.655	0.786	0.547	3e-31
17979452	223	AT4g27310/M4I22_120 [Arabidopsis thalian	0.719	0.852	0.469	4e-31
296081249	266	unnamed protein product [Vitis vinifera]	0.844	0.838	0.407	2e-30

>gi|449476704|ref|XP_004154811.1| PREDICTED: uncharacterized protein LOC101228838 [Cucumis sativus]

 Score =  180 bits (457), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 136/273 (49%), Positives = 170/273 (62%), Gaps = 18/273 (6%)

Query: 1   MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
           M KCELC   ARM+CESDQA+LCWDCDEKVHCANFLVAKH R LLCHVCQS TPW ASG 
Sbjct: 1   MIKCELCGHQARMFCESDQANLCWDCDEKVHCANFLVAKHSRTLLCHVCQSPTPWAASGR 60

Query: 61  KLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDE 120
           KL PTVSVC+ CV      V+D      R       +   D+  DD+ ++  +  D ++ 
Sbjct: 61  KLTPTVSVCEGCVQ-----VHDGKCDQERRRENEVEVDDGDDFVDDEGFDSYEGGDSEEY 115

Query: 121 DPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRDFG-DLFS 179
           D  EE+++ED ENQVVPWS   S SPP PP    SS     +    + KRMR++G DL S
Sbjct: 116 DDGEEDDDEDGENQVVPWSYASSSSPPPPPTVTSSSEGEISAGAGVASKRMREYGVDLDS 175

Query: 180 DDEI-GC----SSRPVTNEEAAASMSSYRPLKQPRPT------ISDCDRDHGQSVSRSTA 228
           DDEI  C    S+RP  N+EA +S SS RPLKQ R T       S  D +  ++  +STA
Sbjct: 176 DDEIESCSAPPSTRPFFNDEATSS-SSLRPLKQARVTGPTQSITSTPDDEACKAELKSTA 234

Query: 229 IISSLRGLQNQTMTDQGDAAAAITGICRLSRDH 261
           ++ S++ LQN+  TD  DA+  I GIC++SRD 
Sbjct: 235 VVRSIQRLQNRLPTDINDASKMIFGICKMSRDQ 267

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255569661|ref|XP_002525796.1| transcription factor, putative [Ricinus communis] gi|223534946|gb|EEF36632.1| transcription factor, putative [Ricinus communis]

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 168/275 (61%), Gaps = 18/275 (6%)

Query: 1   MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
           M+ CELC   ARMYCESDQASLCW CDEKVH ANFLVAKH R LLC VCQS TPWKASGP
Sbjct: 1   MKGCELCGGAARMYCESDQASLCWSCDEKVHSANFLVAKHCRNLLCQVCQSPTPWKASGP 60

Query: 61  KLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDE 120
           KLGPTVS+CD+C +      N  D  +   G+  E + G+D  D+    + +DD  DDD 
Sbjct: 61  KLGPTVSICDSCFSLHNSSNNHRD-IIDDDGNVEESLEGNDHDDEF---DSDDDLYDDDV 116

Query: 121 DPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRD-FGDLFS 179
           D +EEEEEED +NQVVPWS      P            S +       KR+R+    L S
Sbjct: 117 DEEEEEEEEDGDNQVVPWSVTPPSPPSASSSDSEEEISSRLLG---GAKRVRESIAYLDS 173

Query: 180 DDEIGCSSRP-----VTNEEAAASMSSYRPLKQPRPTIS-----DCDRDHGQSVSRSTAI 229
           DDEIGCSS       ++  +   S+ S+R LKQ R   +     + D   GQ+ SRSTA+
Sbjct: 174 DDEIGCSSSQMDSGRISGNDEGNSLESFRKLKQRRRIRTEEEEEEDDHHDGQAESRSTAV 233

Query: 230 ISSLRGLQNQTMTDQGDAAAAITGICRLSRDHQTR 264
           I SL+ LQN+ +T++ +A+A I GICRLSRDH  R
Sbjct: 234 IDSLKRLQNEMVTNRDNASATILGICRLSRDHHNR 268

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449458205|ref|XP_004146838.1| PREDICTED: uncharacterized protein LOC101209141 [Cucumis sativus]

 Score =  176 bits (446), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 139/273 (50%), Positives = 170/273 (62%), Gaps = 13/273 (4%)

Query: 1   MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
           M KCELC   ARM+CESDQA+LCWDCDEKVHCANFLVAKH R LLCHVCQS TPW ASG 
Sbjct: 1   MIKCELCGHQARMFCESDQANLCWDCDEKVHCANFLVAKHSRTLLCHVCQSPTPWAASGR 60

Query: 61  KLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDE 120
           KL PTVSVC+ CV       + + +               DE  D  +  D ++DDD +E
Sbjct: 61  KLTPTVSVCEGCVQVHDGKCDQERRRENEVEVDDGDDFVDDEGFDSYEGGDSEEDDDGEE 120

Query: 121 DPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRDFG-DLFS 179
           D DEEE++ED ENQVVPWS   S SPP PP    SS     +    + KRMR++G DL S
Sbjct: 121 DDDEEEDDEDGENQVVPWSYASSSSPPPPPTVTSSSEGEISAGAGVASKRMREYGVDLDS 180

Query: 180 DDEI-GC----SSRPVTNEEAAASMSSYRPLKQPRPT------ISDCDRDHGQSVSRSTA 228
           DDEI  C    S+RP  N+EA +S SS RPLKQ R T       S  D +  ++  +STA
Sbjct: 181 DDEIESCSAPQSTRPFFNDEATSS-SSLRPLKQARVTGPTQSITSTPDDEACKAELKSTA 239

Query: 229 IISSLRGLQNQTMTDQGDAAAAITGICRLSRDH 261
           ++ S++ LQN+  TD  DA+  I GIC++SRD 
Sbjct: 240 VVRSIQRLQNRLPTDINDASKMIFGICKMSRDQ 272

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297803370|ref|XP_002869569.1| hypothetical protein ARALYDRAFT_913814 [Arabidopsis lyrata subsp. lyrata] gi|297315405|gb|EFH45828.1| hypothetical protein ARALYDRAFT_913814 [Arabidopsis lyrata subsp. lyrata]

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 122/209 (58%), Gaps = 32/209 (15%)

Query: 2   RKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
           +KC+LC   ARMYCESDQASLCWDCD KVH ANFLVAKH RCLLC  CQSLTPWKASG +
Sbjct: 3   KKCDLCSGVARMYCESDQASLCWDCDGKVHGANFLVAKHTRCLLCSACQSLTPWKASGLR 62

Query: 62  LGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDED 121
           LGPT SVCD+CVA    G          G   S    G +E    + +E E+D   +D+ 
Sbjct: 63  LGPTFSVCDSCVALKNAGGG--------GNRVSSESRGQEEV---NSFESEEDRIREDDG 111

Query: 122 PDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLK-RMRDFGDLF-S 179
            D E      ENQVVPWS     +  QPPP   SSS    S    + + R R+  DL  S
Sbjct: 112 GDGEA-----ENQVVPWS-----AAAQPPPVMSSSSSDCGSGGSVTKRTRTRENSDLLCS 161

Query: 180 DDEIGCSSRPVTNEEAAASMSSY-RPLKQ 207
           DDEIG SS        +A  S+Y RPLK+
Sbjct: 162 DDEIGSSS--------SAQESNYSRPLKR 182

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356554959|ref|XP_003545808.1| PREDICTED: uncharacterized protein LOC100805832 [Glycine max]

 Score =  146 bits (368), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 92/152 (60%), Gaps = 24/152 (15%)

Query: 1   MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
           MRKCELC  PA+++CESDQASLCW+CD KVH ANFLV KH R LLCHVCQSLT W  +GP
Sbjct: 1   MRKCELCNSPAKLFCESDQASLCWECDAKVHSANFLVTKHPRILLCHVCQSLTAWHGTGP 60

Query: 61  KLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDE 120
           K  PT+SVC+ CV                  + SE  S  +  +D DD  D+   +D  E
Sbjct: 61  KFVPTMSVCNTCV-----------------NNNSETCSQQNHVEDHDDNHDDGTGEDHVE 103

Query: 121 DPDEEEEEEDDENQVVPWSGDDSQSPPQPPPP 152
           + D    E+D+ENQVVPW+         PPPP
Sbjct: 104 NHDGGVSEDDEENQVVPWTS-------TPPPP 128

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225447717|ref|XP_002272924.1| PREDICTED: uncharacterized protein LOC100252747 [Vitis vinifera]

 Score =  145 bits (367), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 123/300 (41%), Positives = 157/300 (52%), Gaps = 59/300 (19%)

Query: 1   MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
           M+ CELC CPARMYCESDQASLCWDCD KVH ANFLVA+H R LLCHVC+S TPW+ASG 
Sbjct: 1   MKGCELCGCPARMYCESDQASLCWDCDAKVHGANFLVARHSRSLLCHVCRSPTPWRASGA 60

Query: 61  KLGPTVSVCDACV---AAARCGVNDDDKAVVRGGSQSERISGHDE------------TDD 105
           KLG TVSVC+ CV      +C           GG+  E   G+D+             + 
Sbjct: 61  KLGHTVSVCERCVDGCGGRKC-----------GGAAEESEGGNDDEVGMEDDDLDEDDEY 109

Query: 106 DDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEED 165
           DDD + ED++++++ED D   ++ED +NQVVPWS               S +  S    D
Sbjct: 110 DDDDDVEDEEEEEEEDDDFGGDDEDGDNQVVPWSSTPPPPEASSSSSEESLNSFSSGNRD 169

Query: 166 -------FSLKRMRDFG-DLFSDDEIGC-SSRP------------VTNEEAAASMSSYRP 204
                   SLKRMR+   DL S D+    SS+P              ++  A S  + RP
Sbjct: 170 VPGSFTMLSLKRMRETASDLRSQDDFNRPSSQPNYASARAAAARSAADDGEAISEDALRP 229

Query: 205 LK-----QPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITGICRLSR 259
            K     Q RP          Q+ SR+  I+ SL  L NQ +T   DA++ I GIC LS+
Sbjct: 230 FKDRRIEQNRPV-------QPQAGSRTAEIVDSLNRLHNQDITSGSDASSIIAGICNLSK 282

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|15237049|ref|NP_194461.1| B-box type zinc finger-containing protein [Arabidopsis thaliana] gi|3269292|emb|CAA19725.1| putative protein [Arabidopsis thaliana] gi|7269584|emb|CAB79586.1| putative protein [Arabidopsis thaliana] gi|332659923|gb|AEE85323.1| B-box type zinc finger-containing protein [Arabidopsis thaliana]

 Score =  142 bits (357), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 131/228 (57%), Gaps = 38/228 (16%)

Query: 2   RKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
           +KC+LC   ARMYCESDQASLCWDCD KVH ANFLVAKH RCLLC  CQSLTPWKA+G +
Sbjct: 3   KKCDLCNGVARMYCESDQASLCWDCDGKVHGANFLVAKHTRCLLCSACQSLTPWKATGLR 62

Query: 62  LGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDD------ 115
           LGPT SVC++CVA    G    ++ +     Q E  S   E+++D   ED  D       
Sbjct: 63  LGPTFSVCESCVALKNAGGGRGNRVLSENRGQEEVNS--FESEEDRIREDHGDGDDAESY 120

Query: 116 -------------DDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSIS 162
                        DD+DED DE+ ++E+ ENQVVPWS     +  Q PP   SSS    S
Sbjct: 121 DDDEEEDEDEEYSDDEDEDDDEDGDDEEAENQVVPWS-----AAAQVPPVMSSSSSDGGS 175

Query: 163 EEDFSLK-RMRDFGDLF-SDDEIGCSSRPVTNEEAAASMSSY-RPLKQ 207
               + + R R+  DL  SDDEIG SS         A  S+Y RPLK+
Sbjct: 176 GGSVTKRTRARENSDLLCSDDEIGSSS---------AQGSNYSRPLKR 214

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118489756|gb|ABK96678.1| unknown [Populus trichocarpa x Populus deltoides]

 Score =  141 bits (355), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 98/179 (54%), Positives = 118/179 (65%), Gaps = 6/179 (3%)

Query: 1   MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
           M+ CELC   ARM+CESDQASLCWDCDEKVH ANFLVAKH R LLC VCQS TPWK+SG 
Sbjct: 1   MKGCELCGGSARMFCESDQASLCWDCDEKVHSANFLVAKHCRTLLCQVCQSPTPWKSSGS 60

Query: 61  KLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISG--HDETDDDDDYEDEDDDDDD 118
           KL P VSVC++C A  +          V    Q  R +G  +DE+++D +++D+D DDD 
Sbjct: 61  KLAPIVSVCESCFAVHKNKKKQLQDLNVMASDQESREAGNDYDESENDREFDDDDTDDDS 120

Query: 119 DEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEE----DFSLKRMRD 173
           DE  +EE+EEED +NQVVPWSG  + S P   PP  SSS S         +  LKRMRD
Sbjct: 121 DEYDEEEDEEEDGDNQVVPWSGLTASSSPSIAPPVASSSSSEEEISCAGGNGFLKRMRD 179

Source: Populus trichocarpa x Populus deltoides

Species: Populus trichocarpa x Populus deltoides

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|17979452|gb|AAL50063.1| AT4g27310/M4I22_120 [Arabidopsis thaliana]

 Score =  140 bits (354), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 107/228 (46%), Positives = 131/228 (57%), Gaps = 38/228 (16%)

Query: 2   RKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
           +KC+LC   ARMYCESDQASLCWDCD KVH ANFL+AKH RCLLC  CQSLTPWKA+G +
Sbjct: 3   KKCDLCNGVARMYCESDQASLCWDCDGKVHGANFLLAKHTRCLLCSACQSLTPWKATGLR 62

Query: 62  LGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDD------ 115
           LGPT SVC++CVA    G    ++ +     Q E  S   E+++D   ED  D       
Sbjct: 63  LGPTFSVCESCVALKNAGGGRGNRVLSENRGQEEVNS--FESEEDRIREDHGDGDDAESY 120

Query: 116 -------------DDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSIS 162
                        DD+DED DE+ ++E+ ENQVVPWS     +  Q PP   SSS    S
Sbjct: 121 DDDEEEDEDEEYSDDEDEDDDEDGDDEEAENQVVPWS-----AAAQVPPVMSSSSSDGGS 175

Query: 163 EEDFSLK-RMRDFGDLF-SDDEIGCSSRPVTNEEAAASMSSY-RPLKQ 207
               + + R R+  DL  SDDEIG SS         A  S+Y RPLK+
Sbjct: 176 GGSVTKRTRARENSDLLCSDDEIGSSS---------AQGSNYSRPLKR 214

Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296081249|emb|CBI17993.3| unnamed protein product [Vitis vinifera]

 Score =  139 bits (349), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 116/285 (40%), Positives = 147/285 (51%), Gaps = 62/285 (21%)

Query: 1   MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
           M+ CELC CPARMYCESDQASLCWDCD KVH ANFLVA+H R LLCHVC+S TPW+ASG 
Sbjct: 1   MKGCELCGCPARMYCESDQASLCWDCDAKVHGANFLVARHSRSLLCHVCRSPTPWRASGA 60

Query: 61  KLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDE 120
           KLG TVSVC+ C                             + + DDD + ED++++++E
Sbjct: 61  KLGHTVSVCERC-----------------------------DDEYDDDDDVEDEEEEEEE 91

Query: 121 DPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEED-------FSLKRMRD 173
           D D   ++ED +NQVVPWS               S +  S    D        SLKRMR+
Sbjct: 92  DDDFGGDDEDGDNQVVPWSSTPPPPEASSSSSEESLNSFSSGNRDVPGSFTMLSLKRMRE 151

Query: 174 FG-DLFSDDEIGC-SSRP------------VTNEEAAASMSSYRPLK-----QPRPTISD 214
              DL S D+    SS+P              ++  A S  + RP K     Q RP    
Sbjct: 152 TASDLRSQDDFNRPSSQPNYASARAAAARSAADDGEAISEDALRPFKDRRIEQNRPV--- 208

Query: 215 CDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITGICRLSR 259
                 Q+ SR+  I+ SL  L NQ +T   DA++ I GIC LS+
Sbjct: 209 ----QPQAGSRTAEIVDSLNRLHNQDITSGSDASSIIAGICNLSK 249

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Phylum: Streptophyta

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	264
TAIR|locus:2131709	223	BBX28 "B-box domain protein 28	0.356	0.421	0.638	7.2e-36
TAIR|locus:2147274	215	BBX29 "B-box domain protein 29	0.359	0.441	0.63	1.6e-29
TAIR|locus:2092940	225	BBX32 "B-box domain protein 32	0.299	0.351	0.407	3.1e-12
TAIR|locus:2095562	121	BBX31 "B-box domain protein 31	0.193	0.421	0.529	9.4e-11
TAIR|locus:1009023318	117	BBX30 "B-box domain protein 30	0.189	0.427	0.54	1.5e-10
TAIR|locus:2129860	330	BBX9 "B-box domain protein 9"	0.276	0.221	0.410	5.7e-09
TAIR|locus:2199262	356	BBX27 "B-box domain protein 27	0.189	0.140	0.490	3.7e-08
TAIR|locus:2043288	332	AT2G47890 [Arabidopsis thalian	0.181	0.144	0.510	5.1e-07
TAIR|locus:2088748	364	BBX10 "B-box domain protein 10	0.253	0.184	0.436	1.2e-06
TAIR|locus:2074587	347	COL2 "CONSTANS-like 2" [Arabid	0.265	0.201	0.391	1.3e-06

TAIR|locus:2131709 BBX28 "B-box domain protein 28" [Arabidopsis thaliana (taxid:3702)]

 Score = 337 (123.7 bits), Expect = 7.2e-36, Sum P(2) = 7.2e-36
 Identities = 60/94 (63%), Positives = 69/94 (73%)

Query:     2 RKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
             +KC+LC   ARMYCESDQASLCWDCD KVH ANFLVAKH RCLLC  CQSLTPWKA+G +
Sbjct:     3 KKCDLCNGVARMYCESDQASLCWDCDGKVHGANFLVAKHTRCLLCSACQSLTPWKATGLR 62

Query:    62 LGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSE 95
             LGPT SVC++CVA    G    ++ +     Q E
Sbjct:    63 LGPTFSVCESCVALKNAGGGRGNRVLSENRGQEE 96

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

TAIR|locus:2147274 BBX29 "B-box domain protein 29" [Arabidopsis thaliana (taxid:3702)]

 Score = 327 (120.2 bits), Expect = 1.6e-29, P = 1.6e-29
 Identities = 63/100 (63%), Positives = 73/100 (73%)

Query:     2 RKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
             +KCELC   ARMYCESDQASLCWDCD KVH ANFLVAKH+RCLLC  CQS TPWKASG  
Sbjct:     4 KKCELCCGVARMYCESDQASLCWDCDGKVHGANFLVAKHMRCLLCSACQSHTPWKASGLN 63

Query:    62 LGPTVSVCDACVAAARCGVNDDDKAVVRGGS--QSERISG 99
             LGPTVS+C++C+A  +   N++     R  +  Q E I G
Sbjct:    64 LGPTVSICESCLARKK---NNNSSLAGRDQNLNQEEEIIG 100

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

GO:0009409 "response to cold" evidence=IEP

GO:0009555 "pollen development" evidence=IMP

TAIR|locus:2092940 BBX32 "B-box domain protein 32" [Arabidopsis thaliana (taxid:3702)]

 Score = 164 (62.8 bits), Expect = 3.1e-12, P = 3.1e-12
 Identities = 33/81 (40%), Positives = 45/81 (55%)

Query:     4 CELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLG 63
             CELC   A ++C +D A LC  CD K H +NFL A+H R ++C  C+SLT    SGP L 
Sbjct:     5 CELCGAEADLHCAADSAFLCRSCDAKFHASNFLFARHFRRVICPNCKSLTQNFVSGPLLP 64

Query:    64 --PTVSVCDACVAAARCGVND 82
               P  + C    +++ C   D
Sbjct:    65 WPPRTTCCSESSSSSCCSSLD 85

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0008270 "zinc ion binding" evidence=ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

GO:0010200 "response to chitin" evidence=IEP

GO:0005515 "protein binding" evidence=IPI

GO:0009640 "photomorphogenesis" evidence=IMP

GO:0009785 "blue light signaling pathway" evidence=IMP

GO:0010017 "red or far-red light signaling pathway" evidence=IMP

GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IEP

GO:0005737 "cytoplasm" evidence=IDA

GO:0009909 "regulation of flower development" evidence=IMP

TAIR|locus:2095562 BBX31 "B-box domain protein 31" [Arabidopsis thaliana (taxid:3702)]

 Score = 150 (57.9 bits), Expect = 9.4e-11, P = 9.4e-11
 Identities = 27/51 (52%), Positives = 35/51 (68%)

Query:     3 KCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLT 53
             +CELC+  A ++CE+D A LC  CD  VH ANFL  +H+R +LC  CQ LT
Sbjct:    30 RCELCDGDASVFCEADSAFLCRKCDRWVHGANFLAWRHVRRVLCTSCQKLT 80

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

GO:0010224 "response to UV-B" evidence=IEP;RCA

GO:0009744 "response to sucrose stimulus" evidence=RCA

TAIR|locus:1009023318 BBX30 "B-box domain protein 30" [Arabidopsis thaliana (taxid:3702)]

 Score = 148 (57.2 bits), Expect = 1.5e-10, P = 1.5e-10
 Identities = 27/50 (54%), Positives = 33/50 (66%)

Query:     4 CELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLT 53
             CELC   A +YCE+D A LC  CD  VH ANFL  +HLR ++C  C+ LT
Sbjct:    32 CELCGENATVYCEADAAFLCRKCDRWVHSANFLARRHLRRVICTTCRKLT 81

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0008270 "zinc ion binding" evidence=IEA

TAIR|locus:2129860 BBX9 "B-box domain protein 9" [Arabidopsis thaliana (taxid:3702)]

 Score = 141 (54.7 bits), Expect = 5.7e-09, Sum P(2) = 5.7e-09
 Identities = 32/78 (41%), Positives = 41/78 (52%)

Query:     3 KCELCECP-ARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
             +C+ C    A +YC+SD A LC +CD  VH AN L  +H R LLC  C SL P       
Sbjct:     4 RCDFCGTEKALIYCKSDSAKLCLNCDVNVHSANPLSQRHTRSLLCEKC-SLQPTAVHC-- 60

Query:    62 LGPTVSVCDACV-AAARC 78
             +   VS+C  C   A+ C
Sbjct:    61 MNENVSLCQGCQWTASNC 78

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006863 "purine nucleobase transport" evidence=RCA

TAIR|locus:2199262 BBX27 "B-box domain protein 27" [Arabidopsis thaliana (taxid:3702)]

 Score = 132 (51.5 bits), Expect = 3.7e-08, Sum P(2) = 3.7e-08
 Identities = 25/51 (49%), Positives = 33/51 (64%)

Query:     2 RKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQS 51
             R CE C+   A +YC +D A+LC  CD KVH AN L  +HLR +LC  C++
Sbjct:    12 RVCEFCKAYRAVVYCIADTANLCLTCDAKVHSANSLSGRHLRTVLCDSCKN 62

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

TAIR|locus:2043288 AT2G47890 [Arabidopsis thaliana (taxid:3702)]

 Score = 135 (52.6 bits), Expect = 5.1e-07, P = 5.1e-07
 Identities = 25/49 (51%), Positives = 32/49 (65%)

Query:     2 RKCELCECP-ARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVC 49
             R C+ C+   A +YC++D A LC  CD++VH AN L AKH R LLC  C
Sbjct:    11 RLCDYCDSSVALVYCKADSAKLCLACDKQVHVANQLFAKHFRSLLCDSC 59

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

GO:0009611 "response to wounding" evidence=RCA

GO:0009805 "coumarin biosynthetic process" evidence=RCA

GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA

TAIR|locus:2088748 BBX10 "B-box domain protein 10" [Arabidopsis thaliana (taxid:3702)]

 Score = 130 (50.8 bits), Expect = 1.2e-06, Sum P(2) = 1.2e-06
 Identities = 31/71 (43%), Positives = 39/71 (54%)

Query:     3 KCELCECP-ARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPK 61
             KC+ C    A +YC+SD A LC +CD  VH AN L  +H+R L+C  C S  P  A+   
Sbjct:     4 KCDHCATSQALIYCKSDLAKLCLNCDVHVHSANPLSHRHIRSLICEKCFS-QP--AAIRC 60

Query:    62 LGPTVSVCDAC 72
             L   VS C  C
Sbjct:    61 LDEKVSYCQGC 71

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS

TAIR|locus:2074587 COL2 "CONSTANS-like 2" [Arabidopsis thaliana (taxid:3702)]

 Score = 132 (51.5 bits), Expect = 1.3e-06, P = 1.3e-06
 Identities = 29/74 (39%), Positives = 40/74 (54%)

Query:     2 RKCELCECPA-RMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGP 60
             R C+ C   A  +YCE+D A LC  CD +VH AN + ++H R  +C  C+S  P  A+  
Sbjct:    14 RACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQSCES-AP--AAFL 70

Query:    61 KLGPTVSVCDACVA 74
                   S+C AC A
Sbjct:    71 CKADAASLCTACDA 84

GO:0005622 "intracellular" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS

GO:0009909 "regulation of flower development" evidence=IMP

GO:0009658 "chloroplast organization" evidence=IMP

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input: scaffold_701556.1 annotation not avaliable (191 aa) (Arabidopsis lyrata)

Predicted Functional Partners:

Sorry, there are no predicted associations at the current settings.

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Length	Definition	E-value
Query	264
pfam03153	332	pfam03153, TFIIA, Transcription factor IIA, alpha/	5e-07
pfam03066	146	pfam03066, Nucleoplasmin, Nucleoplasmin	3e-06
cd00021	39	cd00021, BBOX, B-Box-type zinc finger; zinc bindin	1e-05
smart00336	42	smart00336, BBOX, B-Box-type zinc finger	2e-05
pfam04147	809	pfam04147, Nop14, Nop14-like family	3e-05
PTZ00415	2849	PTZ00415, PTZ00415, transmission-blocking target a	3e-05
PRK05901	509	PRK05901, PRK05901, RNA polymerase sigma factor; P	4e-05
pfam03153	332	pfam03153, TFIIA, Transcription factor IIA, alpha/	6e-05
pfam04147	809	pfam04147, Nop14, Nop14-like family	6e-05
pfam10446	449	pfam10446, DUF2457, Protein of unknown function (D	7e-05
pfam08595	141	pfam08595, RXT2_N, RXT2-like, N-terminal	8e-05
PRK05901	509	PRK05901, PRK05901, RNA polymerase sigma factor; P	1e-04
PTZ00248	319	PTZ00248, PTZ00248, eukaryotic translation initiat	1e-04
PHA02608	80	PHA02608, 67, prohead core protein; Provisional	1e-04
PRK05901	509	PRK05901, PRK05901, RNA polymerase sigma factor; P	2e-04
TIGR00927	1096	TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger	2e-04
PRK02363	129	PRK02363, PRK02363, DNA-directed RNA polymerase su	3e-04
PRK05901	509	PRK05901, PRK05901, RNA polymerase sigma factor; P	4e-04
PRK02363	129	PRK02363, PRK02363, DNA-directed RNA polymerase su	4e-04
pfam05764	238	pfam05764, YL1, YL1 nuclear protein	4e-04
pfam04889	241	pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle cont	4e-04
pfam04546	211	pfam04546, Sigma70_ner, Sigma-70, non-essential re	5e-04
pfam04546	211	pfam04546, Sigma70_ner, Sigma-70, non-essential re	5e-04
pfam04546	211	pfam04546, Sigma70_ner, Sigma-70, non-essential re	6e-04
pfam04546	211	pfam04546, Sigma70_ner, Sigma-70, non-essential re	6e-04
pfam05285	317	pfam05285, SDA1, SDA1	6e-04
pfam09026	101	pfam09026, Cenp-B_dimeris, Centromere protein B di	7e-04
pfam04147	809	pfam04147, Nop14, Nop14-like family	0.001
PRK05901	509	PRK05901, PRK05901, RNA polymerase sigma factor; P	0.001
pfam09026	101	pfam09026, Cenp-B_dimeris, Centromere protein B di	0.001
pfam11705	221	pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym	0.001
pfam04615	728	pfam04615, Utp14, Utp14 protein	0.002
pfam04050	171	pfam04050, Upf2, Up-frameshift suppressor 2	0.002
pfam09073	424	pfam09073, BUD22, BUD22	0.002
PLN00151	852	PLN00151, PLN00151, potassium transporter; Provisi	0.002
pfam07133	164	pfam07133, Merozoite_SPAM, Merozoite surface prote	0.002
pfam03353	316	pfam03353, Lin-8, Ras-mediated vulval-induction an	0.003
PRK05658	619	PRK05658, PRK05658, RNA polymerase sigma factor Rp	0.003
PTZ00007	337	PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr	0.003
PTZ00007	337	PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr	0.004
pfam10498	355	pfam10498, IFT57, Intra-flagellar transport protei	0.004
pfam04931	784	pfam04931, DNA_pol_phi, DNA polymerase phi	0.004

>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit

 Score = 49.4 bits (118), Expect = 5e-07
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 83  DDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVV 136
              A + G    +   G D+ DD+D  E + DD DDD   ++ E+  D +N ++
Sbjct: 239 RTIAQIDGIDSDDEGDGSDDDDDEDAIESDLDDSDDDVSDEDGEDLFDTDNVML 292

Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription. Length = 332

>gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin

 Score = 45.4 bits (108), Expect = 3e-06
 Identities = 15/49 (30%), Positives = 31/49 (63%)

Query: 89  RGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVP 137
           + GS    ISG      ++D  D+D++D+++ED +E+++E++ E +  P
Sbjct: 93  KSGSGPVHISGQHLVASEEDESDDDEEDEEEEDDEEDDDEDESEEEESP 141

Nucleoplasmins are also known as chromatin decondensation proteins. They bind to core histones and transfer DNA to them in a reaction that requires ATP. This is thought to play a role in the assembly of regular nucleosomal arrays. Length = 146

>gnl|CDD|237988 cd00021, BBOX, B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction

 Score = 41.1 bits (97), Expect = 1e-05
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 2  RKCELC-ECPARMYCESDQASLCWDCDEKVH 31
          R C+   E P  ++CE+D+A LC DCD  VH
Sbjct: 1  RLCDEHGEEPLSLFCETDRALLCVDCDLSVH 31

Length = 39

>gnl|CDD|197662 smart00336, BBOX, B-Box-type zinc finger

 Score = 40.8 bits (96), Expect = 2e-05
 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 7/46 (15%)

Query: 1  MRKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL 45
            KC+     PA  +CE   A LC  CDE  H        H   LL
Sbjct: 3  APKCDSHGDEPAEFFCEECGALLCRTCDEAEH------RGHTVVLL 42

Length = 42

>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family

 Score = 44.6 bits (106), Expect = 3e-05
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 101 DETDDDDDYEDEDDDDD-DDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSS 156
           DE DDDDD E+E++D D  DE+ DEE+E+ DDE+       +  +   +      S 
Sbjct: 334 DEEDDDDDLEEEEEDVDLSDEEEDEEDEDSDDEDDEEEEEEEKEKKKKKSAESTRSE 390

Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production. Length = 809

>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional

 Score = 44.7 bits (105), Expect = 3e-05
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 3/53 (5%)

Query: 95  ERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPP 147
           E +S  D    DDD EDED+DDDD+E   ++EEEE++E ++  +  +D +   
Sbjct: 143 EDMSPRDNFVIDDDDEDEDEDDDDEE---DDEEEEEEEEEIKGFDDEDEEDEG 192

Length = 2849

>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional

 Score = 44.2 bits (105), Expect = 4e-05
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDS 143
           D+ D+DDD +D+DDD DD+++  +E +E +  +    +  D+ 
Sbjct: 150 DDDDEDDDEDDDDDDVDDEDEEKKEAKELEKLSDDDDFVWDED 192

Length = 509

>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit

 Score = 43.2 bits (102), Expect = 6e-05
 Identities = 16/63 (25%), Positives = 27/63 (42%), Gaps = 8/63 (12%)

Query: 82  DDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPD--------EEEEEEDDEN 133
              +A         +I G D  D+ D  +D+DD+D  + D D        E+ E+  D +
Sbjct: 229 PKKQAKSSKRRTIAQIDGIDSDDEGDGSDDDDDEDAIESDLDDSDDDVSDEDGEDLFDTD 288

Query: 134 QVV 136
            V+
Sbjct: 289 NVM 291

Transcription initiation factor IIA (TFIIA) is a heterotrimer, the three subunits being known as alpha, beta, and gamma, in order of molecular weight. The N and C-terminal domains of the gamma subunit are represented in pfam02268 and pfam02751, respectively. This family represents the precursor that yields both the alpha and beta subunits. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II. Together with TFIID, TFIIA binds to the promoter region; this is the first step in the formation of a pre-initiation complex (PIC). Binding of the rest of the transcription machinery follows this step. After initiation, the PIC does not completely dissociate from the promoter. Some components, including TFIIA, remain attached and re-initiate a subsequent round of transcription. Length = 332

>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family

 Score = 43.8 bits (104), Expect = 6e-05
 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 2/72 (2%)

Query: 81  NDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSG 140
            + D     G  Q E     +E   DD  EDE+DDDDD E+ +E+ +  D+E        
Sbjct: 306 FEPDDDDNFGLGQGEEDEEEEEDGVDD--EDEEDDDDDLEEEEEDVDLSDEEEDEEDEDS 363

Query: 141 DDSQSPPQPPPP 152
           DD     +    
Sbjct: 364 DDEDDEEEEEEE 375

Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production. Length = 809

>gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457)

 Score = 43.4 bits (102), Expect = 7e-05
 Identities = 17/43 (39%), Positives = 31/43 (72%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDS 143
           D+ ++DDD +D++D+DDDD+D DE++E+EDD++  +       
Sbjct: 54  DDDEEDDDDDDDEDEDDDDDDDDEDDEDEDDDDSTLHDDSSAD 96

This is a family of uncharacterized proteins. Length = 449

>gnl|CDD|219922 pfam08595, RXT2_N, RXT2-like, N-terminal

 Score = 41.2 bits (97), Expect = 8e-05
 Identities = 19/41 (46%), Positives = 27/41 (65%)

Query: 93  QSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
             +RI  ++    D+D  D DDDD+DDED +E + E+DDEN
Sbjct: 35  SRKRIKFNNPPRIDEDGGDIDDDDEDDEDDEEADAEDDDEN 75

The family represents the N-terminal region of RXT2-like proteins. In S. cerevisiae, RXT2 has been demonstrated to be involved in conjugation with cellular fusion (mating) and invasive growth. A high throughput localisation study has localised RXT2 to the nucleus. Length = 141

>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional

 Score = 42.3 bits (100), Expect = 1e-04
 Identities = 17/32 (53%), Positives = 27/32 (84%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDE 132
           D+  DDDD +D+DDD+DDDED D+++ +++DE
Sbjct: 139 DDDLDDDDIDDDDDDEDDDEDDDDDDVDDEDE 170

Length = 509

>gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional

 Score = 42.7 bits (101), Expect = 1e-04
 Identities = 15/54 (27%), Positives = 33/54 (61%), Gaps = 6/54 (11%)

Query: 80  VNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
           V  D++         E +   +E +++DDY + +D+D++DED +EEE++++ + 
Sbjct: 272 VGGDEE------DLEELLEKAEEEEEEDDYSESEDEDEEDEDEEEEEDDDEGDK 319

Length = 319

>gnl|CDD|177433 PHA02608, 67, prohead core protein; Provisional

 Score = 39.4 bits (92), Expect = 1e-04
 Identities = 20/37 (54%), Positives = 29/37 (78%)

Query: 96  RISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDE 132
            I G +  DDDDD +D+DDDD DD+D D+++++EDDE
Sbjct: 44  MIEGEEPEDDDDDEDDDDDDDKDDKDDDDDDDDEDDE 80

Length = 80

>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional

 Score = 41.9 bits (99), Expect = 2e-04
 Identities = 16/32 (50%), Positives = 26/32 (81%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDE 132
           D+  DDDD +++DD+DDDD+D D+E+EE+ + 
Sbjct: 144 DDDIDDDDDDEDDDEDDDDDDVDDEDEEKKEA 175

Length = 509

>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger

 Score = 41.9 bits (98), Expect = 2e-04
 Identities = 20/61 (32%), Positives = 38/61 (62%), Gaps = 8/61 (13%)

Query: 74  AAARCGVNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
           A  +     D+K V  GG       G D  D +++ E+E+++++++E+ +EEEEEE++EN
Sbjct: 839 AENQGEAKQDEKGVDGGG-------GSDGGDSEEE-EEEEEEEEEEEEEEEEEEEEEEEN 890

Query: 134 Q 134
           +
Sbjct: 891 E 891

[Transport and binding proteins, Cations and iron carrying compounds]. Length = 1096

>gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed

 Score = 39.6 bits (93), Expect = 3e-04
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEED 130
           D  DDD   +D+ D++D DE+ DE+EE+E+
Sbjct: 100 DIIDDDILPDDDFDEEDLDEEDDEDEEDEE 129

Length = 129

>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional

 Score = 40.7 bits (96), Expect = 4e-04
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 4/93 (4%)

Query: 81  NDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSG 140
             D    +      + ++  D+ DDDDD +D DDDD DD+D DE+++E+DD++ V     
Sbjct: 111 ALDKDDDLNYVKDIDVLNQADDDDDDDDDDDLDDDDIDDDDDDEDDDEDDDDDDVD---- 166

Query: 141 DDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRD 173
           D+ +   +       S       ++   + +R 
Sbjct: 167 DEDEEKKEAKELEKLSDDDDFVWDEDDSEALRQ 199

Length = 509

>gnl|CDD|235033 PRK02363, PRK02363, DNA-directed RNA polymerase subunit delta; Reviewed

 Score = 39.2 bits (92), Expect = 4e-04
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 95  ERISGHDETDD--DDDYEDEDDDDDDDEDPDEEEEEEDDE 132
           ++    D  DD  DDD   +DD D++D D +++E+EED+E
Sbjct: 90  KKKKFMDGDDDIIDDDILPDDDFDEEDLDEEDDEDEEDEE 129

Length = 129

>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein

 Score = 40.4 bits (95), Expect = 4e-04
 Identities = 11/37 (29%), Positives = 25/37 (67%), Gaps = 6/37 (16%)

Query: 102 ETDDDDDYEDEDDDDDD------DEDPDEEEEEEDDE 132
           E +DD+++E E++++++      D+  D+E E +D+E
Sbjct: 36  EEEDDEEFEIEEEEEEEEVDSDFDDSEDDEPESDDEE 72

The proteins in this family are designated YL1. These proteins have been shown to be DNA-binding and may be a transcription factor. Length = 238

>gnl|CDD|218312 pfam04889, Cwf_Cwc_15, Cwf15/Cwc15 cell cycle control protein

 Score = 40.5 bits (95), Expect = 4e-04
 Identities = 11/47 (23%), Positives = 21/47 (44%)

Query: 82  DDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEE 128
           D++  + R   + +  +   +  D     D  DDD DD+D ++E   
Sbjct: 100 DEEDEIKRKRIEEDARNSDADDSDSSSDSDSSDDDSDDDDSEDETAA 146

This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues. The function of these proteins is unknown, but they form part of the spliceosome and are thus thought to be involved in mRNA splicing. Length = 241

>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region

 Score = 39.9 bits (94), Expect = 5e-04
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQV 135
            E D++D  +D+DDD+D+DED +EE +   D  + 
Sbjct: 46  SELDEEDLEDDDDDDEDEDEDDEEEADLGPDPEEA 80

The domain is found in the primary vegetative sigma factor. The function of this domain is unclear and can be removed without loss of function. Length = 211

>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region

 Score = 39.9 bits (94), Expect = 5e-04
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 102 ETDDDDDYEDEDDDDDDDEDPDEEEEEEDDE 132
              + D+ + EDDDDDD+++ +++EEE D  
Sbjct: 44  IESELDEEDLEDDDDDDEDEDEDDEEEADLG 74

The domain is found in the primary vegetative sigma factor. The function of this domain is unclear and can be removed without loss of function. Length = 211

>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region

 Score = 39.9 bits (94), Expect = 6e-04
 Identities = 9/30 (30%), Positives = 22/30 (73%)

Query: 104 DDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
            + +  E++ +DDDDD++ ++E++EE+ + 
Sbjct: 44  IESELDEEDLEDDDDDDEDEDEDDEEEADL 73

The domain is found in the primary vegetative sigma factor. The function of this domain is unclear and can be removed without loss of function. Length = 211

>gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region

 Score = 39.9 bits (94), Expect = 6e-04
 Identities = 11/34 (32%), Positives = 23/34 (67%)

Query: 100 HDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
                 + + ++ED +DDDD+D DE+E++E++ +
Sbjct: 39  ATAAAIESELDEEDLEDDDDDDEDEDEDDEEEAD 72

The domain is found in the primary vegetative sigma factor. The function of this domain is unclear and can be removed without loss of function. Length = 211

>gnl|CDD|218538 pfam05285, SDA1, SDA1

 Score = 40.4 bits (95), Expect = 6e-04
 Identities = 15/84 (17%), Positives = 37/84 (44%)

Query: 82  DDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGD 141
           +  K   R   ++E+    D+ DD+++  + ++D+D D++ +  + E D E +      +
Sbjct: 76  EKWKEEERKKKEAEQGLESDDDDDEEEEWEVEEDEDSDDEGEWIDVESDKEIESSDSEDE 135

Query: 142 DSQSPPQPPPPPVSSSCSSISEED 165
           + +          S    S  +E+
Sbjct: 136 EEKDEAAKKAKEDSDEELSEEDEE 159

This family consists of several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localised in the nucleus. Length = 317

>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain

 Score = 37.8 bits (87), Expect = 7e-04
 Identities = 19/40 (47%), Positives = 30/40 (75%)

Query: 102 ETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGD 141
           E D D D ++E+DDDD+DE+ D+E+++EDD+   VP  G+
Sbjct: 9   EEDSDSDSDEEEDDDDEDEEDDDEDDDEDDDEVPVPSFGE 48

The centromere protein B (CENP-B) dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation. Length = 101

>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family

 Score = 39.6 bits (93), Expect = 0.001
 Identities = 21/55 (38%), Positives = 31/55 (56%)

Query: 98  SGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPP 152
              ++ D  D+ EDE+D+D DDED +EEEEEE ++ +        S+ P   P P
Sbjct: 344 EEEEDVDLSDEEEDEEDEDSDDEDDEEEEEEEKEKKKKKSAESTRSELPFTFPCP 398

Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production. Length = 809

>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional

 Score = 39.6 bits (93), Expect = 0.001
 Identities = 13/49 (26%), Positives = 28/49 (57%)

Query: 100 HDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQ 148
            ++ D+DDD +D DD+D++ ++  E E+  DD++ V      ++    +
Sbjct: 153 DEDDDEDDDDDDVDDEDEEKKEAKELEKLSDDDDFVWDEDDSEALRQAR 201

Length = 509

>gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain

 Score = 37.1 bits (85), Expect = 0.001
 Identities = 18/32 (56%), Positives = 26/32 (81%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDE 132
           +E  D D  E+EDDDD+D+ED DE+++E+DDE
Sbjct: 9   EEDSDSDSDEEEDDDDEDEEDDDEDDDEDDDE 40

The centromere protein B (CENP-B) dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation. Length = 101

>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31

 Score = 39.0 bits (91), Expect = 0.001
 Identities = 8/40 (20%), Positives = 28/40 (70%)

Query: 95  ERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQ 134
           +      E  D++D +DE+++++++E+ ++ ++++DD++ 
Sbjct: 159 KLKELEAEDVDEEDEKDEEEEEEEEEEDEDFDDDDDDDDD 198

RNA polymerase III contains seventeen subunits in yeasts and in human cells. Twelve of these are akin to RNA polymerase I or II and the other five are RNA pol III-specific, and form the functionally distinct groups (i) Rpc31-Rpc34-Rpc82, and (ii) Rpc37-Rpc53. Rpc31, Rpc34 and Rpc82 form a cluster of enzyme-specific subunits that contribute to transcription initiation in S.cerevisiae and H.sapiens. There is evidence that these subunits are anchored at or near the N-terminal Zn-fold of Rpc1, itself prolonged by a highly conserved but RNA polymerase III-specific domain. Length = 221

>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein

 Score = 39.3 bits (92), Expect = 0.002
 Identities = 9/36 (25%), Positives = 24/36 (66%)

Query: 95  ERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEED 130
            +I G   +++D+D + + +++D+D+D D+++ E  
Sbjct: 316 RKIEGKSVSEEDEDEDSDSEEEDEDDDEDDDDGENP 351

This protein is found to be part of a large ribonucleoprotein complex containing the U3 snoRNA. Depletion of the Utp proteins impedes production of the 18S rRNA, indicating that they are part of the active pre-rRNA processing complex. This large RNP complex has been termed the small subunit (SSU) processome. Length = 728

>gnl|CDD|217861 pfam04050, Upf2, Up-frameshift suppressor 2

 Score = 37.7 bits (88), Expect = 0.002
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 91  GSQSERISGHDET---DDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSP 146
           GS+SE   G ++    ++D+D E  D+++ D  D +++EE + +E Q+     ++   P
Sbjct: 2   GSESESDDGEEDEELPEEDEDDESSDEEEVDLPDDEQDEESDSEEEQIFVTRQEEEVDP 60

Transcripts harbouring premature signals for translation termination are recognised and rapidly degraded by eukaryotic cells through a pathway known as nonsense-mediated mRNA decay. In Saccharomyces cerevisiae, three trans-acting factors (Upf1 to Upf3) are required for nonsense-mediated mRNA decay. Length = 171

>gnl|CDD|220102 pfam09073, BUD22, BUD22

 Score = 38.7 bits (90), Expect = 0.002
 Identities = 15/86 (17%), Positives = 31/86 (36%), Gaps = 13/86 (15%)

Query: 80  VNDDDKAVVRGGSQSERISGHDETDDDDDY-------------EDEDDDDDDDEDPDEEE 126
              +D++     ++ +     +E  D +DY             E+ ++    + + D  E
Sbjct: 175 SESEDESKSEESAEDDSDDEEEEDSDSEDYSQYDGMLVDSSDEEEGEEAPSINYNEDTSE 234

Query: 127 EEEDDENQVVPWSGDDSQSPPQPPPP 152
            E D+ +  +  S   S S    PP 
Sbjct: 235 SESDESDSEISESRSVSDSEESSPPS 260

BUD22 has been shown in yeast to be a nuclear protein involved in bud-site selection. It plays a role in positioning the proximal bud pole signal. More recently it has been shown to be involved in ribosome biogenesis. Length = 424

>gnl|CDD|215079 PLN00151, PLN00151, potassium transporter; Provisional

 Score = 39.0 bits (91), Expect = 0.002
 Identities = 17/45 (37%), Positives = 20/45 (44%)

Query: 87  VVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDD 131
           +V   S   R     E D +D    +DDDDD D      EEEED 
Sbjct: 19  LVGTDSGESRWVDGSEDDSEDPASLDDDDDDRDSGGGMLEEEEDG 63

Length = 852

>gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM)

 Score = 37.5 bits (87), Expect = 0.002
 Identities = 14/42 (33%), Positives = 28/42 (66%)

Query: 95  ERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVV 136
           E I   +E   D+  ED+++++++DE+  EE E+ +DE ++V
Sbjct: 34  EDIIKENEDVKDEKQEDDEEEEEEDEEEIEEPEDIEDEEEIV 75

This family consists of several Plasmodium falciparum SPAM (secreted polymorphic antigen associated with merozoites) proteins. Variation among SPAM alleles is the result of deletions and amino acid substitutions in non-repetitive sequences within and flanking the alanine heptad-repeat domain. Heptad repeats in which the a and d position contain hydrophobic residues generate amphipathic alpha-helices which give rise to helical bundles or coiled-coil structures in proteins. SPAM is an example of a P. falciparum antigen in which a repetitive sequence has features characteristic of a well-defined structural element. Length = 164

>gnl|CDD|217509 pfam03353, Lin-8, Ras-mediated vulval-induction antagonist

 Score = 38.1 bits (89), Expect = 0.003
 Identities = 32/137 (23%), Positives = 46/137 (33%), Gaps = 11/137 (8%)

Query: 94  SERISGHDETDDDDD--YEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPP 151
            E  +G D+  DD+D    D   +D   E  D EE +E DE +V      D         
Sbjct: 128 KEPWTGEDQEADDEDDIIYDGIFEDRTRESQDMEENDEVDEVEVE--EVPDDYGANLAVD 185

Query: 152 PPVSSSCSSISEEDFSLKRMRDFGDLFSDDEIGCSSRPVTNEEAAASMSSYRPLKQPRPT 211
            P  S+ S   E     K+         + +      P  + E+A S S+    +     
Sbjct: 186 EPEQSTMSRPQEV----KQSVPAQQAPPNPQ---QPMPSASSESATSKSASTSRESSPQP 238

Query: 212 ISDCDRDHGQSVSRSTA 228
            S   R        STA
Sbjct: 239 QSPPPRRVPAPTVDSTA 255

LIN-8 is a nuclear protein, present at the sites of transcriptional repressor complexes, which interacts with LIN-35 Rb.Lin35 Rb is a product of the class B synMuv gene lin-35 which silences genes required for vulval specification through chromatin modification and remodelling. The biological role of the interaction has not yet been determined however predictions have been made. The interaction shows that class A synMuv genes control vulval induction through the transcriptional regulation of gene expression. LIN-8 normally functions as part of a protein complex however when the complex is absent, other family members can partially replace LIN-8 activity. Length = 316

>gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated

 Score = 38.6 bits (91), Expect = 0.003
 Identities = 13/55 (23%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 94  SERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQ 148
            E I G    D + + +      + +E  D+E+EEE+++      + D+S+ P +
Sbjct: 167 RELIDG--FVDPNAEEDPAHVGSELEELDDDEDEEEEEDENDDSLAADESELPEK 219

Length = 619

>gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional

 Score = 38.2 bits (89), Expect = 0.003
 Identities = 10/36 (27%), Positives = 15/36 (41%)

Query: 98  SGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
           S  ++ DD D Y+  D    D     +  EE+D   
Sbjct: 287 SSDEDDDDYDSYDSSDSASSDSNSDVDTNEEDDRGE 322

Length = 337

>gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional

 Score = 37.9 bits (88), Expect = 0.004
 Identities = 8/27 (29%), Positives = 13/27 (48%)

Query: 104 DDDDDYEDEDDDDDDDEDPDEEEEEED 130
             D    D + D D +E+ D  E+E +
Sbjct: 300 SSDSASSDSNSDVDTNEEDDRGEKESN 326

Length = 337

>gnl|CDD|220785 pfam10498, IFT57, Intra-flagellar transport protein 57

 Score = 37.8 bits (88), Expect = 0.004
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 78  CGVNDD--DKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQV 135
           C V DD  D A+ + G   +R    +E D++++ +++D +   +E  +E E EE D+++ 
Sbjct: 103 CYVLDDLADAALKKKGFSFKRPKYPNEEDEEENVDEDDAEIILEEVEEEVEIEEVDDDEG 162

Query: 136 V 136
            
Sbjct: 163 T 163

Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms. Intra-flagellar transport (IFT) is required for the assembly and maintenance of eukaryotic cilia and flagella, and consists of the bidirectional movement of large protein particles between the base and the distal tip of the organelle. IFT particles contain multiple copies of two distinct protein complexes, A and B, which contain at least 6 and 11 protein subunits. IFT57 is part of complex B but is not, however, required for the core subunits to stay associated. This protein is known as Huntington-interacting protein-1 in humans. Length = 355

>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi

 Score = 37.9 bits (88), Expect = 0.004
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 102 ETDDDDD-----YEDEDDDDDDDEDPDEEEEEEDDE 132
           ETDDD+D      + E + + D ED +E+E+E+D E
Sbjct: 657 ETDDDEDECEAIEDSESESESDGEDGEEDEQEDDAE 692

This family includes the fifth essential DNA polymerase in yeast EC:2.7.7.7. Pol5p is localised exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units. Length = 784

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	264
cd00021	39	BBOX B-Box-type zinc finger; zinc binding domain (	97.38
smart00336	42	BBOX B-Box-type zinc finger.	96.77
PF00643	42	zf-B_box: B-box zinc finger; InterPro: IPR000315 Z	96.47
PF06524	314	NOA36: NOA36 protein; InterPro: IPR010531 This fam	96.28
KOG4367	699	consensus Predicted Zn-finger protein [Function un	96.24
cd00021	39	BBOX B-Box-type zinc finger; zinc binding domain (	96.18
KOG0585	576	consensus Ca2+/calmodulin-dependent protein kinase	96.15
KOG0198	313	consensus MEKK and related serine/threonine protei	95.91
KOG4279	1226	consensus Serine/threonine protein kinase [Signal	95.64
KOG0581	364	consensus Mitogen-activated protein kinase kinase	95.36
smart00336	42	BBOX B-Box-type zinc finger.	95.3
PF06524	314	NOA36: NOA36 protein; InterPro: IPR010531 This fam	95.09
PF09026	101	CENP-B_dimeris: Centromere protein B dimerisation	95.03
PF10446	458	DUF2457: Protein of unknown function (DUF2457); In	94.79
KOG0575	592	consensus Polo-like serine/threonine protein kinas	94.57
PF00643	42	zf-B_box: B-box zinc finger; InterPro: IPR000315 Z	94.56
KOG0615	475	consensus Serine/threonine protein kinase Chk2 and	94.28
PF09026	101	CENP-B_dimeris: Centromere protein B dimerisation	93.73
PHA02882	294	putative serine/threonine kinase; Provisional	93.69
PF10446	458	DUF2457: Protein of unknown function (DUF2457); In	93.57
cd07868	317	STKc_CDK8 Catalytic domain of the Serine/Threonine	93.53
KOG0592	604	consensus 3-phosphoinositide-dependent protein kin	93.4
cd07867	317	STKc_CDC2L6 Catalytic domain of Serine/Threonine K	93.32
KOG0943	3015	consensus Predicted ubiquitin-protein ligase/hyper	93.25
KOG1035	1351	consensus eIF-2alpha kinase GCN2 [Translation, rib	93.25
cd07862	290	STKc_CDK6 Catalytic domain of the Serine/Threonine	93.12
cd05037	259	PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the	93.08
cd07871	288	STKc_PCTAIRE3 Catalytic domain of the Serine/Threo	93.06
cd05102	338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	92.93
cd05631	285	STKc_GRK4 Catalytic domain of the Protein Serine/T	92.81
cd07859	338	STKc_TDY_MAPK_plant Catalytic domain of the Serine	92.77
cd05571	323	STKc_PKB Catalytic domain of the Protein Serine/Th	92.74
cd05614	332	STKc_MSK2_N N-terminal catalytic domain of the Pro	92.67
cd05575	323	STKc_SGK Catalytic domain of the Protein Serine/Th	92.64
cd05593	328	STKc_PKB_gamma Catalytic domain of the Protein Ser	92.5
cd05602	325	STKc_SGK1 Catalytic domain of the Protein Serine/T	92.49
cd05078	258	PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain	92.24
cd05042	269	PTKc_Aatyk Catalytic domain of the Protein Tyrosin	92.22
cd05628	363	STKc_NDR1 Catalytic domain of the Protein Serine/T	92.21
cd05108	316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	92.2
PHA03212	391	serine/threonine kinase US3; Provisional	92.2
cd07878	343	STKc_p38beta_MAPK11 Catalytic domain of the Serine	92.18
cd05621	370	STKc_ROCK2 Catalytic domain of the Protein Serine/	92.16
cd05629	377	STKc_NDR_like_fungal Catalytic domain of Fungal Nu	92.13
cd07869	303	STKc_PFTAIRE1 Catalytic domain of the Serine/Threo	92.09
cd05586	330	STKc_Sck1_like Catalytic domain of Suppressor of l	92.07
cd05076	274	PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th	92.06
PTZ00036	440	glycogen synthase kinase; Provisional	92.06
cd08226	328	PK_STRAD_beta Pseudokinase domain of STE20-related	92.03
KOG0658	364	consensus Glycogen synthase kinase-3 [Carbohydrate	92.01
cd05585	312	STKc_YPK1_like Catalytic domain of Yeast Protein K	91.97
cd07874	355	STKc_JNK3 Catalytic domain of the Serine/Threonine	91.96
cd05587	324	STKc_cPKC Catalytic domain of the Protein Serine/T	91.92
cd05626	381	STKc_LATS2 Catalytic domain of the Protein Serine/	91.91
cd05603	321	STKc_SGK2 Catalytic domain of the Protein Serine/T	91.89
PHA03210	501	serine/threonine kinase US3; Provisional	91.88
PLN00181	793	protein SPA1-RELATED; Provisional	91.85
PHA03207	392	serine/threonine kinase US3; Provisional	91.7
cd07863	288	STKc_CDK4 Catalytic domain of the Serine/Threonine	91.7
cd08227	327	PK_STRAD_alpha Pseudokinase domain of STE20-relate	91.68
cd05591	321	STKc_nPKC_epsilon Catalytic domain of the Protein	91.64
cd07876	359	STKc_JNK2 Catalytic domain of the Serine/Threonine	91.64
cd05598	376	STKc_LATS Catalytic domain of the Protein Serine/T	91.61
cd05620	316	STKc_nPKC_delta Catalytic domain of the Protein Se	91.61
PTZ00284	467	protein kinase; Provisional	91.55
PLN03225	566	Serine/threonine-protein kinase SNT7; Provisional	91.55
PHA03209	357	serine/threonine kinase US3; Provisional	91.51
cd05612	291	STKc_PRKX_like Catalytic domain of PRKX-like Prote	91.5
cd07853	372	STKc_NLK Catalytic domain of the Serine/Threonine	91.47
cd05595	323	STKc_PKB_beta Catalytic domain of the Protein Seri	91.47
cd05109	279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	91.46
cd05075	272	PTKc_Axl Catalytic domain of the Protein Tyrosine	91.46
KOG0660	359	consensus Mitogen-activated protein kinase [Signal	91.44
cd07872	309	STKc_PCTAIRE2 Catalytic domain of the Serine/Threo	91.4
cd05573	350	STKc_ROCK_NDR_like Catalytic domain of ROCK- and N	91.38
cd05599	364	STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel	91.37
cd05604	325	STKc_SGK3 Catalytic domain of the Protein Serine/T	91.28
cd05096	304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	91.24
cd05625	382	STKc_LATS1 Catalytic domain of the Protein Serine/	91.22
PTZ00263	329	protein kinase A catalytic subunit; Provisional	91.2
cd05616	323	STKc_cPKC_beta Catalytic domain of the Protein Ser	91.14
cd05592	316	STKc_nPKC_theta_delta Catalytic domain of the Prot	91.07
PLN00034	353	mitogen-activated protein kinase kinase; Provision	91.03
KOG0600	560	consensus Cdc2-related protein kinase [Cell cycle	91.03
cd07857	332	STKc_MPK1 Catalytic domain of the Serine/Threonine	91.02
cd05091	283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	91.0
cd05086	268	PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi	90.99
cd05077	262	PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th	90.93
cd05608	280	STKc_GRK1 Catalytic domain of the Protein Serine/T	90.92
cd05601	330	STKc_CRIK Catalytic domain of the Protein Serine/T	90.91
cd05584	323	STKc_p70S6K Catalytic domain of the Protein Serine	90.91
cd07875	364	STKc_JNK1 Catalytic domain of the Serine/Threonine	90.83
KOG0579	1187	consensus Ste20-like serine/threonine protein kina	90.77
cd05046	275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	90.71
cd05596	370	STKc_ROCK Catalytic domain of the Protein Serine/T	90.71
cd05590	320	STKc_nPKC_eta Catalytic domain of the Protein Seri	90.7
cd05622	371	STKc_ROCK1 Catalytic domain of the Protein Serine/	90.66
KOG0578	550	consensus p21-activated serine/threonine protein k	90.63
cd05582	318	STKc_RSK_N N-terminal catalytic domain of the Prot	90.61
PTZ00426	340	cAMP-dependent protein kinase catalytic subunit; P	90.54
PHA03211	461	serine/threonine kinase US3; Provisional	90.5
cd05081	284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	90.45
cd05627	360	STKc_NDR2 Catalytic domain of the Protein Serine/T	90.4
KOG0664	449	consensus Nemo-like MAPK-related serine/threonine	90.39
cd05576	237	STKc_RPK118_like Catalytic domain of the Protein S	90.39
cd05106	374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	90.31
cd05064	266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	90.25
cd07848	287	STKc_CDKL5 Catalytic domain of the Serine/Threonin	90.23
cd05600	333	STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p-	90.19
KOG0192	362	consensus Tyrosine kinase specific for activated (	90.19
cd05597	331	STKc_DMPK_like Catalytic domain of Myotonic Dystro	90.18
cd05074	273	PTKc_Tyro3 Catalytic domain of the Protein Tyrosin	90.16
cd05035	273	PTKc_Axl_like Catalytic Domain of Axl-like Protein	90.16
cd05589	324	STKc_PKN Catalytic domain of the Protein Serine/Th	90.11
cd05624	331	STKc_MRCK_beta Catalytic domain of the Protein Ser	90.02
cd05633	279	STKc_GRK3 Catalytic domain of the Protein Serine/T	90.02
cd05570	318	STKc_PKC Catalytic domain of the Protein Serine/Th	90.0
cd05618	329	STKc_aPKC_iota Catalytic domain of the Protein Ser	89.97
cd05623	332	STKc_MRCK_alpha Catalytic domain of the Protein Se	89.94
KOG0594	323	consensus Protein kinase PCTAIRE and related kinas	89.93
cd05619	316	STKc_nPKC_theta Catalytic domain of the Protein Se	89.93
cd05111	279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	89.9
cd00192	262	PTKc Catalytic domain of Protein Tyrosine Kinases.	89.88
cd05617	327	STKc_aPKC_zeta Catalytic domain of the Protein Ser	89.77
cd05080	283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	89.76
cd07861	285	STKc_CDK1_euk Catalytic domain of the Serine/Threo	89.7
cd05051	296	PTKc_DDR Catalytic domain of the Protein Tyrosine	89.66
cd05089	297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	89.64
cd05594	325	STKc_PKB_alpha Catalytic domain of the Protein Ser	89.64
cd05147	190	RIO1_euk RIO kinase family; eukaryotic RIO1, catal	89.61
cd08216	314	PK_STRAD Pseudokinase domain of STE20-related kina	89.61
cd05084	252	PTKc_Fes Catalytic domain of the Protein Tyrosine	89.54
cd05632	285	STKc_GRK5 Catalytic domain of the Protein Serine/T	89.54
cd05053	293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	89.5
cd05052	263	PTKc_Abl Catalytic domain of the Protein Tyrosine	89.4
PF00069	260	Pkinase: Protein kinase domain Protein kinase; unc	89.37
cd05094	291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	89.27
cd05048	283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	89.22
cd07837	295	STKc_CdkB_plant Catalytic domain of the Serine/Thr	89.21
cd05588	329	STKc_aPKC Catalytic domain of the Protein Serine/T	89.15
cd07839	284	STKc_CDK5 Catalytic domain of the Serine/Threonine	89.11
cd05101	304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	89.09
cd05082	256	PTKc_Csk Catalytic domain of the Protein Tyrosine	89.08
PTZ00267	478	NIMA-related protein kinase; Provisional	89.06
cd05093	288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	89.06
cd05116	257	PTKc_Syk Catalytic domain of the Protein Tyrosine	89.03
cd06624	268	STKc_ASK Catalytic domain of the Protein Serine/Th	88.98
cd06658	292	STKc_PAK5 Catalytic domain of the Protein Serine/T	88.97
cd07843	293	STKc_CDC2L1 Catalytic domain of the Serine/Threoni	88.95
PTZ00283	496	serine/threonine protein kinase; Provisional	88.95
cd07870	291	STKc_PFTAIRE2 Catalytic domain of the Serine/Threo	88.94
cd05615	323	STKc_cPKC_alpha Catalytic domain of the Protein Se	88.92
cd05092	280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	88.74
cd07847	286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	88.74
cd05090	283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	88.73
cd05104	375	PTKc_Kit Catalytic domain of the Protein Tyrosine	88.56
cd05607	277	STKc_GRK7 Catalytic domain of the Protein Serine/T	88.55
cd05054	337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	88.49
cd05110	303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	88.27
cd05055	302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	88.18
cd05040	257	PTKc_Ack_like Catalytic domain of the Protein Tyro	88.18
cd05115	257	PTKc_Zap-70 Catalytic domain of the Protein Tyrosi	88.16
KOG0666	438	consensus Cyclin C-dependent kinase CDK8 [Transcri	88.15
cd05088	303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	88.15
cd05095	296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	88.12
KOG0659	318	consensus Cdk activating kinase (CAK)/RNA polymera	88.05
cd06630	268	STKc_MEKK1 Catalytic domain of the Protein Serine/	88.04
KOG0598	357	consensus Ribosomal protein S6 kinase and related	88.04
cd06645	267	STKc_MAP4K3 Catalytic domain of the Protein Serine	88.0
cd05045	290	PTKc_RET Catalytic domain of the Protein Tyrosine	87.99
cd07844	291	STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like	87.87
cd05118	283	STKc_CMGC Catalytic domain of CMGC family Serine/T	87.86
cd05103	343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	87.78
cd07849	336	STKc_ERK1_2_like Catalytic domain of Extracellular	87.72
cd05049	280	PTKc_Trk Catalytic domain of the Protein Tyrosine	87.67
cd05043	280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	87.63
cd05145	190	RIO1_like RIO kinase family; RIO1, RIO3 and simila	87.6
PRK10345	210	hypothetical protein; Provisional	87.53
cd05062	277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	87.5
cd05579	265	STKc_MAST_like Catalytic domain of Microtubule-ass	87.48
cd05058	262	PTKc_Met_Ron Catalytic domain of the Protein Tyros	87.47
cd05605	285	STKc_GRK4_like Catalytic domain of G protein-coupl	87.42
cd05630	285	STKc_GRK6 Catalytic domain of the Protein Serine/T	87.42
cd07842	316	STKc_CDK8_like Catalytic domain of Cyclin-Dependen	87.41
cd05038	284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	87.4
cd05036	277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	87.39
cd05032	277	PTKc_InsR_like Catalytic domain of Insulin Recepto	87.39
cd05610	669	STKc_MASTL Catalytic domain of the Protein Serine/	87.38
KOG1187	361	consensus Serine/threonine protein kinase [Signal	87.34
KOG0201	467	consensus Serine/threonine protein kinase [Signal	87.32
cd06625	263	STKc_MEKK3_like Catalytic domain of MAP/ERK kinase	87.29
cd05611	260	STKc_Rim15_like Catalytic domain of fungal Rim15-l	87.24
cd07841	298	STKc_CDK7 Catalytic domain of the Serine/Threonine	87.24
cd05039	256	PTKc_Csk_like Catalytic domain of C-terminal Src k	87.24
cd08223	257	STKc_Nek4 Catalytic domain of the Protein Serine/T	87.23
cd05606	278	STKc_beta_ARK Catalytic domain of the Protein Seri	87.1
cd05059	256	PTKc_Tec_like Catalytic domain of Tec-like Protein	87.08
cd08220	256	STKc_Nek8 Catalytic domain of the Protein Serine/T	87.01
cd06637	272	STKc_TNIK Catalytic domain of the Protein Serine/T	86.95
cd07873	301	STKc_PCTAIRE1 Catalytic domain of the Serine/Threo	86.9
cd06646	267	STKc_MAP4K5 Catalytic domain of the Protein Serine	86.9
cd05044	269	PTKc_c-ros Catalytic domain of the Protein Tyrosin	86.89
cd05100	334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	86.85
cd05067	260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	86.79
cd05041	251	PTKc_Fes_like Catalytic domain of Fes-like Protein	86.74
PRK09188	365	serine/threonine protein kinase; Provisional	86.73
cd05061	288	PTKc_InsR Catalytic domain of the Protein Tyrosine	86.68
cd06659	297	STKc_PAK6 Catalytic domain of the Protein Serine/T	86.65
cd08529	256	STKc_FA2-like Catalytic domain of the Protein Seri	86.63
cd05113	256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	86.53
cd06653	264	STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina	86.51
cd05148	261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	86.43
cd05056	270	PTKc_FAK Catalytic domain of the Protein Tyrosine	86.42
cd06636	282	STKc_MAP4K4_6 Catalytic domain of the Protein Seri	86.4
cd06608	275	STKc_myosinIII_like Catalytic domain of Class III	86.37
cd07840	287	STKc_CDK9_like Catalytic domain of Cyclin-Dependen	86.34
cd07850	353	STKc_JNK Catalytic domain of the Serine/Threonine	86.33
cd08229	267	STKc_Nek7 Catalytic domain of the Protein Serine/T	86.31
cd05047	270	PTKc_Tie Catalytic domain of Tie Protein Tyrosine	86.27
cd05050	288	PTKc_Musk Catalytic domain of the Protein Tyrosine	86.24
cd07855	334	STKc_ERK5 Catalytic domain of the Serine/Threonine	86.22
cd05060	257	PTKc_Syk_like Catalytic domain of Spleen Tyrosine	86.18
cd06619	279	PKc_MKK5 Catalytic domain of the dual-specificity	86.17
cd07865	310	STKc_CDK9 Catalytic domain of the Serine/Threonine	86.11
cd05097	295	PTKc_DDR_like Catalytic domain of Discoidin Domain	86.09
cd07845	309	STKc_CDK10 Catalytic domain of the Serine/Threonin	85.99
cd06652	265	STKc_MEKK2 Catalytic domain of the Protein Serine/	85.91
cd05070	260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	85.87
cd05580	290	STKc_PKA Catalytic domain of the Protein Serine/Th	85.8
cd07866	311	STKc_BUR1 Catalytic domain of the Serine/Threonine	85.8
cd05069	260	PTKc_Yes Catalytic domain of the Protein Tyrosine	85.76
cd06638	286	STKc_myosinIIIA Catalytic domain of the Protein Se	85.71
COG0515	384	SPS1 Serine/threonine protein kinase [General func	85.69
cd06611	280	STKc_SLK_like Catalytic domain of Ste20-like kinas	85.63
cd05079	284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	85.56
cd05083	254	PTKc_Chk Catalytic domain of the Protein Tyrosine	85.55
cd07832	286	STKc_CCRK Catalytic domain of the Serine/Threonine	85.39
cd07836	284	STKc_Pho85 Catalytic domain of the Serine/Threonin	85.39
cd06649	331	PKc_MEK2 Catalytic domain of the dual-specificity	85.3
PTZ00024	335	cyclin-dependent protein kinase; Provisional	85.3
cd06651	266	STKc_MEKK3 Catalytic domain of the Protein Serine/	85.29
cd08228	267	STKc_Nek6 Catalytic domain of the Protein Serine/T	85.25
cd05098	307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	85.23
cd05033	266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	85.23
cd05065	269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	85.18
cd05114	256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	85.16
cd05068	261	PTKc_Frk_like Catalytic domain of Fyn-related kina	85.1
cd06613	262	STKc_MAP4K3_like Catalytic domain of Mitogen-activ	85.08
cd07835	283	STKc_CDK1_like Catalytic domain of Cyclin-Dependen	85.05
cd05057	279	PTKc_EGFR_like Catalytic domain of Epidermal Growt	85.03
PLN00009	294	cyclin-dependent kinase A; Provisional	84.97
cd07831	282	STKc_MOK Catalytic domain of the Serine/Threonine	84.92
cd05105	400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	84.89
smart00219	258	TyrKc Tyrosine kinase, catalytic domain. Phosphotr	84.79
PHA03390	267	pk1 serine/threonine-protein kinase 1; Provisional	84.76
cd05577	277	STKc_GRK Catalytic domain of the Protein Serine/Th	84.76
cd06627	254	STKc_Cdc7_like Catalytic domain of Cell division c	84.74
KOG0193	678	consensus Serine/threonine protein kinase RAF [Sig	84.72
cd08225	257	STKc_Nek5 Catalytic domain of the Protein Serine/T	84.66
cd05071	262	PTKc_Src Catalytic domain of the Protein Tyrosine	84.63
cd05072	261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	84.57
cd06643	282	STKc_SLK Catalytic domain of the Protein Serine/Th	84.57
cd06654	296	STKc_PAK1 Catalytic domain of the Protein Serine/T	84.54
cd06648	285	STKc_PAK_II Catalytic domain of the Protein Serine	84.42
cd05066	267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	84.38
cd08219	255	STKc_Nek3 Catalytic domain of the Protein Serine/T	84.36
cd07854	342	STKc_MAPK4_6 Catalytic domain of the Serine/Threon	84.32
cd07830	283	STKc_MAK_like Catalytic domain of Male germ cell-A	84.2
cd07856	328	STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre	84.17
cd07834	330	STKc_MAPK Catalytic domain of the Serine/Threonine	84.15
KOG4645	1509	consensus MAPKKK (MAP kinase kinase kinase) SSK2 a	83.94
cd07860	284	STKc_CDK2_3 Catalytic domain of the Serine/Threoni	83.91
cd05085	250	PTKc_Fer Catalytic domain of the Protein Tyrosine	83.9
cd06612	256	STKc_MST1_2 Catalytic domain of the Protein Serine	83.83
cd07880	343	STKc_p38gamma_MAPK12 Catalytic domain of the Serin	83.82
cd05099	314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	83.7
cd07879	342	STKc_p38delta_MAPK13 Catalytic domain of the Serin	83.7
cd08217	265	STKc_Nek2 Catalytic domain of the Protein Serine/T	83.63
PF14812	81	PBP1_TM: Transmembrane domain of transglycosylase	83.57
KOG1164	322	consensus Casein kinase (serine/threonine/tyrosine	83.56
cd07852	337	STKc_MAPK15 Catalytic domain of the Serine/Threoni	83.54
cd07858	337	STKc_TEY_MAPK_plant Catalytic domain of the Serine	83.41
cd06628	267	STKc_MAPKKK_Byr2_like Catalytic domain of fungal B	83.41
cd08221	256	STKc_Nek9 Catalytic domain of the Protein Serine/T	83.38
cd05572	262	STKc_cGK_PKG Catalytic domain of the Protein Serin	83.37
cd06617	283	PKc_MKK3_6 Catalytic domain of the dual-specificit	83.28
cd05087	269	PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein	83.13
PTZ00415	2849	transmission-blocking target antigen s230; Provisi	83.03
cd06626	264	STKc_MEKK4 Catalytic domain of the Protein Serine/	83.02
cd06639	291	STKc_myosinIIIB Catalytic domain of the Protein Se	82.96
cd05112	256	PTKc_Itk Catalytic domain of the Protein Tyrosine	82.88
cd07877	345	STKc_p38alpha_MAPK14 Catalytic domain of the Serin	82.87
cd05034	261	PTKc_Src_like Catalytic domain of Src kinase-like	82.86
cd05107	401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	82.82
cd06917	277	STKc_NAK1_like Catalytic domain of Fungal Nak1-lik	82.65
cd05578	258	STKc_Yank1 Catalytic domain of the Protein Serine/	82.62
cd07846	286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	82.62
cd06632	258	STKc_MEKK1_plant Catalytic domain of the Protein S	82.61
KOG4721	904	consensus Serine/threonine protein kinase, contain	82.55
cd08224	267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	82.38
PRK01723	239	3-deoxy-D-manno-octulosonic-acid kinase; Reviewed	82.37
cd07838	287	STKc_CDK4_6_like Catalytic domain of Cyclin-Depend	82.32
cd07829	282	STKc_CDK_like Catalytic domain of Cyclin-Dependent	82.26
cd06622	286	PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS	82.2
cd05122	253	PKc_STE Catalytic domain of STE family Protein Kin	82.09
cd05073	260	PTKc_Hck Catalytic domain of the Protein Tyrosine	82.05
cd05063	268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	82.03
cd07864	302	STKc_CDK12 Catalytic domain of the Serine/Threonin	81.91
cd05609	305	STKc_MAST Catalytic domain of the Protein Serine/T	81.9
cd06631	265	STKc_YSK4 Catalytic domain of the Protein Serine/T	81.78
cd06635	317	STKc_TAO1 Catalytic domain of the Protein Serine/T	81.62
cd06607	307	STKc_TAO Catalytic domain of the Protein Serine/Th	81.57
cd06657	292	STKc_PAK4 Catalytic domain of the Protein Serine/T	81.54
cd05574	316	STKc_phototropin_like Catalytic domain of Phototro	81.46
cd06609	274	STKc_MST3_like Catalytic domain of Mammalian Ste20	81.32
cd05144	198	RIO2_C RIO kinase family; RIO2, C-terminal catalyt	81.11
cd06629	272	STKc_MAPKKK_Bck1_like Catalytic domain of fungal B	81.1
cd06656	297	STKc_PAK3 Catalytic domain of the Protein Serine/T	80.92
PTZ00415	2849	transmission-blocking target antigen s230; Provisi	80.89
KOG0593	396	consensus Predicted protein kinase KKIAMRE [Genera	80.7
KOG0583	370	consensus Serine/threonine protein kinase [Signal	80.51
cd05613	290	STKc_MSK1_N N-terminal catalytic domain of the Pro	80.44
cd06610	267	STKc_OSR1_SPAK Catalytic domain of the Protein Ser	80.34
KOG1832	1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	80.32
cd07833	288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	80.08

>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction

Probab=97.38  E-value=0.00013  Score=47.35  Aligned_cols=38  Identities=45%  Similarity=0.840  Sum_probs=33.2

Q ss_pred             CCCCCCCC-CceEEecCCCcccccccCcccccccccCCccccccc
Q 024658            2 RKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL   45 (264)
Q Consensus         2 ~~Cd~C~~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (264)
                      ..|..++. ++.+||..|++.+|..|+...|.      .|.+++|
T Consensus         1 ~~C~~H~~~~~~~fC~~~~~~iC~~C~~~~H~------~H~~~~i   39 (39)
T cd00021           1 RLCDEHGEEPLSLFCETDRALLCVDCDLSVHS------GHRRVPL   39 (39)
T ss_pred             CCCCccCCcceEEEeCccChhhhhhcChhhcC------CCCEeeC
Confidence            36899988 99999999999999999988875      5888775

>smart00336 BBOX B-Box-type zinc finger

Probab=96.77  E-value=0.0012  Score=43.29  Aligned_cols=39  Identities=41%  Similarity=0.698  Sum_probs=32.6

Q ss_pred             CCCCCCCCC-CceEEecCCCcccccccCcccccccccCCccccccc
Q 024658            1 MRKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL   45 (264)
Q Consensus         1 m~~Cd~C~~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (264)
                      ++.|..+.. ++.+||..+.+.+|..|....|      +.|.+++|
T Consensus         3 ~~~C~~h~~~~~~~~C~~c~~~iC~~C~~~~H------~~H~~~~l   42 (42)
T smart00336        3 PPKCDSHGDEPAEFFCEECGALLCRTCDEAEH------RGHTVVLL   42 (42)
T ss_pred             CCcCCCCCCCceEEECCCCCcccccccChhhc------CCCceecC
Confidence            367999996 9999999999999999998866      35777664

>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule

Probab=96.47  E-value=0.0014  Score=43.78  Aligned_cols=39  Identities=26%  Similarity=0.499  Sum_probs=33.2

Q ss_pred             CCCCCCCCC-CceEEecCCCcccccccCcccccccccCCccccccc
Q 024658            1 MRKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL   45 (264)
Q Consensus         1 m~~Cd~C~~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (264)
                      ++.|..+.. ++.+||..+...||..|....|..      |..++|
T Consensus         3 ~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~------H~~~~i   42 (42)
T PF00643_consen    3 EPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG------HKIVPI   42 (42)
T ss_dssp             SSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT------SEEEEC
T ss_pred             CccCccCCccceEEEecCCCCccCccCCCCCCCC------CEEeEC
Confidence            578999999 699999999999999999999865      777664

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....

>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues

Probab=96.28  E-value=0.0034  Score=59.27  Aligned_cols=12  Identities=75%  Similarity=1.249  Sum_probs=4.7

Q ss_pred             CCCCCCCCCCCC
Q 024658          111 DEDDDDDDDEDP  122 (264)
Q Consensus       111 ded~~~dd~e~e  122 (264)
                      |+|+|||+||++
T Consensus       279 d~d~d~d~eed~  290 (314)
T PF06524_consen  279 DEDDDEDDEEDE  290 (314)
T ss_pred             cccccccccccc
Confidence            344444443333

The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus

>KOG4367 consensus Predicted Zn-finger protein [Function unknown]

Probab=96.24  E-value=0.0012  Score=66.17  Aligned_cols=74  Identities=26%  Similarity=0.385  Sum_probs=64.3

Q ss_pred             CCCCCCC---CceEEecCCCcccccccCcccccccccCCcccccccc-------------cccccCCCCceecccCCCCc
Q 024658            3 KCELCEC---PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLC-------------HVCQSLTPWKASGPKLGPTV   66 (264)
Q Consensus         3 ~Cd~C~~---pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC-------------~~C~~~p~~ka~~~C~~d~~   66 (264)
                      .|.+|++   .|.|+|+....+.|.-|..+.|-+--.+++|.-+|-.             ..|-.|+...-.+||..|.+
T Consensus       164 kcqlce~a~k~a~v~ceqcdv~yc~pc~~~~hp~rgplakh~l~~~~~grvs~~~s~r~~~~ct~h~~e~~smyc~~ck~  243 (699)
T KOG4367|consen  164 KCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKM  243 (699)
T ss_pred             hhhhhcCChhhhhhhHhhCceEEechHHhccCCCCCchhhcccCCcccCceeeccchhhhhhccCCCCCCceEEEEecCC
Confidence            6999998   4999999999999999999999877778888655542             47888998889999999999


Q ss_pred             ccCchhhhcc
Q 024658           67 SVCDACVAAA   76 (264)
Q Consensus        67 ~LC~~Cd~~~   76 (264)
                      ++|-.|--.+
T Consensus       244 pvc~~clee~  253 (699)
T KOG4367|consen  244 PVCYQCLEEG  253 (699)
T ss_pred             hHHHHHHHhh
Confidence            9999998754

>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction

Probab=96.18  E-value=0.0027  Score=41.11  Aligned_cols=37  Identities=11%  Similarity=-0.017  Sum_probs=28.7

Q ss_pred             cccCCCCceecccCCCCcccCchhhhcccCCCCCCccc
Q 024658           49 CQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKA   86 (264)
Q Consensus        49 C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~pV   86 (264)
                      |+.|+...+.+||..|.+.||..|...+ -.+|.++||
T Consensus         3 C~~H~~~~~~~fC~~~~~~iC~~C~~~~-H~~H~~~~i   39 (39)
T cd00021           3 CDEHGEEPLSLFCETDRALLCVDCDLSV-HSGHRRVPL   39 (39)
T ss_pred             CCccCCcceEEEeCccChhhhhhcChhh-cCCCCEeeC
Confidence            5555544589999999999999999865 357777664

>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms]

Probab=96.15  E-value=0.002  Score=65.19  Aligned_cols=51  Identities=14%  Similarity=0.087  Sum_probs=35.0

Q ss_pred             ccCCCCCCCCCCCCCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          200 SSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       200 ~s~Rplk~~~i~~~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+.++++.-+.  ..+++.-.++-.--+.+|.+|.|||.|.|||||+|++|+|
T Consensus       192 ~s~G~v~w~p~--d~~els~~~Ar~ylrDvv~GLEYLH~QgiiHRDIKPsNLL  242 (576)
T KOG0585|consen  192 CSKGEVKWCPP--DKPELSEQQARKYLRDVVLGLEYLHYQGIIHRDIKPSNLL  242 (576)
T ss_pred             ccCCccccCCC--CcccccHHHHHHHHHHHHHHHHHHHhcCeeccccchhheE
Confidence            34567666553  2222222233334467888999999999999999999986

>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]

Probab=95.91  E-value=0.003  Score=59.80  Aligned_cols=29  Identities=17%  Similarity=0.162  Sum_probs=27.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+++|+++|+|||++.|+|+|+|+||||
T Consensus       121 ~ytr~iL~GL~ylHs~g~vH~DiK~~NiL  149 (313)
T KOG0198|consen  121 RYTRQILEGLAYLHSKGIVHCDIKPANIL  149 (313)
T ss_pred             HHHHHHHHHHHHHHhCCEeccCcccceEE
Confidence            45689999999999999999999999997

>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]

Probab=95.64  E-value=0.0028  Score=67.00  Aligned_cols=50  Identities=20%  Similarity=0.379  Sum_probs=39.6

Q ss_pred             ccCCCCCCCCCCCCCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH-----hhhhccc
Q 024658          200 SSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT-----GICRLSR  259 (264)
Q Consensus       200 ~s~Rplk~~~i~~~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~-----~ic~l~~  259 (264)
                      +-.+|||+---+++=          -+.+|+++|+|||.+.|.|||+|+-|+|     |+||+|-
T Consensus       665 skWGPlKDNEstm~f----------YtkQILeGLkYLHen~IVHRDIKGDNVLvNTySGvlKISD  719 (1226)
T KOG4279|consen  665 SKWGPLKDNESTMNF----------YTKQILEGLKYLHENKIVHRDIKGDNVLVNTYSGVLKISD  719 (1226)
T ss_pred             hccCCCccchhHHHH----------HHHHHHHHhhhhhhcceeeccccCCcEEEeeccceEEecc
Confidence            346889885433322          3589999999999999999999999987     8888763

>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]

Probab=95.36  E-value=0.0073  Score=58.80  Aligned_cols=30  Identities=10%  Similarity=0.153  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      .+-+.+|+.+|.|||+ -.|||||+|++|||
T Consensus       181 ~~ia~~VL~GL~YLh~~~~IIHRDIKPsNlL  211 (364)
T KOG0581|consen  181 GKIARAVLRGLSYLHEERKIIHRDIKPSNLL  211 (364)
T ss_pred             HHHHHHHHHHHHHHhhccCeeeccCCHHHee
Confidence            3456899999999996 99999999999997

>smart00336 BBOX B-Box-type zinc finger

Probab=95.30  E-value=0.012  Score=38.44  Aligned_cols=40  Identities=15%  Similarity=-0.020  Sum_probs=28.7

Q ss_pred             ccccccccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           42 RCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        42 RvpLC~~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      |.++|..++..+   +.+||..|...||..|... .-.+|...|
T Consensus         2 ~~~~C~~h~~~~---~~~~C~~c~~~iC~~C~~~-~H~~H~~~~   41 (42)
T smart00336        2 RPPKCDSHGDEP---AEFFCEECGALLCRTCDEA-EHRGHTVVL   41 (42)
T ss_pred             cCCcCCCCCCCc---eEEECCCCCcccccccChh-hcCCCceec
Confidence            455665555444   8999999999999999975 225666554

>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues

Probab=95.09  E-value=0.019  Score=54.46  Aligned_cols=8  Identities=13%  Similarity=-0.135  Sum_probs=3.1

Q ss_pred             cccCCCCc
Q 024658           59 GPKLGPTV   66 (264)
Q Consensus        59 ~~C~~d~~   66 (264)
                      +.|+.|.+
T Consensus       183 ~sCLRCK~  190 (314)
T PF06524_consen  183 YSCLRCKI  190 (314)
T ss_pred             hhhhheee
Confidence            33443333

The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus

>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box

Probab=95.03  E-value=0.0063  Score=49.77  Aligned_cols=6  Identities=33%  Similarity=0.340  Sum_probs=0.0

Q ss_pred             eecCCC
Q 024658          135 VVPWSG  140 (264)
Q Consensus       135 vVp~s~  140 (264)
                      -|||..
T Consensus        40 e~p~p~   45 (101)
T PF09026_consen   40 EVPVPE   45 (101)
T ss_dssp             ------
T ss_pred             cccchh
Confidence            568866

CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.

>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins

Probab=94.79  E-value=0.019  Score=57.27  Aligned_cols=16  Identities=13%  Similarity=0.023  Sum_probs=9.0

Q ss_pred             hhhccccccccCcchh
Q 024658          234 RGLQNQTMTDQGDAAA  249 (264)
Q Consensus       234 ~~l~~~~i~~~d~~~a  249 (264)
                      ++.-+..+|-+||.++
T Consensus       217 Rr~~K~~~iPQDIDPS  232 (458)
T PF10446_consen  217 RRREKHIPIPQDIDPS  232 (458)
T ss_pred             HHHcCCCCCCCCCCCC
Confidence            3445556666666654

>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]

Probab=94.57  E-value=0.0099  Score=60.94  Aligned_cols=36  Identities=8%  Similarity=0.027  Sum_probs=32.3

Q ss_pred             ccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          217 RDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       217 ~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.-+++-...+|||.+|+|||+..|||||.|=.|||
T Consensus       115 ltEpEary~l~QIv~GlkYLH~~~IiHRDLKLGNlf  150 (592)
T KOG0575|consen  115 LTEPEARYFLRQIVEGLKYLHSLGIIHRDLKLGNLF  150 (592)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHhcCceecccchhhee
Confidence            556777788899999999999999999999998886

>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule

Probab=94.56  E-value=0.02  Score=38.11  Aligned_cols=37  Identities=11%  Similarity=0.016  Sum_probs=26.0

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|..|+...+.+||..|..+||..|.... =.+|..+|
T Consensus         5 ~C~~H~~~~~~~~C~~C~~~~C~~C~~~~-H~~H~~~~   41 (42)
T PF00643_consen    5 KCPEHPEEPLSLFCEDCNEPLCSECTVSG-HKGHKIVP   41 (42)
T ss_dssp             B-SSTTTSBEEEEETTTTEEEEHHHHHTS-TTTSEEEE
T ss_pred             cCccCCccceEEEecCCCCccCccCCCCC-CCCCEEeE
Confidence            34555555599999999999999999953 12255444

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]

Probab=94.28  E-value=0.018  Score=57.45  Aligned_cols=35  Identities=9%  Similarity=0.087  Sum_probs=29.9

Q ss_pred             cCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          218 DHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       218 ~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .++..--...||+..|+|||++.|||||+||-|||
T Consensus       274 ~ed~~K~~f~Qll~avkYLH~~GI~HRDiKPeNIL  308 (475)
T KOG0615|consen  274 REDLGKLLFKQLLTAVKYLHSQGIIHRDIKPENIL  308 (475)
T ss_pred             ccchhHHHHHHHHHHHHHHHHcCcccccCCcceEE
Confidence            34444456789999999999999999999999997

>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box

Probab=93.73  E-value=0.018  Score=47.14  Aligned_cols=14  Identities=36%  Similarity=0.681  Sum_probs=0.4

Q ss_pred             hhhccccCCceecC
Q 024658          125 EEEEEDDENQVVPW  138 (264)
Q Consensus       125 ~~~ee~~enqvVp~  138 (264)
                      +++++++++-|--.
T Consensus        33 dddee~de~p~p~f   46 (101)
T PF09026_consen   33 DDDEEEDEVPVPEF   46 (101)
T ss_dssp             -------------H
T ss_pred             ccccccccccchhH
Confidence            33333335555443

CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.

>PHA02882 putative serine/threonine kinase; Provisional

Probab=93.69  E-value=0.032  Score=49.19  Aligned_cols=29  Identities=7%  Similarity=0.155  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       130 ~i~~qi~~~l~~lH~~~iiHrDiKp~Nil  158 (294)
T PHA02882        130 NIMKDMLTTLEYIHEHGISHGDIKPENIM  158 (294)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999996

>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins

Probab=93.57  E-value=0.04  Score=55.03  Aligned_cols=16  Identities=13%  Similarity=0.270  Sum_probs=8.6

Q ss_pred             CCCCccccCCCCCCCC
Q 024658          176 DLFSDDEIGCSSRPVT  191 (264)
Q Consensus       176 ~~~s~~~~~~~s~~~~  191 (264)
                      +|--.-++-|.+--..
T Consensus       188 ~LPDSTDFVCGTLDED  203 (458)
T PF10446_consen  188 ELPDSTDFVCGTLDED  203 (458)
T ss_pred             CCCCcccccCCCcCCc
Confidence            4444456667665433

>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8

Probab=93.53  E-value=0.034  Score=48.93  Aligned_cols=29  Identities=17%  Similarity=0.094  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       112 ~i~~qi~~al~~LH~~~ivHrDlkp~Nil  140 (317)
T cd07868         112 SLLYQILDGIHYLHANWVLHRDLKPANIL  140 (317)
T ss_pred             HHHHHHHHHHHHHHhCCEEcCCCCHHHEE
Confidence            44689999999999999999999999998

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p

>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]

Probab=93.40  E-value=0.036  Score=56.86  Aligned_cols=28  Identities=14%  Similarity=0.199  Sum_probs=26.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+||++|.|||+..|||||.|+-|||
T Consensus       179 YAAeIldAleylH~~GIIHRDlKPENIL  206 (604)
T KOG0592|consen  179 YAAEILDALEYLHSNGIIHRDLKPENIL  206 (604)
T ss_pred             HHHHHHHHHHHHHhcCceeccCChhhee
Confidence            3678999999999999999999999997

>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6

Probab=93.32  E-value=0.04  Score=48.19  Aligned_cols=29  Identities=17%  Similarity=0.094  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||++.|+|+|.|++|||
T Consensus       112 ~i~~qi~~aL~~lH~~~ivH~Dlkp~Nil  140 (317)
T cd07867         112 SLLYQILDGIHYLHANWVLHRDLKPANIL  140 (317)
T ss_pred             HHHHHHHHHHHHHHhCCEEcCCCCHHHEE
Confidence            44579999999999999999999999997

Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as

>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]

Probab=93.25  E-value=0.055  Score=60.14  Aligned_cols=18  Identities=28%  Similarity=0.497  Sum_probs=10.2

Q ss_pred             cCCCCccccCCCCCCCCC
Q 024658           89 RGGSQSERISGHDETDDD  106 (264)
Q Consensus        89 ~~g~p~~~~~~~d~~~~d  106 (264)
                      |.|.-...+.+||+.+||
T Consensus      1730 f~GEed~~Dddndddddd 1747 (3015)
T KOG0943|consen 1730 FAGEEDHHDDDNDDDDDD 1747 (3015)
T ss_pred             ccCccccccccccccccc
Confidence            666666666666554433

>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]

Probab=93.25  E-value=0.033  Score=61.34  Aligned_cols=27  Identities=15%  Similarity=0.154  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -++|+++|.|+|++.|||||.||-|||
T Consensus       703 FreIlEGLaYIH~~giIHRDLKP~NIF  729 (1351)
T KOG1035|consen  703 FREILEGLAYIHDQGIIHRDLKPRNIF  729 (1351)
T ss_pred             HHHHHHHHHHHHhCceeeccCCcceeE
Confidence            378999999999999999999999997

>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6

Probab=93.12  E-value=0.042  Score=47.46  Aligned_cols=29  Identities=10%  Similarity=0.095  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       114 ~i~~qi~~aL~~lH~~~iiH~dlkp~Nil  142 (290)
T cd07862         114 DMMFQLLRGLDFLHSHRVVHRDLKPQNIL  142 (290)
T ss_pred             HHHHHHHHHHHHHHHCCeeeCCCCHHHEE
Confidence            34578999999999999999999999997

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla

>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases

Probab=93.08  E-value=0.04  Score=46.22  Aligned_cols=30  Identities=13%  Similarity=0.217  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.+++|||
T Consensus       104 ~~~~~~i~~~l~~LH~~~i~H~dlkp~Nil  133 (259)
T cd05037         104 LDVAKQLASALHYLEDKKLVHGNVCGKNIL  133 (259)
T ss_pred             HHHHHHHHHHHHHHhhCCeecccCccceEE
Confidence            344579999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki

>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase

Probab=93.06  E-value=0.048  Score=47.67  Aligned_cols=29  Identities=3%  Similarity=-0.009  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       107 ~~~~qi~~aL~~LH~~~ivH~dlkp~Nil  135 (288)
T cd07871         107 IFMFQLLRGLSYCHKRKILHRDLKPQNLL  135 (288)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            34578999999999999999999999996

Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3

Probab=92.93  E-value=0.042  Score=49.00  Aligned_cols=28  Identities=18%  Similarity=0.096  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+|+.|||
T Consensus       179 ~~~qi~~aL~~LH~~~ivHrDiKp~Nil  206 (338)
T cd05102         179 YSFQVARGMEFLASRKCIHRDLAARNIL  206 (338)
T ss_pred             HHHHHHHHHHHHHHCCEECCCCccceEE
Confidence            3468999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V

>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4

Probab=92.81  E-value=0.05  Score=47.50  Aligned_cols=30  Identities=13%  Similarity=0.169  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|++++|||
T Consensus       105 ~~~~~qi~~~l~~lH~~~iiH~dikp~Nil  134 (285)
T cd05631         105 IFYAAELCCGLEDLQRERIVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHHhCCEEeCCCCHHHEE
Confidence            345678999999999999999999999985

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i

>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants

Probab=92.77  E-value=0.053  Score=47.84  Aligned_cols=29  Identities=7%  Similarity=0.038  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.|||
T Consensus       107 ~i~~qi~~aL~~LH~~~ivH~dlkp~NIl  135 (338)
T cd07859         107 FFLYQLLRALKYIHTANVFHRDLKPKNIL  135 (338)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            34578999999999999999999999986

Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos

>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B

Probab=92.74  E-value=0.051  Score=48.66  Aligned_cols=28  Identities=14%  Similarity=0.109  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       100 ~~~qi~~~L~~lH~~~ivHrDlkp~NIl  127 (323)
T cd05571         100 YGAEIVSALGYLHSCDVVYRDLKLENLM  127 (323)
T ss_pred             HHHHHHHHHHHHHhCCeEeCCCCHHHEE
Confidence            3468999999999999999999999996

Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be

>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2

Probab=92.67  E-value=0.056  Score=48.26  Aligned_cols=28  Identities=21%  Similarity=0.132  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+|+.|||
T Consensus       110 ~~~qi~~~l~~lH~~~ivHrDlkp~Nil  137 (332)
T cd05614         110 YSGEIILALEHLHKLGIVYRDIKLENIL  137 (332)
T ss_pred             HHHHHHHHHHHHHHCCcEecCCCHHHeE
Confidence            4468999999999999999999999996

Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph

>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase

Probab=92.64  E-value=0.054  Score=48.40  Aligned_cols=28  Identities=18%  Similarity=0.114  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|+|++++|||
T Consensus       101 ~~~qi~~~l~~lH~~givH~dikp~NIl  128 (323)
T cd05575         101 YAAEIASALGYLHSLNIIYRDLKPENIL  128 (323)
T ss_pred             HHHHHHHHHHHHHHCCeEeCCCCHHHeE
Confidence            3578999999999999999999999996

Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr

>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma

Probab=92.50  E-value=0.057  Score=48.71  Aligned_cols=28  Identities=14%  Similarity=0.146  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+++.|||
T Consensus       100 ~~~qi~~aL~~LH~~~ivHrDikp~NIl  127 (328)
T cd05593         100 YGAEIVSALDYLHSGKIVYRDLKLENLM  127 (328)
T ss_pred             HHHHHHHHHHHHHhCCeEecccCHHHeE
Confidence            4578999999999999999999999995

Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate

>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1

Probab=92.49  E-value=0.059  Score=48.20  Aligned_cols=28  Identities=18%  Similarity=0.121  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|||.+++|||
T Consensus       101 ~~~qi~~~L~~lH~~giiHrDlkp~Nil  128 (325)
T cd05602         101 YAAEIASALGYLHSLNIVYRDLKPENIL  128 (325)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            3478999999999999999999999985

Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt

>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3

Probab=92.24  E-value=0.059  Score=45.99  Aligned_cols=29  Identities=14%  Similarity=0.098  Sum_probs=26.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|++||++.|+|+|.++++||-
T Consensus       105 ~~~qi~~~l~~lH~~~iiH~dlkp~nili  133 (258)
T cd05078         105 VAKQLAWALHFLEDKGLTHGNVCAKNVLL  133 (258)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCccceEEE
Confidence            45789999999999999999999999874

Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity

>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases

Probab=92.22  E-value=0.067  Score=45.66  Aligned_cols=29  Identities=14%  Similarity=0.048  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.+++|||
T Consensus       104 ~~~~qi~~~l~~lH~~~ivH~dlkp~Nil  132 (269)
T cd05042         104 RMACEVASGLLWLHQADFIHSDLALRNCQ  132 (269)
T ss_pred             HHHHHHHHHHHHHHhcCEecccccHhheE
Confidence            34568999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina

>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1

Probab=92.21  E-value=0.065  Score=48.95  Aligned_cols=31  Identities=0%  Similarity=0.009  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|||.|+.|||
T Consensus       103 ~~~~~~qi~~aL~~lH~~givHrDlKp~NIL  133 (363)
T cd05628         103 TQFYIAETVLAIDSIHQLGFIHRDIKPDNLL  133 (363)
T ss_pred             HHHHHHHHHHHHHHHHhCCeEecCCCHHHeE
Confidence            3445678999999999999999999999996

Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor

Probab=92.20  E-value=0.066  Score=47.44  Aligned_cols=28  Identities=14%  Similarity=0.187  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|+|+|.++.|||
T Consensus       114 ~~~qi~~~L~~LH~~~iiH~dlkp~Nil  141 (316)
T cd05108         114 WCVQIAKGMNYLEERRLVHRDLAARNVL  141 (316)
T ss_pred             HHHHHHHHHHHHHhcCeeccccchhheE
Confidence            4568999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor

>PHA03212 serine/threonine kinase US3; Provisional

Probab=92.20  E-value=0.069  Score=50.25  Aligned_cols=29  Identities=10%  Similarity=0.198  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||+|++|||
T Consensus       186 ~i~~qi~~aL~ylH~~~IvHrDiKP~NIl  214 (391)
T PHA03212        186 AIERSVLRAIQYLHENRIIHRDIKAENIF  214 (391)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCChHhEE
Confidence            34568999999999999999999999996

>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase

Probab=92.18  E-value=0.062  Score=48.17  Aligned_cols=29  Identities=3%  Similarity=0.088  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.|||
T Consensus       122 ~i~~qi~~aL~~LH~~~ivHrdikp~Nil  150 (343)
T cd07878         122 FLIYQLLRGLKYIHSAGIIHRDLKPSNVA  150 (343)
T ss_pred             HHHHHHHHHHHHHHHCCeecccCChhhEE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is

>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2

Probab=92.16  E-value=0.066  Score=49.68  Aligned_cols=28  Identities=4%  Similarity=0.172  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       147 ~~~qil~aL~~LH~~~IvHrDLKp~NIL  174 (370)
T cd05621         147 YTAEVVLALDAIHSMGLIHRDVKPDNML  174 (370)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHEE
Confidence            4468999999999999999999999985

Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found

>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases

Probab=92.13  E-value=0.069  Score=48.90  Aligned_cols=27  Identities=4%  Similarity=0.079  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       107 ~~ql~~aL~~LH~~givHrDlkp~NIl  133 (377)
T cd05629         107 MAECVLAIEAVHKLGFIHRDIKPDNIL  133 (377)
T ss_pred             HHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            578999999999999999999999997

Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of

>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase

Probab=92.09  E-value=0.068  Score=46.98  Aligned_cols=28  Identities=4%  Similarity=0.030  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.|+.|||
T Consensus       108 ~~~qi~~al~~lH~~~ivH~dlkp~Nil  135 (303)
T cd07869         108 FLFQLLRGLSYIHQRYILHRDLKPQNLL  135 (303)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4478999999999999999999999996

Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an

>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases

Probab=92.07  E-value=0.067  Score=47.85  Aligned_cols=28  Identities=11%  Similarity=0.107  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qil~al~~LH~~~ivHrDlkp~Nil  128 (330)
T cd05586         101 YIAELVLALEHLHKYDIVYRDLKPENIL  128 (330)
T ss_pred             HHHHHHHHHHHHHHCCeEeccCCHHHeE
Confidence            3468999999999999999999999996

Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of

>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2

Probab=92.06  E-value=0.075  Score=46.26  Aligned_cols=30  Identities=17%  Similarity=0.258  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.+++|||
T Consensus       120 ~~i~~qi~~~l~~lH~~~iiH~dlkp~Nil  149 (274)
T cd05076         120 ITVAQQLASALSYLEDKNLVHGNVCAKNIL  149 (274)
T ss_pred             HHHHHHHHHHHHHHHcCCccCCCCCcccEE
Confidence            345678999999999999999999999997

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt

>PTZ00036 glycogen synthase kinase; Provisional

Probab=92.06  E-value=0.07  Score=50.99  Aligned_cols=27  Identities=7%  Similarity=0.091  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       176 ~~qi~~gL~yLH~~~IiHrDLKp~NIL  202 (440)
T PTZ00036        176 SYQLCRALAYIHSKFICHRDLKPQNLL  202 (440)
T ss_pred             HHHHHHHHHHHHHCCEecCCcCHHHEE
Confidence            358999999999999999999999987

>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta

Probab=92.03  E-value=0.071  Score=47.63  Aligned_cols=29  Identities=14%  Similarity=0.064  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.|++|||
T Consensus       105 ~~~~qi~~aL~~lH~~~ivHrDlkp~Nil  133 (328)
T cd08226         105 NILFGALRGLNYLHQNGYIHRNIKASHIL  133 (328)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            44578999999999999999999999996

Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig

>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism]

Probab=92.01  E-value=0.058  Score=52.66  Aligned_cols=34  Identities=9%  Similarity=0.218  Sum_probs=30.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH-----hhhhcc
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT-----GICRLS  258 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~-----~ic~l~  258 (264)
                      -+-||..+|.|||+..|-|||+|+.|||     |+-|||
T Consensus       130 Yt~Qlfrgl~yLh~~~IcHRDIKPqNlLvD~~tg~LKic  168 (364)
T KOG0658|consen  130 YTYQLFRGLAYLHSHGICHRDIKPQNLLVDPDTGVLKIC  168 (364)
T ss_pred             HHHHHHHHHHHHHhcCcccCCCChheEEEcCCCCeEEec
Confidence            3579999999999999999999999997     666665

>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases

Probab=91.97  E-value=0.075  Score=47.25  Aligned_cols=28  Identities=11%  Similarity=0.167  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.+++|||
T Consensus        98 ~~~qi~~~l~~lH~~~i~HrDlkp~Nil  125 (312)
T cd05585          98 YTAELLCALENLHKFNVIYRDLKPENIL  125 (312)
T ss_pred             HHHHHHHHHHHHHhCCeEeCCCCHHHeE
Confidence            4568999999999999999999999985

Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl

>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3

Probab=91.96  E-value=0.077  Score=47.94  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       124 ~~~qi~~aL~~LH~~givHrDikp~Nil  151 (355)
T cd07874         124 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  151 (355)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCChHHEE
Confidence            4578999999999999999999999996

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok

>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C

Probab=91.92  E-value=0.076  Score=47.50  Aligned_cols=30  Identities=13%  Similarity=0.018  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       104 ~~~~~qi~~al~~lH~~~ivH~dlkp~Nil  133 (324)
T cd05587         104 VFYAAEIAIGLFFLHSKGIIYRDLKLDNVM  133 (324)
T ss_pred             HHHHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            345678999999999999999999999996

Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory

>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2

Probab=91.91  E-value=0.072  Score=49.10  Aligned_cols=27  Identities=4%  Similarity=0.083  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|++|||
T Consensus       107 ~~qi~~aL~~LH~~givHrDlKp~Nil  133 (381)
T cd05626         107 IAELTLAIESVHKMGFIHRDIKPDNIL  133 (381)
T ss_pred             HHHHHHHHHHHHhCCeeecCCcHHHEE
Confidence            468999999999999999999999996

Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po

>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2

Probab=91.89  E-value=0.075  Score=47.35  Aligned_cols=28  Identities=11%  Similarity=0.089  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qi~~~L~~lH~~~ivH~Dlkp~NIl  128 (321)
T cd05603         101 YAAEVASAIGYLHSLNIIYRDLKPENIL  128 (321)
T ss_pred             HHHHHHHHHHHHHHCCeEeccCCHHHeE
Confidence            3578999999999999999999999986

Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.

>PHA03210 serine/threonine kinase US3; Provisional

Probab=91.88  E-value=0.076  Score=51.78  Aligned_cols=28  Identities=4%  Similarity=0.112  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|++|||
T Consensus       272 i~~ql~~aL~yLH~~gIiHrDLKP~NIL  299 (501)
T PHA03210        272 IMKQLLCAVEYIHDKKLIHRDIKLENIF  299 (501)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            3468889999999999999999999986

>PLN00181 protein SPA1-RELATED; Provisional

Probab=91.85  E-value=0.07  Score=54.79  Aligned_cols=29  Identities=7%  Similarity=0.069  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||.|++|||
T Consensus        84 ~i~~qi~~al~~lH~~gIvHrDlKP~NiL  112 (793)
T PLN00181         84 HVFRQIVEIVNAAHSQGIVVHNVRPSCFV  112 (793)
T ss_pred             HHHHHHHHHHHHHHhCCeeeccCCchhEE
Confidence            34579999999999999999999999998

>PHA03207 serine/threonine kinase US3; Provisional

Probab=91.70  E-value=0.085  Score=49.04  Aligned_cols=29  Identities=10%  Similarity=0.157  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||+|++|||
T Consensus       189 ~i~~ql~~aL~~LH~~givHrDlkp~Nil  217 (392)
T PHA03207        189 TIQRRLLEALAYLHGRGIIHRDVKTENIF  217 (392)
T ss_pred             HHHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            44578999999999999999999999986

>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4

Probab=91.70  E-value=0.083  Score=45.43  Aligned_cols=29  Identities=10%  Similarity=0.082  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       112 ~~~~qi~~al~~lH~~~ivH~dikp~Nil  140 (288)
T cd07863         112 DLMRQFLRGLDFLHANCIVHRDLKPENIL  140 (288)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999987

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou

>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha

Probab=91.68  E-value=0.074  Score=47.50  Aligned_cols=28  Identities=11%  Similarity=0.122  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       106 i~~qi~~~L~~LH~~~iiH~dlkp~Nil  133 (327)
T cd08227         106 ILQGVLKALDYIHHMGYVHRSVKASHIL  133 (327)
T ss_pred             HHHHHHHHHHHHHHCCEecCCCChhhEE
Confidence            3467899999999999999999999996

Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype

>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon

Probab=91.64  E-value=0.086  Score=47.09  Aligned_cols=28  Identities=11%  Similarity=0.007  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       101 ~~~qi~~aL~~LH~~~ivHrDikp~Nil  128 (321)
T cd05591         101 YAAEVTLALMFLHRHGVIYRDLKLDNIL  128 (321)
T ss_pred             HHHHHHHHHHHHHHCCeeccCCCHHHeE
Confidence            4578999999999999999999999996

Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to

>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2

Probab=91.64  E-value=0.087  Score=47.78  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       128 ~~~qi~~~L~~LH~~~ivHrDlkp~NIl  155 (359)
T cd07876         128 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  155 (359)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            3468999999999999999999999996

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn

>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor

Probab=91.61  E-value=0.08  Score=48.34  Aligned_cols=27  Identities=4%  Similarity=0.110  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       107 ~~qi~~al~~lH~~~ivHrDlkp~Nil  133 (376)
T cd05598         107 IAELTCAIESVHKMGFIHRDIKPDNIL  133 (376)
T ss_pred             HHHHHHHHHHHHHCCeEeCCCCHHHEE
Confidence            468999999999999999999999996

Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.

>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta

Probab=91.61  E-value=0.087  Score=47.19  Aligned_cols=28  Identities=11%  Similarity=0.137  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qi~~~l~~lH~~~ivHrDlkp~Nil  128 (316)
T cd05620         101 YAAEIVCGLQFLHSKGIIYRDLKLDNVM  128 (316)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            4468999999999999999999999985

Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I

>PTZ00284 protein kinase; Provisional

Probab=91.55  E-value=0.087  Score=50.22  Aligned_cols=29  Identities=7%  Similarity=-0.104  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|.+||.+ .|+|||+|++|||-
T Consensus       236 i~~qi~~aL~yLH~~~gIiHrDlKP~NILl  265 (467)
T PTZ00284        236 IIFQTGVALDYFHTELHLMHTDLKPENILM  265 (467)
T ss_pred             HHHHHHHHHHHHHhcCCeecCCCCHHHEEE
Confidence            346889999999974 99999999999973

>PLN03225 Serine/threonine-protein kinase SNT7; Provisional

Probab=91.55  E-value=0.082  Score=53.06  Aligned_cols=27  Identities=19%  Similarity=0.286  Sum_probs=25.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|++|||
T Consensus       261 ~~qll~aL~yLH~~gIiHRDLKP~NIL  287 (566)
T PLN03225        261 MRQILFALDGLHSTGIVHRDVKPQNII  287 (566)
T ss_pred             HHHHHHHHHHHHHCCEEeCcCCHHHEE
Confidence            467899999999999999999999996

>PHA03209 serine/threonine kinase US3; Provisional

Probab=91.51  E-value=0.089  Score=48.14  Aligned_cols=28  Identities=21%  Similarity=0.239  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+|+.|||
T Consensus       162 i~~qi~~aL~~LH~~~ivHrDlkp~Nil  189 (357)
T PHA03209        162 IEKQILEGLRYLHAQRIIHRDVKTENIF  189 (357)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4478999999999999999999999996

>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases

Probab=91.50  E-value=0.091  Score=46.15  Aligned_cols=29  Identities=14%  Similarity=0.161  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       105 ~~~~qi~~~l~~lH~~~i~H~dlkp~NIl  133 (291)
T cd05612         105 FYASEIVCALEYLHSKEIVYRDLKPENIL  133 (291)
T ss_pred             HHHHHHHHHHHHHHHCCeeecCCCHHHeE
Confidence            34578999999999999999999999997

Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt

>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase

Probab=91.47  E-value=0.094  Score=47.92  Aligned_cols=28  Identities=11%  Similarity=0.099  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       108 ~~~qi~~aL~~LH~~~ivH~dlkp~Nil  135 (372)
T cd07853         108 FLYQILRGLKYLHSAGILHRDIKPGNLL  135 (372)
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCChHHEE
Confidence            4578999999999999999999999986

Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription

>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta

Probab=91.47  E-value=0.085  Score=47.38  Aligned_cols=29  Identities=14%  Similarity=0.137  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus        99 ~~~~qi~~aL~~LH~~~ivH~Dlkp~NIl  127 (323)
T cd05595          99 FYGAEIVSALEYLHSRDVVYRDIKLENLM  127 (323)
T ss_pred             HHHHHHHHHHHHHHHCCeEecCCCHHHEE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2

Probab=91.46  E-value=0.078  Score=45.63  Aligned_cols=30  Identities=13%  Similarity=0.165  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       112 ~~~~~qi~~~L~~lH~~~iiH~dlkp~Nil  141 (279)
T cd05109         112 LNWCVQIAKGMSYLEEVRLVHRDLAARNVL  141 (279)
T ss_pred             HHHHHHHHHHHHHHHHCCeeccccccceEE
Confidence            445689999999999999999999999986

Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve

>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl

Probab=91.46  E-value=0.089  Score=44.71  Aligned_cols=28  Identities=21%  Similarity=0.144  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       117 ~~~~i~~~l~~lH~~~i~H~dlkp~Nil  144 (272)
T cd05075         117 FMTDIASGMEYLSSKSFIHRDLAARNCM  144 (272)
T ss_pred             HHHHHHHHHHHHHHCCeeccccchhheE
Confidence            3467899999999999999999999987

Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor

>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms]

Probab=91.44  E-value=0.079  Score=51.68  Aligned_cols=31  Identities=6%  Similarity=0.071  Sum_probs=27.9

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+--||+-+|||+|+..|+|||.|++|||
T Consensus       127 ~q~f~YQiLrgLKyiHSAnViHRDLKPsNll  157 (359)
T KOG0660|consen  127 AQYFLYQILRGLKYIHSANVIHRDLKPSNLL  157 (359)
T ss_pred             HHHHHHHHHHhcchhhcccccccccchhhee
Confidence            3456679999999999999999999999997

>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase

Probab=91.40  E-value=0.097  Score=46.11  Aligned_cols=28  Identities=7%  Similarity=0.000  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       109 ~~~qi~~aL~~lH~~~ivH~dlkp~Nil  136 (309)
T cd07872         109 FLYQILRGLAYCHRRKVLHRDLKPQNLL  136 (309)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4568999999999999999999999985

Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play

>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases

Probab=91.38  E-value=0.091  Score=46.88  Aligned_cols=27  Identities=7%  Similarity=0.127  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+++.|||
T Consensus       107 ~~qi~~aL~~LH~~giiH~Dlkp~NIl  133 (350)
T cd05573         107 IAELVLALDSVHKLGFIHRDIKPDNIL  133 (350)
T ss_pred             HHHHHHHHHHHHHCCeeccCCCHHHeE
Confidence            468999999999999999999999996

Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the

>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases

Probab=91.37  E-value=0.092  Score=47.48  Aligned_cols=28  Identities=4%  Similarity=0.033  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       106 ~~~qi~~aL~~lH~~~ivH~Dlkp~NIl  133 (364)
T cd05599         106 YIAETILAIDSIHKLGYIHRDIKPDNLL  133 (364)
T ss_pred             HHHHHHHHHHHHHHCCeEeccCCHHHeE
Confidence            4478999999999999999999999996

Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica

>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3

Probab=91.28  E-value=0.093  Score=46.94  Aligned_cols=28  Identities=18%  Similarity=0.118  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       101 ~~~qi~~al~~lH~~givH~Dlkp~NIl  128 (325)
T cd05604         101 YAAEIASALGYLHSINIVYRDLKPENIL  128 (325)
T ss_pred             HHHHHHHHHHHHHHCCeeecCCCHHHeE
Confidence            4578999999999999999999999986

Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1

Probab=91.24  E-value=0.1  Score=45.77  Aligned_cols=29  Identities=14%  Similarity=0.094  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.+++|||
T Consensus       142 ~i~~~i~~al~~lH~~~ivH~dlkp~Nil  170 (304)
T cd05096         142 HVALQIASGMKYLSSLNFVHRDLATRNCL  170 (304)
T ss_pred             HHHHHHHHHHHHHHHCCccccCcchhheE
Confidence            45678999999999999999999999997

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k

>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1

Probab=91.22  E-value=0.097  Score=48.02  Aligned_cols=27  Identities=4%  Similarity=0.097  Sum_probs=25.4

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       107 ~~qi~~al~~lH~~~ivHrDlKp~NIL  133 (382)
T cd05625         107 IAELTCAVESVHKMGFIHRDIKPDNIL  133 (382)
T ss_pred             HHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            468999999999999999999999997

Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an

>PTZ00263 protein kinase A catalytic subunit; Provisional

Probab=91.20  E-value=0.099  Score=47.09  Aligned_cols=27  Identities=4%  Similarity=0.114  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+++.|||
T Consensus       124 ~~qi~~aL~~LH~~~ivH~dlkp~NIl  150 (329)
T PTZ00263        124 HAELVLAFEYLHSKDIIYRDLKPENLL  150 (329)
T ss_pred             HHHHHHHHHHHHHCCeeecCCCHHHEE
Confidence            468999999999999999999999986

>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta

Probab=91.14  E-value=0.1  Score=46.69  Aligned_cols=30  Identities=13%  Similarity=0.018  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|||.++.|||
T Consensus       104 ~~~~~qi~~aL~~LH~~~ivHrDlkp~Nil  133 (323)
T cd05616         104 VFYAAEIAIGLFFLHSKGIIYRDLKLDNVM  133 (323)
T ss_pred             HHHHHHHHHHHHHHHHCCEEecCCCHHHeE
Confidence            345678999999999999999999999985

Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and

>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta

Probab=91.07  E-value=0.1  Score=46.67  Aligned_cols=28  Identities=14%  Similarity=0.138  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+++.|||
T Consensus       101 ~~~qi~~al~~LH~~~ivH~dlkp~Nil  128 (316)
T cd05592         101 YAAEIICGLQFLHKKGIIYRDLKLDNVL  128 (316)
T ss_pred             HHHHHHHHHHHHHHCCEEeCCCCHHHeE
Confidence            3578999999999999999999999996

Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp

>PLN00034 mitogen-activated protein kinase kinase; Provisional

Probab=91.03  E-value=0.1  Score=47.34  Aligned_cols=29  Identities=10%  Similarity=0.190  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       172 ~i~~qi~~aL~~LH~~~ivHrDlkp~NIl  200 (353)
T PLN00034        172 DVARQILSGIAYLHRRHIVHRDIKPSNLL  200 (353)
T ss_pred             HHHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            34578999999999999999999999996

>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]

Probab=91.03  E-value=0.097  Score=53.42  Aligned_cols=34  Identities=9%  Similarity=0.047  Sum_probs=29.7

Q ss_pred             CCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          219 HGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       219 ~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+|--....||+.+|+|+|++.|.|||+|++|||
T Consensus       217 ~~qIKc~mkQLl~Gl~~cH~~gvlHRDIK~SNiL  250 (560)
T KOG0600|consen  217 EPQIKCYMKQLLEGLEYCHSRGVLHRDIKGSNIL  250 (560)
T ss_pred             hHHHHHHHHHHHHHHHHHhhcCeeeccccccceE
Confidence            3445556679999999999999999999999997

>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1

Probab=91.02  E-value=0.12  Score=46.34  Aligned_cols=29  Identities=10%  Similarity=0.119  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.++.|||
T Consensus       109 ~~~~qi~~aL~~LH~~givH~dlkp~Nil  137 (332)
T cd07857         109 SFIYQILCGLKYIHSANVLHRDLKPGNLL  137 (332)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHeE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2

Probab=91.00  E-value=0.1  Score=44.92  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.+++||+
T Consensus       129 ~~~ql~~aL~~lH~~gi~H~dlkp~Nil  156 (283)
T cd05091         129 IVTQIAAGMEFLSSHHVVHKDLATRNVL  156 (283)
T ss_pred             HHHHHHHHHHHHHHcCccccccchhheE
Confidence            3468999999999999999999999996

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2

Probab=90.99  E-value=0.097  Score=45.04  Aligned_cols=27  Identities=7%  Similarity=0.076  Sum_probs=25.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|++++|||
T Consensus       105 ~~~i~~al~~lH~~~i~H~dikp~nil  131 (268)
T cd05086         105 ACEIAAGVTHMHKHNFLHSDLALRNCF  131 (268)
T ss_pred             HHHHHHHHHHHHHCCeeccCCccceEE
Confidence            468999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage

>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1

Probab=90.93  E-value=0.11  Score=44.78  Aligned_cols=32  Identities=13%  Similarity=0.129  Sum_probs=28.2

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ..+...+|+.+|.+||++.|+|+|.++.|||=
T Consensus       107 ~~~i~~qi~~~l~~lH~~~ivH~dlkp~Nill  138 (262)
T cd05077         107 KFKVAKQLASALSYLEDKDLVHGNVCTKNILL  138 (262)
T ss_pred             HHHHHHHHHHHHHHhhhCCeECCCCCcccEEE
Confidence            34556899999999999999999999999874

Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom

>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1

Probab=90.92  E-value=0.12  Score=45.04  Aligned_cols=29  Identities=17%  Similarity=0.188  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       101 ~~~~qi~~~l~~lH~~~i~H~dlkp~Nil  129 (280)
T cd05608         101 FYTAQIISGLEHLHQRRIIYRDLKPENVL  129 (280)
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            45578999999999999999999999986

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g

>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase

Probab=90.91  E-value=0.1  Score=46.55  Aligned_cols=27  Identities=0%  Similarity=0.103  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|++||++.|+|||.++.|||
T Consensus       108 ~~qi~~aL~~lH~~~i~H~Dlkp~NIl  134 (330)
T cd05601         108 LAELVLAIHSVHQMGYVHRDIKPENVL  134 (330)
T ss_pred             HHHHHHHHHHHHHCCeEcccCchHheE
Confidence            468999999999999999999999996

Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor

>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase

Probab=90.91  E-value=0.11  Score=46.57  Aligned_cols=28  Identities=18%  Similarity=0.101  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       105 ~~~qi~~~l~~lH~~~ivH~dlkp~Nil  132 (323)
T cd05584         105 YLSEISLALEHLHQQGIIYRDLKPENIL  132 (323)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            3568999999999999999999999997

Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in

>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1

Probab=90.83  E-value=0.11  Score=47.11  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       131 ~~~qi~~aL~~LH~~~ivH~Dlkp~NIl  158 (364)
T cd07875         131 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  158 (364)
T ss_pred             HHHHHHHHHHHHhhCCeecCCCCHHHEE
Confidence            3578999999999999999999999986

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]

Probab=90.77  E-value=0.072  Score=56.43  Aligned_cols=48  Identities=17%  Similarity=0.133  Sum_probs=39.4

Q ss_pred             HHhhhhcccCCCCCCCCCCCCCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          193 EEAAASMSSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       193 ~~~~~s~~s~Rplk~~~i~~~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+.|+.=-|+|++.-|-   .|         -.++++.|++||++.|||||.|+.|||
T Consensus       115 AVDaimlEL~r~LtE~QIq---vv---------c~q~ldALn~LHs~~iIHRDLKAGNiL  162 (1187)
T KOG0579|consen  115 AVDAIMLELGRVLTEDQIQ---VV---------CYQVLDALNWLHSQNIIHRDLKAGNIL  162 (1187)
T ss_pred             hHhHHHHHhccccchHHHH---HH---------HHHHHHHHHHHhhcchhhhhccccceE
Confidence            3467788888999987761   11         357899999999999999999999997

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4

Probab=90.71  E-value=0.11  Score=44.43  Aligned_cols=30  Identities=23%  Similarity=0.180  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.||+
T Consensus       120 ~~~~~~l~~~l~~LH~~~i~H~dlkp~Nil  149 (275)
T cd05046         120 VALCTQIALGMDHLSNARFVHRDLAARNCL  149 (275)
T ss_pred             HHHHHHHHHHHHHhhhcCcccCcCccceEE
Confidence            345578999999999999999999999976

Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s

>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase

Probab=90.71  E-value=0.12  Score=47.84  Aligned_cols=27  Identities=4%  Similarity=0.186  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.++.|||
T Consensus       148 ~~qi~~aL~~LH~~~ivHrDLkp~NIL  174 (370)
T cd05596         148 TAEVVLALDAIHSMGFIHRDVKPDNML  174 (370)
T ss_pred             HHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            468999999999999999999999986

Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in

>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta

Probab=90.70  E-value=0.12  Score=46.38  Aligned_cols=29  Identities=14%  Similarity=0.060  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+++.|||
T Consensus       100 ~~~~ql~~~L~~lH~~~ivH~dlkp~NIl  128 (320)
T cd05590         100 FYAAEITSALMFLHDKGIIYRDLKLDNVL  128 (320)
T ss_pred             HHHHHHHHHHHHHHHCCeEeCCCCHHHeE
Confidence            34578999999999999999999999996

Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal

>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1

Probab=90.66  E-value=0.11  Score=48.03  Aligned_cols=28  Identities=4%  Similarity=0.158  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.|+.|||
T Consensus       147 ~~~qi~~aL~~LH~~~ivHrDLkp~NIl  174 (371)
T cd05622         147 YTAEVVLALDAIHSMGFIHRDVKPDNML  174 (371)
T ss_pred             HHHHHHHHHHHHHHCCEEeCCCCHHHEE
Confidence            3468999999999999999999999996

Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an

>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]

Probab=90.63  E-value=0.092  Score=53.68  Aligned_cols=35  Identities=17%  Similarity=0.186  Sum_probs=29.0

Q ss_pred             CCCCcchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          219 HGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       219 ~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      -+|--.-.++|+.+|++||++.|||||+|+-+||.
T Consensus       368 E~qIA~Icre~l~aL~fLH~~gIiHrDIKSDnILL  402 (550)
T KOG0578|consen  368 EGQIAAICREILQGLKFLHARGIIHRDIKSDNILL  402 (550)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcceeeeccccceeEe
Confidence            34444456778899999999999999999999975

>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase

Probab=90.61  E-value=0.12  Score=45.98  Aligned_cols=28  Identities=11%  Similarity=0.031  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       103 ~~~qi~~~l~~lH~~~i~H~dlkp~Nil  130 (318)
T cd05582         103 YLAELALALDHLHSLGIIYRDLKPENIL  130 (318)
T ss_pred             HHHHHHHHHHHHHHCCEecCCCCHHHeE
Confidence            3468999999999999999999999986

Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate

>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional

Probab=90.54  E-value=0.12  Score=47.26  Aligned_cols=29  Identities=10%  Similarity=0.041  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||.++.|||
T Consensus       135 ~~~~qi~~aL~~LH~~~ivHrDLkp~NIL  163 (340)
T PTZ00426        135 FYAAQIVLIFEYLQSLNIVYRDLKPENLL  163 (340)
T ss_pred             HHHHHHHHHHHHHHHCCeEccCCCHHHEE
Confidence            34678999999999999999999999997

>PHA03211 serine/threonine kinase US3; Provisional

Probab=90.50  E-value=0.12  Score=50.61  Aligned_cols=28  Identities=4%  Similarity=0.156  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+|++|||
T Consensus       265 i~~qi~~aL~yLH~~gIvHrDLKP~NIL  292 (461)
T PHA03211        265 VARQLLSAIDYIHGEGIIHRDIKTENVL  292 (461)
T ss_pred             HHHHHHHHHHHHHHCCEEECcCCHHHEE
Confidence            3467889999999999999999999986

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3

Probab=90.45  E-value=0.13  Score=44.28  Aligned_cols=30  Identities=13%  Similarity=0.121  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||+..|+|+|.+++||+
T Consensus       111 ~~~~~~l~~aL~~LH~~~i~H~dlkp~nil  140 (284)
T cd05081         111 LLYASQICKGMEYLGSKRYVHRDLATRNIL  140 (284)
T ss_pred             HHHHHHHHHHHHHHHHCCceeccCCHhhEE
Confidence            344578999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th

>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2

Probab=90.40  E-value=0.12  Score=46.92  Aligned_cols=28  Identities=0%  Similarity=0.044  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       106 ~~~qi~~~L~~lH~~givHrDLkp~NIl  133 (360)
T cd05627         106 YIAETVLAIDAIHQLGFIHRDIKPDNLL  133 (360)
T ss_pred             HHHHHHHHHHHHHHCCeEccCCCHHHEE
Confidence            4578999999999999999999999996

Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul

>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]

Probab=90.39  E-value=0.1  Score=50.77  Aligned_cols=28  Identities=11%  Similarity=0.126  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +--+|+.+|||||+..|.|||+|+.|+|
T Consensus       161 FlYQILRGLKYLHsA~ILHRDIKPGNLL  188 (449)
T KOG0664|consen  161 FVYQILRGLKYLHTANILHRDIKPGNLL  188 (449)
T ss_pred             hHHHHHhhhHHHhhcchhhccCCCccEE
Confidence            4579999999999999999999998854

>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins

Probab=90.39  E-value=0.13  Score=43.65  Aligned_cols=31  Identities=10%  Similarity=0.133  Sum_probs=27.2

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+...+|+.+|.+||++.|+|+|.++.||+
T Consensus        87 ~~~~~~ql~~~l~~lH~~~i~H~dlkp~Nil  117 (237)
T cd05576          87 VKRWAAEMVVALDALHREGIVCRDLNPNNIL  117 (237)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            3455678999999999999999999999986

Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor

Probab=90.31  E-value=0.12  Score=47.97  Aligned_cols=29  Identities=14%  Similarity=0.120  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +-..+|+.+|.+||++.|+|||.+++|||
T Consensus       216 ~i~~qi~~aL~yLH~~giiHrDLkp~Nil  244 (374)
T cd05106         216 RFSSQVAQGMDFLASKNCIHRDVAARNVL  244 (374)
T ss_pred             HHHHHHHHHHHHHHHCCEEeccCchheEE
Confidence            44578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10

Probab=90.25  E-value=0.12  Score=44.38  Aligned_cols=31  Identities=16%  Similarity=0.169  Sum_probs=27.5

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.|||
T Consensus       109 ~~~~~~~i~~al~~lH~~~iiH~dikp~nil  139 (266)
T cd05064         109 LMGMLPGLASGMKYLSEMGYVHKGLAAHKVL  139 (266)
T ss_pred             HHHHHHHHHHHHHHHHHCCEeeccccHhhEE
Confidence            3455678999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor

>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5

Probab=90.23  E-value=0.14  Score=44.22  Aligned_cols=29  Identities=7%  Similarity=0.082  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       104 ~~~~qi~~~L~~lH~~~i~H~dlkp~Nil  132 (287)
T cd07848         104 SYIYQLIKAIHWCHKNDIVHRDIKPENLL  132 (287)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34578999999999999999999999986

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes

>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases

Probab=90.19  E-value=0.14  Score=45.77  Aligned_cols=28  Identities=4%  Similarity=0.051  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||.+.|+|+|.++.|||
T Consensus       106 ~~~qi~~~l~~lH~~~ivH~dlkp~Nil  133 (333)
T cd05600         106 YMAEMFEAVDALHELGYIHRDLKPENFL  133 (333)
T ss_pred             HHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            4578999999999999999999999996

Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis.

>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]

Probab=90.19  E-value=0.12  Score=49.61  Aligned_cols=30  Identities=10%  Similarity=0.121  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhcccc-ccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQT-MTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~-i~~~d~~~a~i~  252 (264)
                      ....-+|..+++|||++. |||||.|+.|||
T Consensus       145 l~~aldiArGm~YLH~~~~iIHrDLK~~NiL  175 (362)
T KOG0192|consen  145 LRIALDIARGMEYLHSEGPIIHRDLKSDNIL  175 (362)
T ss_pred             HHHHHHHHHHHHHHhcCCCeeecccChhhEE
Confidence            355568889999999999 999999999997

>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases

Probab=90.18  E-value=0.14  Score=46.23  Aligned_cols=28  Identities=0%  Similarity=0.054  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       107 ~~~qi~~~l~~lH~~~ivH~dlkp~Nil  134 (331)
T cd05597         107 YLAEMVLAIDSVHQLGYVHRDIKPDNVL  134 (331)
T ss_pred             HHHHHHHHHHHHHhCCeEECCCCHHHEE
Confidence            4578999999999999999999999985

Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,

>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3

Probab=90.16  E-value=0.13  Score=43.78  Aligned_cols=31  Identities=19%  Similarity=0.073  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .....+|+.+|.+||+..|+|+|.+++|||-
T Consensus       116 ~~~~~~i~~~l~~lH~~~i~H~dikp~nili  146 (273)
T cd05074         116 VRFMIDIASGMEYLSSKNFIHRDLAARNCML  146 (273)
T ss_pred             HHHHHHHHHHHHHHHhCCEeecccchhhEEE
Confidence            3445789999999999999999999999873

Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac

>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases

Probab=90.16  E-value=0.13  Score=43.57  Aligned_cols=28  Identities=18%  Similarity=0.086  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.||+
T Consensus       118 ~~~~i~~aL~~lH~~~i~H~dlkp~Nil  145 (273)
T cd05035         118 FMVDIALGMEYLSNRNFIHRDLAARNCM  145 (273)
T ss_pred             HHHHHHHHHHHHHhCCeeccccchheEE
Confidence            3478999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu

>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N

Probab=90.11  E-value=0.14  Score=45.82  Aligned_cols=31  Identities=10%  Similarity=0.127  Sum_probs=27.1

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|++||++.|+|||.++.|||
T Consensus       103 ~~~~~~qi~~al~~lH~~~ivHrdlkp~Nil  133 (324)
T cd05589         103 AVFYAACVVLGLQYLHENKIVYRDLKLDNLL  133 (324)
T ss_pred             HHHHHHHHHHHHHHHHhCCeEecCCCHHHeE
Confidence            3345678999999999999999999999985

Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved

>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta

Probab=90.02  E-value=0.13  Score=46.28  Aligned_cols=27  Identities=0%  Similarity=0.115  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       108 ~~qi~~~L~~lH~~~iiHrDlkp~Nil  134 (331)
T cd05624         108 IAEMVLAIHSIHQLHYVHRDIKPDNVL  134 (331)
T ss_pred             HHHHHHHHHHHHHCCeeeccCchHHEE
Confidence            468999999999999999999999986

Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.

>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3

Probab=90.02  E-value=0.14  Score=44.66  Aligned_cols=29  Identities=24%  Similarity=0.192  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.|||
T Consensus       101 ~i~~qi~~al~~lH~~~ivH~dikp~Nil  129 (279)
T cd05633         101 FYATEIILGLEHMHNRFVVYRDLKPANIL  129 (279)
T ss_pred             HHHHHHHHHHHHHHHCCcCCCCCCHHHEE
Confidence            34578999999999999999999999986

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi

>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C

Probab=90.00  E-value=0.15  Score=45.55  Aligned_cols=29  Identities=10%  Similarity=0.067  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.++.|||
T Consensus       100 ~~~~qi~~~l~~LH~~~ivH~dlkp~Nil  128 (318)
T cd05570         100 FYAAEIVLGLQFLHERGIIYRDLKLDNVL  128 (318)
T ss_pred             HHHHHHHHHHHHHHhCCeEccCCCHHHeE
Confidence            34578999999999999999999999987

Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re

>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota

Probab=89.97  E-value=0.15  Score=46.13  Aligned_cols=29  Identities=14%  Similarity=0.031  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||+++.|||
T Consensus       100 ~i~~qi~~~l~~lH~~~ivH~Dikp~Nil  128 (329)
T cd05618         100 FYSAEISLALNYLHERGIIYRDLKLDNVL  128 (329)
T ss_pred             HHHHHHHHHHHHHHHCCeeeCCCCHHHEE
Confidence            34568999999999999999999999986

Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o

>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha

Probab=89.94  E-value=0.14  Score=46.09  Aligned_cols=28  Identities=4%  Similarity=0.077  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.|+.|||
T Consensus       107 ~~~qi~~al~~lH~~~iiHrDlkp~Nil  134 (332)
T cd05623         107 YLAEMVIAIDSVHQLHYVHRDIKPDNIL  134 (332)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHEE
Confidence            3468999999999999999999999986

Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw

>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only]

Probab=89.93  E-value=0.14  Score=49.39  Aligned_cols=29  Identities=10%  Similarity=0.088  Sum_probs=27.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...||+.+|.+||+..|+|||.|+.|||
T Consensus       124 ~~m~Qll~gl~~~H~~~IlHRDLKPQNlL  152 (323)
T KOG0594|consen  124 SFMRQLLRGLAFLHSHGILHRDLKPQNLL  152 (323)
T ss_pred             HHHHHHHHHHHHHHhCCeecccCCcceEE
Confidence            55689999999999999999999999996

>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta

Probab=89.93  E-value=0.15  Score=45.75  Aligned_cols=28  Identities=18%  Similarity=0.157  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qi~~al~~LH~~~ivHrdikp~Nil  128 (316)
T cd05619         101 YAAEIICGLQFLHSKGIVYRDLKLDNIL  128 (316)
T ss_pred             HHHHHHHHHHHHHhCCeEeCCCCHHHEE
Confidence            4578999999999999999999999996

Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3

Probab=89.90  E-value=0.13  Score=44.58  Aligned_cols=28  Identities=21%  Similarity=0.190  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.+++|||
T Consensus       114 i~~qi~~~l~~lH~~~iiH~dlkp~nil  141 (279)
T cd05111         114 WCVQIAKGMYYLEEHRMVHRNLAARNIL  141 (279)
T ss_pred             HHHHHHHHHHHHHHCCEeccccCcceEE
Confidence            4468999999999999999999999986

Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r

>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases

Probab=89.88  E-value=0.15  Score=42.27  Aligned_cols=30  Identities=17%  Similarity=0.129  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       108 ~~~~~~l~~al~~lH~~~i~H~di~p~nil  137 (262)
T cd00192         108 LSFAIQIAKGMEYLASKKFVHRDLAARNCL  137 (262)
T ss_pred             HHHHHHHHHHHHHHHcCCcccCccCcceEE
Confidence            345578999999999999999999999986

Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan

>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta

Probab=89.77  E-value=0.16  Score=45.75  Aligned_cols=29  Identities=10%  Similarity=0.016  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       100 ~~~~qi~~al~~lH~~~ivHrDlkp~Nil  128 (327)
T cd05617         100 FYAAEICIALNFLHERGIIYRDLKLDNVL  128 (327)
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            34578999999999999999999999986

Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2

Probab=89.76  E-value=0.13  Score=44.30  Aligned_cols=29  Identities=17%  Similarity=0.102  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       111 ~i~~~l~~~l~~lH~~~i~H~dlkp~Nil  139 (283)
T cd05080         111 LFAQQICEGMAYLHSQHYIHRDLAARNVL  139 (283)
T ss_pred             HHHHHHHHHHHHHHHCCeeccccChheEE
Confidence            34568999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign

>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like

Probab=89.70  E-value=0.16  Score=43.49  Aligned_cols=30  Identities=7%  Similarity=-0.015  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       104 ~~~~~qi~~~L~~lH~~~i~H~dl~p~nil  133 (285)
T cd07861         104 KSYLYQILQGILFCHSRRVLHRDLKPQNLL  133 (285)
T ss_pred             HHHHHHHHHHHHHHHhCCeeecCCCHHHEE
Confidence            345689999999999999999999999985

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors

Probab=89.66  E-value=0.16  Score=43.92  Aligned_cols=27  Identities=22%  Similarity=0.218  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.+++|||
T Consensus       136 ~~~i~~al~~LH~~~i~H~dlkp~Nil  162 (296)
T cd05051         136 ATQIASGMRYLESLNFVHRDLATRNCL  162 (296)
T ss_pred             HHHHHHHHHHHHHcCccccccchhcee
Confidence            468999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1

Probab=89.64  E-value=0.15  Score=44.75  Aligned_cols=28  Identities=11%  Similarity=0.179  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||+..|+|+|+++.|||
T Consensus       124 i~~qi~~al~~lH~~~ivH~dlkp~Nil  151 (297)
T cd05089         124 FASDVATGMQYLSEKQFIHRDLAARNVL  151 (297)
T ss_pred             HHHHHHHHHHHHHHCCcccCcCCcceEE
Confidence            4468999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.

>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha

Probab=89.64  E-value=0.14  Score=45.74  Aligned_cols=28  Identities=14%  Similarity=0.170  Sum_probs=24.9

Q ss_pred             hhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+ +.|+|+|+++.|||
T Consensus       100 ~~~qi~~aL~~lH~~~~ivHrDikp~NIl  128 (325)
T cd05594         100 YGAEIVSALDYLHSEKNVVYRDLKLENLM  128 (325)
T ss_pred             HHHHHHHHHHHHHhcCCEEecCCCCCeEE
Confidence            34689999999997 79999999999995

Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien

>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain

Probab=89.61  E-value=0.17  Score=43.42  Aligned_cols=28  Identities=14%  Similarity=0.102  Sum_probs=24.7

Q ss_pred             hhHHHHHHhhhh-ccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGL-QNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l-~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+..|.+| |+..|+|||.|++|||
T Consensus       122 i~~qi~~~L~~l~H~~giiHrDlkP~NIl  150 (190)
T cd05147         122 LYLQVIQIMRILYQDCRLVHADLSEYNLL  150 (190)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            346788999999 7999999999999996

The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c

>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein

Probab=89.61  E-value=0.14  Score=44.77  Aligned_cols=28  Identities=11%  Similarity=0.164  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|+|+|.++.||+
T Consensus       106 ~~~~l~~~L~~LH~~~ivH~dlk~~Nil  133 (314)
T cd08216         106 ILKDVLNALDYIHSKGFIHRSVKASHIL  133 (314)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCcceEE
Confidence            3468999999999999999999999986

Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc

>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes

Probab=89.54  E-value=0.17  Score=42.67  Aligned_cols=30  Identities=10%  Similarity=0.059  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.||+
T Consensus        97 ~~~~~qi~~~L~~lH~~~i~H~dl~p~nil  126 (252)
T cd05084          97 IQMVENAAAGMEYLESKHCIHRDLAARNCL  126 (252)
T ss_pred             HHHHHHHHHHHHHHHhCCccccccchheEE
Confidence            345578999999999999999999999975

Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular

>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5

Probab=89.54  E-value=0.16  Score=44.27  Aligned_cols=30  Identities=13%  Similarity=0.168  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.||+
T Consensus       105 ~~~~~ql~~~l~~lH~~~iiH~dikp~Nil  134 (285)
T cd05632         105 LFYAAEILCGLEDLHRENTVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHHhCCeeecCCCHHHEE
Confidence            345578999999999999999999999987

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors

Probab=89.50  E-value=0.13  Score=44.41  Aligned_cols=28  Identities=11%  Similarity=0.059  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|+|.+++|||
T Consensus       137 i~~qi~~al~~LH~~~ivH~dlkp~Nil  164 (293)
T cd05053         137 FAYQVARGMEFLASKKCIHRDLAARNVL  164 (293)
T ss_pred             HHHHHHHHHHHHHHCCccccccceeeEE
Confidence            4568999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation,

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase

Probab=89.40  E-value=0.15  Score=43.44  Aligned_cols=28  Identities=21%  Similarity=0.185  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       109 ~~~ql~~~l~~lH~~~i~H~dlkp~nil  136 (263)
T cd05052         109 MATQISSAMEYLEKKNFIHRDLAARNCL  136 (263)
T ss_pred             HHHHHHHHHHHHHhCCEeecccCcceEE
Confidence            3578999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays

>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity

Probab=89.37  E-value=0.17  Score=42.28  Aligned_cols=30  Identities=13%  Similarity=0.174  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|+++.||+
T Consensus       101 ~~~~~qi~~~L~~Lh~~~i~H~dikp~NIl  130 (260)
T PF00069_consen  101 LKIAYQILEALAYLHSKGIVHRDIKPENIL  130 (260)
T ss_dssp             HHHHHHHHHHHHHHHHTTEEESSBSGGGEE
T ss_pred             cccccccccccccccccccccccccccccc
Confidence            344578999999999999999999999996

Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain; InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []: Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins) Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C

Probab=89.27  E-value=0.16  Score=44.29  Aligned_cols=30  Identities=17%  Similarity=0.120  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       126 ~~i~~~i~~al~~lH~~~i~H~dlkp~Nil  155 (291)
T cd05094         126 LHIASQIASGMVYLASQHFVHRDLATRNCL  155 (291)
T ss_pred             HHHHHHHHHHHHHHHhCCeeecccCcceEE
Confidence            344578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors

Probab=89.22  E-value=0.16  Score=43.49  Aligned_cols=28  Identities=14%  Similarity=0.108  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.+++||+
T Consensus       129 ~~~~l~~al~~lH~~~i~H~dlkp~Nil  156 (283)
T cd05048         129 IAIQIAAGMEYLSSHHFVHRDLAARNCL  156 (283)
T ss_pred             HHHHHHHHHHHHHhCCeeccccccceEE
Confidence            4578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer

>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase

Probab=89.21  E-value=0.18  Score=43.50  Aligned_cols=32  Identities=3%  Similarity=-0.014  Sum_probs=27.7

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|.+||++.|+|++.++.||+
T Consensus       111 ~~~~~~~qi~~~L~~LH~~~i~H~dl~~~nil  142 (295)
T cd07837         111 TIKSFMYQLLKGVAHCHKHGVMHRDLKPQNLL  142 (295)
T ss_pred             HHHHHHHHHHHHHHHHHHCCeeecCCChHHEE
Confidence            33455678999999999999999999999985

Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm

>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C

Probab=89.15  E-value=0.19  Score=45.32  Aligned_cols=29  Identities=14%  Similarity=0.017  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|||.++.|||
T Consensus       100 ~~~~qi~~~l~~lH~~~ivH~dlkp~Nil  128 (329)
T cd05588         100 FYSAEISLALNFLHERGIIYRDLKLDNVL  128 (329)
T ss_pred             HHHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            44578999999999999999999999986

Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl

>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5

Probab=89.11  E-value=0.19  Score=43.13  Aligned_cols=32  Identities=6%  Similarity=-0.035  Sum_probs=27.8

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +..+...+|+.+|.+||++.|+|+|.++.||+
T Consensus       100 ~~~~~~~qi~~al~~LH~~~i~H~dl~~~nil  131 (284)
T cd07839         100 IVKSFMFQLLKGLAFCHSHNVLHRDLKPQNLL  131 (284)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEecCCCCHHHEE
Confidence            33456688999999999999999999999985

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2

Probab=89.09  E-value=0.17  Score=44.39  Aligned_cols=28  Identities=14%  Similarity=0.105  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|+|.++.|||
T Consensus       142 ~~~qi~~al~~LH~~givH~dlkp~Nil  169 (304)
T cd05101         142 CTYQVARGMEYLASQKCIHRDLAARNVL  169 (304)
T ss_pred             HHHHHHHHHHHHHHCCeeecccccceEE
Confidence            3568999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase

Probab=89.08  E-value=0.17  Score=42.94  Aligned_cols=28  Identities=14%  Similarity=0.143  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.+++||+
T Consensus       107 ~~~~i~~~l~~lH~~~i~H~dlkp~nil  134 (256)
T cd05082         107 FSLDVCEAMEYLEANNFVHRDLAARNVL  134 (256)
T ss_pred             HHHHHHHHHHHHHhCCEeccccchheEE
Confidence            3468899999999999999999999986

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re

>PTZ00267 NIMA-related protein kinase; Provisional

Probab=89.06  E-value=0.17  Score=48.80  Aligned_cols=28  Identities=18%  Similarity=0.165  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       174 i~~qi~~aL~~lH~~~ivHrDlkp~NIl  201 (478)
T PTZ00267        174 LFYQIVLALDEVHSRKMMHRDLKSANIF  201 (478)
T ss_pred             HHHHHHHHHHHHHhCCEEECCcCHHhEE
Confidence            3468999999999999999999999995

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B

Probab=89.06  E-value=0.18  Score=43.93  Aligned_cols=31  Identities=13%  Similarity=0.073  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.+++|||
T Consensus       122 ~~~~~~ql~~aL~~lH~~~i~H~dlkp~Nil  152 (288)
T cd05093         122 MLHIAQQIAAGMVYLASQHFVHRDLATRNCL  152 (288)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeecccCcceEE
Confidence            3445678999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly

>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase

Probab=89.03  E-value=0.18  Score=42.85  Aligned_cols=29  Identities=10%  Similarity=0.125  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus        99 ~i~~qi~~al~~lH~~~i~H~dlkp~nil  127 (257)
T cd05116          99 ELVHQVSMGMKYLEETNFVHRDLAARNVL  127 (257)
T ss_pred             HHHHHHHHHHHHHHHCCEeecccchhhEE
Confidence            34568999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase

Probab=88.98  E-value=0.2  Score=42.79  Aligned_cols=28  Identities=11%  Similarity=0.237  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|++.+++||+
T Consensus       113 ~~~qi~~al~~lH~~~i~h~dl~p~nil  140 (268)
T cd06624         113 YTKQILEGLKYLHDNQIVHRDIKGDNVL  140 (268)
T ss_pred             HHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            3468999999999999999999999987

Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina

>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5

Probab=88.97  E-value=0.2  Score=44.17  Aligned_cols=29  Identities=17%  Similarity=0.232  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       122 ~~~~qi~~~l~~LH~~~ivH~dlkp~Nil  150 (292)
T cd06658         122 TVCLSVLRALSYLHNQGVIHRDIKSDSIL  150 (292)
T ss_pred             HHHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            45578999999999999999999999986

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express

>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1

Probab=88.95  E-value=0.19  Score=43.57  Aligned_cols=31  Identities=6%  Similarity=0.073  Sum_probs=27.1

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.|||
T Consensus       108 ~~~i~~qi~~aL~~LH~~~i~H~dl~p~nil  138 (293)
T cd07843         108 VKCLMLQLLSGVAHLHDNWILHRDLKTSNLL  138 (293)
T ss_pred             HHHHHHHHHHHHHHHHHCCeeeccCCHHHEE
Confidence            3345578999999999999999999999985

Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the

>PTZ00283 serine/threonine protein kinase; Provisional

Probab=88.95  E-value=0.19  Score=49.21  Aligned_cols=28  Identities=11%  Similarity=0.152  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|++|||
T Consensus       148 i~~qll~aL~~lH~~~IiHrDLKP~NIL  175 (496)
T PTZ00283        148 LFIQVLLAVHHVHSKHMIHRDIKSANIL  175 (496)
T ss_pred             HHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            3468999999999999999999999985

>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase

Probab=88.94  E-value=0.22  Score=43.15  Aligned_cols=29  Identities=7%  Similarity=0.037  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.|||
T Consensus       107 ~~~~qi~~~L~~lH~~~i~H~dlkp~Nil  135 (291)
T cd07870         107 LFMFQLLRGLAYIHGQHILHRDLKPQNLL  135 (291)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCChHHEE
Confidence            34578999999999999999999999986

Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess

>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha

Probab=88.92  E-value=0.2  Score=45.03  Aligned_cols=30  Identities=13%  Similarity=0.009  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|+++.|||
T Consensus       104 ~~i~~qi~~al~~lH~~~ivHrDikp~Nil  133 (323)
T cd05615         104 VFYAAEISVGLFFLHRRGIIYRDLKLDNVM  133 (323)
T ss_pred             HHHHHHHHHHHHHHHHCCeeccCCCHHHeE
Confidence            344578999999999999999999999985

Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A

Probab=88.74  E-value=0.2  Score=43.35  Aligned_cols=29  Identities=14%  Similarity=0.069  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||+..|+|+|.++.|||
T Consensus       126 ~~~~qi~~al~~LH~~~i~H~dlkp~nil  154 (280)
T cd05092         126 AIASQIASGMVYLASLHFVHRDLATRNCL  154 (280)
T ss_pred             HHHHHHHHHHHHHHHCCeecccccHhhEE
Confidence            34578999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4

Probab=88.74  E-value=0.2  Score=42.73  Aligned_cols=32  Identities=3%  Similarity=-0.105  Sum_probs=27.9

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|.+||++.|+|+|.++.||+
T Consensus       101 ~~~~~~~ql~~~l~~LH~~~i~H~dl~p~nil  132 (286)
T cd07847         101 LIKKIIWQTLQAVNFCHKHNCIHRDVKPENIL  132 (286)
T ss_pred             HHHHHHHHHHHHHHHHHHCCceecCCChhhEE
Confidence            34455678999999999999999999999987

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1

Probab=88.73  E-value=0.17  Score=43.58  Aligned_cols=29  Identities=17%  Similarity=0.139  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.+++|||
T Consensus       128 ~i~~~i~~al~~lH~~~i~H~dlkp~nil  156 (283)
T cd05090         128 HIAIQIAAGMEYLSSHFFVHKDLAARNIL  156 (283)
T ss_pred             HHHHHHHHHHHHHHhcCeehhccccceEE
Confidence            34578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit

Probab=88.56  E-value=0.21  Score=46.27  Aligned_cols=29  Identities=21%  Similarity=0.107  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       218 ~~~~qi~~~l~~lH~~~ivH~Dlkp~Nil  246 (375)
T cd05104         218 SFSYQVAKGMSFLASKNCIHRDLAARNIL  246 (375)
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCchhhEE
Confidence            44578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce

>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7

Probab=88.55  E-value=0.2  Score=43.51  Aligned_cols=28  Identities=11%  Similarity=0.106  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||+..|+|+|+++.|||
T Consensus       100 ~~~qi~~al~~lH~~~ivH~dikp~Nil  127 (277)
T cd05607         100 YSAQITCGILHLHSMDIVYRDMKPENVL  127 (277)
T ss_pred             HHHHHHHHHHHHHHCCEEEccCChHhEE
Confidence            3468999999999999999999999987

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors

Probab=88.49  E-value=0.2  Score=45.59  Aligned_cols=29  Identities=21%  Similarity=0.118  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       177 ~~~~qi~~aL~~lH~~~ivHrDikp~Nil  205 (337)
T cd05054         177 SYSFQVARGMEFLASRKCIHRDLAARNIL  205 (337)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCcceEE
Confidence            34478999999999999999999999984

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4

Probab=88.27  E-value=0.21  Score=43.95  Aligned_cols=29  Identities=14%  Similarity=0.168  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       113 ~~~~qi~~~L~~LH~~~ivH~dikp~Nil  141 (303)
T cd05110         113 NWCVQIAKGMMYLEERRLVHRDLAARNVL  141 (303)
T ss_pred             HHHHHHHHHHHHHhhcCeeccccccceee
Confidence            34568999999999999999999999986

Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors

Probab=88.18  E-value=0.18  Score=44.65  Aligned_cols=30  Identities=17%  Similarity=0.109  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.+++|||
T Consensus       144 ~~i~~~i~~~l~~lH~~~ivH~dlkp~Nil  173 (302)
T cd05055         144 LSFSYQVAKGMAFLASKNCIHRDLAARNVL  173 (302)
T ss_pred             HHHHHHHHHHHHHHHHCCeehhhhccceEE
Confidence            345578999999999999999999999975

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept

>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase

Probab=88.18  E-value=0.21  Score=42.06  Aligned_cols=28  Identities=21%  Similarity=0.247  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.+++||+
T Consensus       102 ~~~qi~~~L~~lH~~~i~H~di~p~nil  129 (257)
T cd05040         102 YAVQIANGMRYLESKRFIHRDLAARNIL  129 (257)
T ss_pred             HHHHHHHHHHHHHhCCccccccCcccEE
Confidence            3468999999999999999999999976

Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and

>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa

Probab=88.16  E-value=0.2  Score=42.92  Aligned_cols=29  Identities=10%  Similarity=0.132  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.+++|||
T Consensus        99 ~~~~~i~~~l~~lH~~~i~H~dlkp~nil  127 (257)
T cd05115          99 ELMHQVSMGMKYLEGKNFVHRDLAARNVL  127 (257)
T ss_pred             HHHHHHHHHHHHHHhcCeeecccchheEE
Confidence            34568999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho

>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription]

Probab=88.15  E-value=0.17  Score=49.75  Aligned_cols=27  Identities=15%  Similarity=0.084  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      --+|++++.|||+.=|+|||.|+||||
T Consensus       138 lwQil~Gv~YLH~NWvlHRDLKPaNIl  164 (438)
T KOG0666|consen  138 LWQILDGVHYLHSNWVLHRDLKPANIL  164 (438)
T ss_pred             HHHHHhhhHHHhhhheeeccCCcceEE
Confidence            358999999999999999999999997

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2

Probab=88.15  E-value=0.23  Score=43.93  Aligned_cols=31  Identities=13%  Similarity=0.104  Sum_probs=27.2

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .....+|+.+|++||+..|+|+|.+++|||=
T Consensus       127 ~~~~~qi~~al~~LH~~gi~H~dlkp~Nili  157 (303)
T cd05088         127 LHFAADVARGMDYLSQKQFIHRDLAARNILV  157 (303)
T ss_pred             HHHHHHHHHHHHHHHhCCccccccchheEEe
Confidence            3456789999999999999999999999874

Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2

Probab=88.12  E-value=0.21  Score=43.56  Aligned_cols=29  Identities=17%  Similarity=0.111  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       134 ~~~~~i~~al~~lH~~~i~H~dlkp~Nil  162 (296)
T cd05095         134 FMATQIASGMKYLSSLNFVHRDLATRNCL  162 (296)
T ss_pred             HHHHHHHHHHHHHHHCCeecccCChheEE
Confidence            34578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit

>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair]

Probab=88.05  E-value=0.15  Score=48.94  Aligned_cols=40  Identities=5%  Similarity=-0.079  Sum_probs=35.0

Q ss_pred             CCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          213 SDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       213 ~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.+++.+++--+-...++.+|.|||.+-|.|||.|++|+|
T Consensus        94 ~~i~l~pa~iK~y~~m~LkGl~y~H~~~IlHRDlKPnNLL  133 (318)
T KOG0659|consen   94 KNIILSPADIKSYMLMTLKGLAYCHSKWILHRDLKPNNLL  133 (318)
T ss_pred             cccccCHHHHHHHHHHHHHHHHHHHhhhhhcccCCccceE
Confidence            4445677777888899999999999999999999999987

>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1

Probab=88.04  E-value=0.25  Score=41.75  Aligned_cols=29  Identities=10%  Similarity=0.140  Sum_probs=26.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|++||++.|+|+++++.+|+-
T Consensus       108 ~~~ql~~al~~LH~~~i~H~~i~~~nil~  136 (268)
T cd06630         108 YTEQLLRGLSYLHENQIIHRDVKGANLLI  136 (268)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEEE
Confidence            35899999999999999999999999873

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their

>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms]

Probab=88.04  E-value=0.24  Score=48.40  Aligned_cols=35  Identities=17%  Similarity=0.275  Sum_probs=30.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH------------hhhhcccc
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT------------GICRLSRD  260 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~------------~ic~l~~~  260 (264)
                      ..+|+-.|.+||++.|++||.|+-|||            |+||..-+
T Consensus       131 laEi~lAL~~LH~~gIiyRDlKPENILLd~~GHi~LtDFgL~k~~~~  177 (357)
T KOG0598|consen  131 LAEIVLALGYLHSKGIIYRDLKPENILLDEQGHIKLTDFGLCKEDLK  177 (357)
T ss_pred             HHHHHHHHHHHHhCCeeeccCCHHHeeecCCCcEEEeccccchhccc
Confidence            357999999999999999999999995            77775544

>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3

Probab=88.00  E-value=0.26  Score=41.89  Aligned_cols=29  Identities=17%  Similarity=0.079  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.||+
T Consensus       110 ~~~~~i~~~l~~lH~~~i~H~dlkp~nil  138 (267)
T cd06645         110 YVSRETLQGLYYLHSKGKMHRDIKGANIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34568999999999999999999999986

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated

>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein

Probab=87.99  E-value=0.2  Score=43.54  Aligned_cols=30  Identities=17%  Similarity=0.141  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+-..+|+.+|.+||+..|+|+|++++|||
T Consensus       130 ~~i~~~i~~~l~~LH~~~ivH~dikp~nil  159 (290)
T cd05045         130 ISFAWQISRGMQYLAEMKLVHRDLAARNVL  159 (290)
T ss_pred             HHHHHHHHHHHHHHHHCCeehhhhhhheEE
Confidence            345578999999999999999999999984

Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi

>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases

Probab=87.87  E-value=0.25  Score=42.63  Aligned_cols=29  Identities=3%  Similarity=-0.040  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.+||
T Consensus       107 ~~~~ql~~al~~lH~~~i~H~dl~p~nil  135 (291)
T cd07844         107 LFLFQLLRGLAYCHQRRVLHRDLKPQNLL  135 (291)
T ss_pred             HHHHHHHHHHHHHHhCCeecccCCHHHEE
Confidence            34568999999999999999999999986

Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the

>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases

Probab=87.86  E-value=0.25  Score=41.97  Aligned_cols=29  Identities=7%  Similarity=0.021  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|+|.++.+|+
T Consensus       102 ~~~~~i~~~l~~LH~~~i~H~dl~p~nil  130 (283)
T cd05118         102 SYLYQLLQGLAFCHSHGILHRDLKPENLL  130 (283)
T ss_pred             HHHHHHHHHHHHHHHCCeeecCcCHHHEE
Confidence            34578999999999999999999999986

Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2

Probab=87.78  E-value=0.21  Score=45.22  Aligned_cols=29  Identities=17%  Similarity=0.098  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|+|+++.|||
T Consensus       183 ~~~~qi~~al~~lH~~~i~H~dikp~Nil  211 (343)
T cd05103         183 CYSFQVAKGMEFLASRKCIHRDLAARNIL  211 (343)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCccCeEE
Confidence            34568999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp

>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases

Probab=87.72  E-value=0.26  Score=44.21  Aligned_cols=28  Identities=7%  Similarity=0.097  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       111 i~~ql~~aL~~LH~~~ivH~dlkp~Nil  138 (336)
T cd07849         111 FLYQILRGLKYIHSANVLHRDLKPSNLL  138 (336)
T ss_pred             HHHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            3468999999999999999999999986

Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases

Probab=87.67  E-value=0.24  Score=42.24  Aligned_cols=31  Identities=16%  Similarity=0.082  Sum_probs=27.4

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.||+
T Consensus       124 ~~~~~~~i~~~l~~lH~~~i~h~dlkp~nil  154 (280)
T cd05049         124 LLQIAVQIASGMVYLASQHFVHRDLATRNCL  154 (280)
T ss_pred             HHHHHHHHHHHHHHHhhCCeeccccccceEE
Confidence            3445688999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)

Probab=87.63  E-value=0.23  Score=42.63  Aligned_cols=28  Identities=14%  Similarity=0.113  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++++||
T Consensus       122 i~~~i~~~l~~LH~~~i~H~di~p~nil  149 (280)
T cd05043         122 MAIQIACGMSYLHKRGVIHKDIAARNCV  149 (280)
T ss_pred             HHHHHHHHHHHHHHCCEeecccCHhhEE
Confidence            4458999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It

>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain

Probab=87.60  E-value=0.26  Score=41.63  Aligned_cols=30  Identities=10%  Similarity=0.094  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+..|.+||. +.|+|+|.+++||+
T Consensus       120 ~~i~~~l~~~l~~lH~~~givHrDlkP~NIl  150 (190)
T cd05145         120 EELYEQVVEQMRRLYQEAGLVHGDLSEYNIL  150 (190)
T ss_pred             HHHHHHHHHHHHHHHHhCCEecCCCChhhEE
Confidence            3445789999999999 99999999999987

The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro

>PRK10345 hypothetical protein; Provisional

Probab=87.53  E-value=0.26  Score=43.70  Aligned_cols=27  Identities=15%  Similarity=0.149  Sum_probs=24.2

Q ss_pred             hHHHHHHh-hhhccccccccCcchhhhH
Q 024658          226 STAIISSL-RGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl-~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+++..| ++||.+.|+|+|.|++|||
T Consensus       110 ~~~~L~~l~~yLh~~~IvhrDlKp~NIL  137 (210)
T PRK10345        110 LRQLLKKLKRYLLDNRIVTMELKPQNIL  137 (210)
T ss_pred             HHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            46778777 8999999999999999997

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor

Probab=87.50  E-value=0.27  Score=42.29  Aligned_cols=27  Identities=15%  Similarity=0.117  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||
T Consensus       125 ~~~l~~~l~~lH~~~~vH~dlkp~Nil  151 (277)
T cd05062         125 AGEIADGMAYLNANKFVHRDLAARNCM  151 (277)
T ss_pred             HHHHHHHHHHHHHCCcccCCcchheEE
Confidence            457999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh

>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins

Probab=87.48  E-value=0.28  Score=40.87  Aligned_cols=29  Identities=14%  Similarity=0.109  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|+|+++.||+
T Consensus        97 ~i~~qi~~~L~~lH~~~i~H~di~~~nil  125 (265)
T cd05579          97 IYIAEIVLALEYLHSNGIIHRDLKPDNIL  125 (265)
T ss_pred             HHHHHHHHHHHHHHHcCeecCCCCHHHeE
Confidence            44578999999999999999999999987

Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re

>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron

Probab=87.47  E-value=0.26  Score=41.65  Aligned_cols=27  Identities=11%  Similarity=0.113  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||
T Consensus       104 ~~~i~~~l~~lH~~~i~H~dlk~~nil  130 (262)
T cd05058         104 GLQVAKGMEYLASKKFVHRDLAARNCM  130 (262)
T ss_pred             HHHHHHHHHHHHhCCccccccCcceEE
Confidence            358999999999999999999999976

Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca

>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases

Probab=87.42  E-value=0.28  Score=42.86  Aligned_cols=29  Identities=14%  Similarity=0.141  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.||+
T Consensus       106 ~~~~qi~~~l~~lH~~~ivH~dlkp~Nil  134 (285)
T cd05605         106 FYAAEITCGLEDLHRERIVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHHCCcEecCCCHHHEE
Confidence            34578999999999999999999999987

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5,

>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6

Probab=87.42  E-value=0.27  Score=43.08  Aligned_cols=29  Identities=14%  Similarity=0.140  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.|||
T Consensus       106 ~~~~qi~~~l~~lH~~~iiH~dikp~Nil  134 (285)
T cd05630         106 FYAAEICCGLEDLHQERIVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHhCCEEeCCCCHHHEE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as

>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases

Probab=87.41  E-value=0.28  Score=42.69  Aligned_cols=28  Identities=14%  Similarity=0.060  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       113 i~~qi~~~l~~lH~~~i~h~dlkp~Nil  140 (316)
T cd07842         113 LLWQILNGVHYLHSNWVLHRDLKPANIL  140 (316)
T ss_pred             HHHHHHHHHHHHHhCCEeeCCCCHHHEE
Confidence            3468999999999999999999999986

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases

Probab=87.40  E-value=0.29  Score=41.59  Aligned_cols=30  Identities=23%  Similarity=0.137  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       112 ~~~~~~l~~aL~~lH~~~i~H~dl~p~nil  141 (284)
T cd05038         112 LLFSSQICKGMDYLGSQRYIHRDLAARNIL  141 (284)
T ss_pred             HHHHHHHHHHHHHHHhCCeecCCCCHHhEE
Confidence            345578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase

Probab=87.39  E-value=0.23  Score=42.87  Aligned_cols=29  Identities=10%  Similarity=0.022  Sum_probs=26.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||=
T Consensus       121 ~~~qi~~~l~~LH~~~ivH~dlkp~nil~  149 (277)
T cd05036         121 CARDVAKGCKYLEENHFIHRDIAARNCLL  149 (277)
T ss_pred             HHHHHHHHHHHHHHCCEeecccchheEEE
Confidence            45689999999999999999999999873

Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases

Probab=87.39  E-value=0.25  Score=42.08  Aligned_cols=28  Identities=14%  Similarity=0.112  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|+|+++.+||
T Consensus       124 ~~~~i~~~l~~lH~~~i~H~di~p~nil  151 (277)
T cd05032         124 MAAEIADGMAYLAAKKFVHRDLAARNCM  151 (277)
T ss_pred             HHHHHHHHHHHHHhCCccccccChheEE
Confidence            3468999999999999999999999975

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological

>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase

Probab=87.38  E-value=0.26  Score=50.14  Aligned_cols=29  Identities=7%  Similarity=0.060  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+|+.|||
T Consensus       108 ~i~~qil~aL~yLH~~gIiHrDLKP~NIL  136 (669)
T cd05610         108 KYISEVALALDYLHRHGIIHRDLKPDNML  136 (669)
T ss_pred             HHHHHHHHHHHHHHhCCEEeCCccHHHEE
Confidence            34578999999999999999999999996

Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]

Probab=87.34  E-value=0.31  Score=46.45  Aligned_cols=26  Identities=12%  Similarity=0.081  Sum_probs=22.7

Q ss_pred             HHHHHHhhhhcccc---ccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQT---MTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~---i~~~d~~~a~i~  252 (264)
                      ..|-.+|.|||+..   |||||+|++|||
T Consensus       181 ~g~A~gL~yLH~~~~~~iiHrDiKssNIL  209 (361)
T KOG1187|consen  181 LGAARGLAYLHEGCPPPIIHRDIKSSNIL  209 (361)
T ss_pred             HHHHHHHHHHccCCCCCEecCCCCHHHee
Confidence            45667999999966   999999999997

>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]

Probab=87.32  E-value=0.25  Score=49.64  Aligned_cols=26  Identities=19%  Similarity=0.217  Sum_probs=24.9

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.++.+|++||++..||||+|+||||
T Consensus       118 re~l~~l~ylH~~~kiHrDIKaanil  143 (467)
T KOG0201|consen  118 REVLKGLDYLHSEKKIHRDIKAANIL  143 (467)
T ss_pred             HHHHHHhhhhhhcceeccccccccee
Confidence            78899999999999999999999997

>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases

Probab=87.29  E-value=0.31  Score=41.11  Aligned_cols=29  Identities=14%  Similarity=0.195  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||...|+|+|.++.||+
T Consensus       108 ~~~~~l~~~l~~lH~~~i~H~dl~p~nil  136 (263)
T cd06625         108 KYTRQILEGVEYLHSNMIVHRDIKGANIL  136 (263)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999987

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t

>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases

Probab=87.24  E-value=0.31  Score=41.22  Aligned_cols=28  Identities=4%  Similarity=0.137  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|++.++.+|+
T Consensus       102 i~~qi~~aL~~lH~~~i~H~dl~p~nil  129 (260)
T cd05611         102 YIAEVVLGVEDLHQRGIIHRDIKPENLL  129 (260)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            3478999999999999999999999986

Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do

>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7

Probab=87.24  E-value=0.3  Score=42.38  Aligned_cols=29  Identities=10%  Similarity=0.038  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       106 ~~~~qi~~al~~lH~~~i~H~dl~p~nil  134 (298)
T cd07841         106 SYMLMTLRGLEYLHSNWILHRDLKPNNLL  134 (298)
T ss_pred             HHHHHHHHHHHHHHhCCeeecCCChhhEE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases

Probab=87.24  E-value=0.23  Score=41.91  Aligned_cols=29  Identities=10%  Similarity=0.145  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       106 ~~~~qi~~~l~~lh~~~i~H~di~p~Nil  134 (256)
T cd05039         106 GFALDVCEGMEYLEEKNFVHRDLAARNVL  134 (256)
T ss_pred             HHHHHHHHHHHHHHhCCccchhcccceEE
Confidence            34468999999999999999999999986

Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk

>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4

Probab=87.23  E-value=0.28  Score=41.17  Aligned_cols=30  Identities=13%  Similarity=0.119  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+-..+|+.+|.+||++.|+|+|++++||+
T Consensus       105 ~~~~~~l~~~l~~lH~~~i~H~di~p~nil  134 (257)
T cd08223         105 VEWFVQIAMALQYLHEKHILHRDLKTQNVF  134 (257)
T ss_pred             HHHHHHHHHHHHHHHhCCeeccCCCchhEE
Confidence            344578999999999999999999999985

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.

>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase

Probab=87.10  E-value=0.3  Score=42.51  Aligned_cols=29  Identities=21%  Similarity=0.170  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|++++||+
T Consensus       101 ~~~~ql~~~l~~lH~~~i~H~di~p~nil  129 (278)
T cd05606         101 FYAAEIILGLEHMHNRFVVYRDLKPANIL  129 (278)
T ss_pred             HHHHHHHHHHHHHHHCCEEcCCCCHHHEE
Confidence            44578999999999999999999999986

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases

Probab=87.08  E-value=0.29  Score=41.61  Aligned_cols=29  Identities=10%  Similarity=0.109  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       104 ~i~~qi~~~l~~lH~~~i~H~dl~p~ni~  132 (256)
T cd05059         104 DMCSDVCEAMEYLESNGFIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHHCCcccccccHhhEE
Confidence            34578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows

>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8

Probab=87.01  E-value=0.32  Score=40.73  Aligned_cols=27  Identities=11%  Similarity=0.142  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|++||++.|+|++.++.+|+
T Consensus       107 ~~~i~~~l~~lh~~~i~h~dl~~~nil  133 (256)
T cd08220         107 FVQILLALHHVHTKLILHRDLKTQNIL  133 (256)
T ss_pred             HHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            468999999999999999999999988

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase

Probab=86.95  E-value=0.32  Score=41.33  Aligned_cols=28  Identities=11%  Similarity=0.177  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.||+
T Consensus       116 ~~~qi~~~l~~LH~~~ivh~dl~~~nil  143 (272)
T cd06637         116 ICREILRGLSHLHQHKVIHRDIKGQNVL  143 (272)
T ss_pred             HHHHHHHHHHHHHHCCCccCCCCHHHEE
Confidence            4468999999999999999999999985

Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ

>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase

Probab=86.90  E-value=0.34  Score=42.43  Aligned_cols=28  Identities=4%  Similarity=-0.007  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       109 ~~~qi~~aL~~lH~~~i~H~dlkp~Nil  136 (301)
T cd07873         109 FLFQLLRGLNYCHRRKVLHRDLKPQNLL  136 (301)
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCCHHHEE
Confidence            4578999999999999999999999986

Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl

>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5

Probab=86.90  E-value=0.34  Score=41.22  Aligned_cols=29  Identities=14%  Similarity=0.069  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.||+
T Consensus       110 ~~~~qi~~~l~~lH~~~i~H~dl~p~nil  138 (267)
T cd06646         110 YVCRETLQGLAYLHSKGKMHRDIKGANIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            45578999999999999999999999985

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated

>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros

Probab=86.89  E-value=0.28  Score=41.59  Aligned_cols=29  Identities=10%  Similarity=-0.026  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|++||++.|+|+|.++.+|+
T Consensus       110 ~~~~~l~~~l~~lH~~~i~H~dl~p~nil  138 (269)
T cd05044         110 DICLDVAKGCVYLEQMHFIHRDLAARNCL  138 (269)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCChheEE
Confidence            34468899999999999999999999987

Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3

Probab=86.85  E-value=0.28  Score=43.96  Aligned_cols=28  Identities=14%  Similarity=0.087  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhHh
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||=
T Consensus       140 ~~qi~~al~~LH~~givH~dlkp~Nill  167 (334)
T cd05100         140 AYQVARGMEYLASQKCIHRDLAARNVLV  167 (334)
T ss_pred             HHHHHHHHHHHHHCCeeccccccceEEE
Confidence            4689999999999999999999999863

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk

Probab=86.79  E-value=0.33  Score=41.20  Aligned_cols=29  Identities=14%  Similarity=0.137  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +-..+|+.+|++||+..|+|+|.+++||+
T Consensus       106 ~i~~~i~~al~~LH~~~i~H~dl~p~ni~  134 (260)
T cd05067         106 DMAAQIAEGMAFIERKNYIHRDLRAANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHhcCCeecccccHHhEE
Confidence            34568999999999999999999999975

Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr

>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases

Probab=86.74  E-value=0.28  Score=41.22  Aligned_cols=28  Identities=14%  Similarity=0.057  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus        98 ~~~~~~~~l~~lH~~~i~h~di~p~nil  125 (251)
T cd05041          98 MSLDAAAGMEYLESKNCIHRDLAARNCL  125 (251)
T ss_pred             HHHHHHHHHHHHHhCCEehhhcCcceEE
Confidence            3467889999999999999999999986

Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k

>PRK09188 serine/threonine protein kinase; Provisional

Probab=86.73  E-value=0.28  Score=47.31  Aligned_cols=29  Identities=14%  Similarity=0.083  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCc-chhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGD-AAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~-~~a~i~  252 (264)
                      +...+|+.+|.+||++.|+|||. |++|||
T Consensus       115 ~~~~~i~~aL~~lH~~gIiHrDL~KP~NIL  144 (365)
T PRK09188        115 AWFRSAHRALRDLHRAGITHNDLAKPQNWL  144 (365)
T ss_pred             HHHHHHHHHHHHHHHCCCeeCCCCCcceEE
Confidence            34578999999999999999999 999987

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor

Probab=86.68  E-value=0.3  Score=42.47  Aligned_cols=27  Identities=15%  Similarity=0.148  Sum_probs=24.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||.+.|+|+|.++.|||
T Consensus       125 ~~~l~~~l~~lH~~~i~H~dikp~nil  151 (288)
T cd05061         125 AAEIADGMAYLNAKKFVHRDLAARNCM  151 (288)
T ss_pred             HHHHHHHHHHHHhCCCcCCCCChheEE
Confidence            357889999999999999999999985

Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta

>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6

Probab=86.65  E-value=0.34  Score=42.76  Aligned_cols=30  Identities=13%  Similarity=0.189  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+...+|+.+|.+||++.|+|+|.++.||+
T Consensus       120 ~~~~~qi~~~L~~LH~~~ivH~dl~p~Nil  149 (297)
T cd06659         120 ATVCESVLQALCYLHSQGVIHRDIKSDSIL  149 (297)
T ss_pred             HHHHHHHHHHHHHHHhCCeecCCCCHHHeE
Confidence            345678999999999999999999999985

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i

>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains

Probab=86.63  E-value=0.31  Score=40.80  Aligned_cols=28  Identities=11%  Similarity=0.088  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       106 i~~~l~~al~~lH~~~i~h~dl~~~nil  133 (256)
T cd08529         106 FFIQILLGLAHLHSKKILHRDIKSLNLF  133 (256)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCcceEE
Confidence            3468999999999999999999999986

Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome

Probab=86.53  E-value=0.3  Score=41.73  Aligned_cols=29  Identities=10%  Similarity=0.092  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.++.|||
T Consensus       104 ~~~~~i~~~l~~lH~~~i~H~dl~p~nil  132 (256)
T cd05113         104 EMCKDVCEGMAYLESKQFIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHhCCeeccccCcceEE
Confidence            45578999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds

>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases

Probab=86.51  E-value=0.36  Score=41.23  Aligned_cols=28  Identities=14%  Similarity=0.194  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|++.+++||+
T Consensus       111 ~~~~i~~al~~LH~~~i~H~dl~p~ni~  138 (264)
T cd06653         111 YTRQILQGVSYLHSNMIVHRDIKGANIL  138 (264)
T ss_pred             HHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            4478999999999999999999999987

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk

Probab=86.43  E-value=0.29  Score=41.33  Aligned_cols=28  Identities=18%  Similarity=0.147  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.||+
T Consensus       109 ~~~~i~~al~~lH~~~i~h~dl~~~nil  136 (261)
T cd05148         109 MACQVAEGMAYLEEQNSIHRDLAARNIL  136 (261)
T ss_pred             HHHHHHHHHHHHHHCCeeccccCcceEE
Confidence            4468899999999999999999999875

Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase

Probab=86.42  E-value=0.3  Score=41.71  Aligned_cols=29  Identities=17%  Similarity=0.147  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.+++|||
T Consensus       111 ~~~~~l~~~l~~lH~~~~~H~dl~p~nil  139 (270)
T cd05056         111 LYSYQLSTALAYLESKRFVHRDIAARNVL  139 (270)
T ss_pred             HHHHHHHHHHHHHHhCCeeccccChheEE
Confidence            34568999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions

>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6

Probab=86.40  E-value=0.36  Score=41.52  Aligned_cols=27  Identities=11%  Similarity=0.196  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|++.++.||+
T Consensus       127 ~~qi~~al~~LH~~~ivH~dl~~~nil  153 (282)
T cd06636         127 CREILRGLAHLHAHKVIHRDIKGQNVL  153 (282)
T ss_pred             HHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            457999999999999999999999976

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases

Probab=86.37  E-value=0.41  Score=40.27  Aligned_cols=29  Identities=10%  Similarity=0.044  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|++.++++|+
T Consensus       117 ~~~~ql~~al~~lH~~~i~H~~l~p~ni~  145 (275)
T cd06608         117 YILRETLRGLAYLHENKVIHRDIKGQNIL  145 (275)
T ss_pred             HHHHHHHHHHHHHhcCCcccCCCCHHHEE
Confidence            34578999999999999999999999987

Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I

>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases

Probab=86.34  E-value=0.37  Score=40.94  Aligned_cols=32  Identities=13%  Similarity=0.131  Sum_probs=27.9

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|++||++.|+|++.++.||+
T Consensus       101 ~~~~i~~~i~~al~~LH~~~~~h~dl~p~nil  132 (287)
T cd07840         101 QIKCYMKQLLEGLQYLHSNGILHRDIKGSNIL  132 (287)
T ss_pred             HHHHHHHHHHHHHHHHHHCCceeccCcHHHeE
Confidence            34456688999999999999999999999986

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po

>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase

Probab=86.33  E-value=0.34  Score=43.84  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       123 ~~~ql~~aL~~LH~~gi~H~dlkp~Nil  150 (353)
T cd07850         123 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  150 (353)
T ss_pred             HHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            3578999999999999999999999986

Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7

Probab=86.31  E-value=0.37  Score=40.82  Aligned_cols=28  Identities=11%  Similarity=0.139  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       111 ~~~~i~~~l~~LH~~~i~H~dl~p~nil  138 (267)
T cd08229         111 YFVQLCSALEHMHSRRVMHRDIKPANVF  138 (267)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            3568999999999999999999999985

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.

>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases

Probab=86.27  E-value=0.3  Score=41.99  Aligned_cols=29  Identities=14%  Similarity=0.129  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|+++.|||
T Consensus       116 ~~~~~i~~al~~lH~~~i~H~dikp~nil  144 (270)
T cd05047         116 HFAADVARGMDYLSQKQFIHRDLAARNIL  144 (270)
T ss_pred             HHHHHHHHHHHHHHHCCEeecccccceEE
Confidence            34467889999999999999999999987

Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase

Probab=86.24  E-value=0.34  Score=41.89  Aligned_cols=29  Identities=7%  Similarity=0.079  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       134 ~~~~~i~~aL~~lH~~~i~H~dl~p~nil  162 (288)
T cd05050         134 CIAKQVAAGMAYLSERKFVHRDLATRNCL  162 (288)
T ss_pred             HHHHHHHHHHHHHHhCCeecccccHhheE
Confidence            45678999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M

>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5

Probab=86.22  E-value=0.36  Score=43.27  Aligned_cols=29  Identities=3%  Similarity=0.067  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|++.++.|||
T Consensus       111 ~i~~qi~~aL~~LH~~~ivH~dlkp~Nil  139 (334)
T cd07855         111 YFLYQLLRGLKYIHSANVIHRDLKPSNLL  139 (334)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34578999999999999999999999986

Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the

>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases

Probab=86.18  E-value=0.32  Score=41.24  Aligned_cols=30  Identities=10%  Similarity=0.078  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .-..+|+.+|.+||+..|+|+|.++.|||-
T Consensus        99 ~~~~qi~~~l~~lh~~~i~H~di~p~nili  128 (257)
T cd05060          99 ELAHQVAMGMAYLESKHFVHRDLAARNVLL  128 (257)
T ss_pred             HHHHHHHHHHHHHhhcCeeccCcccceEEE
Confidence            445789999999999999999999999873

Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5

Probab=86.17  E-value=0.36  Score=41.79  Aligned_cols=28  Identities=11%  Similarity=0.127  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       100 ~~~qi~~~l~~lH~~~i~H~dlkp~Nil  127 (279)
T cd06619         100 IAVAVVKGLTYLWSLKILHRDVKPSNML  127 (279)
T ss_pred             HHHHHHHHHHHHHHCCEeeCCCCHHHEE
Confidence            4578999999999999999999999986

Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p

>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9

Probab=86.11  E-value=0.36  Score=41.72  Aligned_cols=29  Identities=14%  Similarity=0.155  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.||+
T Consensus       123 ~i~~qi~~al~~lH~~~i~H~dl~p~nil  151 (310)
T cd07865         123 KVMKMLLNGLYYIHRNKILHRDMKAANIL  151 (310)
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            34578999999999999999999999984

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases

Probab=86.09  E-value=0.36  Score=42.10  Aligned_cols=28  Identities=14%  Similarity=0.114  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.+++||+
T Consensus       134 i~~~i~~al~~lH~~~i~H~dlkp~Nil  161 (295)
T cd05097         134 MAVQIASGMKYLASLNFVHRDLATRNCL  161 (295)
T ss_pred             HHHHHHHHHHHHHhcCeeccccChhhEE
Confidence            4578999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including

>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10

Probab=85.99  E-value=0.37  Score=42.32  Aligned_cols=30  Identities=7%  Similarity=0.081  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||+..|+|+|.++.|||
T Consensus       111 ~~~~~qi~~~l~~lH~~~i~H~dl~p~nil  140 (309)
T cd07845         111 KCLMLQLLRGLQYLHENFIIHRDLKVSNLL  140 (309)
T ss_pred             HHHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            445688999999999999999999999986

Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing

>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2

Probab=85.91  E-value=0.4  Score=40.83  Aligned_cols=29  Identities=14%  Similarity=0.188  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.||+
T Consensus       110 ~~~~~l~~~l~~lH~~~i~H~dl~p~nil  138 (265)
T cd06652         110 KYTRQILEGVSYLHSNMIVHRDIKGANIL  138 (265)
T ss_pred             HHHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            44578999999999999999999999997

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk

Probab=85.87  E-value=0.35  Score=41.06  Aligned_cols=28  Identities=7%  Similarity=0.105  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       107 ~~~~l~~al~~lH~~~i~H~di~p~Nil  134 (260)
T cd05070         107 MAAQVAAGMAYIERMNYIHRDLRSANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCccceEE
Confidence            3478999999999999999999999974

Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r

>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase

Probab=85.80  E-value=0.39  Score=41.81  Aligned_cols=28  Identities=7%  Similarity=0.100  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|+|+|.++++||
T Consensus       106 ~~~qil~~l~~lH~~~i~H~dl~p~nil  133 (290)
T cd05580         106 YAAQVVLALEYLHSLDIVYRDLKPENLL  133 (290)
T ss_pred             HHHHHHHHHHHHHHCCEecCCCCHHHEE
Confidence            3468999999999999999999999986

Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi

>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins

Probab=85.80  E-value=0.39  Score=41.51  Aligned_cols=29  Identities=14%  Similarity=0.156  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~i~~~l~~al~~lH~~~i~H~dl~p~nil  147 (311)
T cd07866         119 CYMLQLLEGINYLHENHILHRDIKAANIL  147 (311)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes

Probab=85.76  E-value=0.35  Score=41.18  Aligned_cols=28  Identities=14%  Similarity=0.124  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       107 ~~~~l~~al~~lH~~~i~H~dl~~~Nil  134 (260)
T cd05069         107 MAAQIADGMAYIERMNYIHRDLRAANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHhCCEeecccCcceEE
Confidence            4568999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin

Probab=85.71  E-value=0.41  Score=41.09  Aligned_cols=28  Identities=11%  Similarity=0.052  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|+|.++++|+
T Consensus       129 ~~~~i~~~l~~lH~~~i~H~dlkp~nil  156 (286)
T cd06638         129 ILHEALMGLQHLHVNKTIHRDVKGNNIL  156 (286)
T ss_pred             HHHHHHHHHHHHHhCCccccCCCHHhEE
Confidence            4578899999999999999999999985

Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear

>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]

Probab=85.69  E-value=0.44  Score=38.29  Aligned_cols=32  Identities=16%  Similarity=0.117  Sum_probs=27.5

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ......+|+.+|++||.+.|+|||.|+.+|+.
T Consensus       103 ~~~~~~~~~~~l~~~H~~~~~hrd~kp~nil~  134 (384)
T COG0515         103 ALFILAQILSALEYLHSKGIIHRDIKPENILL  134 (384)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeccCCCHHHeee
Confidence            34456788999999999999999999999975

>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases

Probab=85.63  E-value=0.4  Score=41.15  Aligned_cols=31  Identities=13%  Similarity=0.099  Sum_probs=27.1

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.||+
T Consensus       105 ~~~~~~ql~~~l~~lh~~~i~h~dl~p~nil  135 (280)
T cd06611         105 IRYVCRQMLEALNFLHSHKVIHRDLKAGNIL  135 (280)
T ss_pred             HHHHHHHHHHHHHHHHHCCcccCCCChhhEE
Confidence            3445678999999999999999999999976

Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1

Probab=85.56  E-value=0.35  Score=41.88  Aligned_cols=29  Identities=14%  Similarity=0.117  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+..|.+||+..|+|+|.+++||+
T Consensus       113 ~i~~~i~~aL~~lH~~gi~H~dlkp~Nil  141 (284)
T cd05079         113 KYAVQICKGMDYLGSRQYVHRDLAARNVL  141 (284)
T ss_pred             HHHHHHHHHHHHHHHCCeeecccchheEE
Confidence            34578999999999999999999999998

Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase

Probab=85.55  E-value=0.38  Score=40.70  Aligned_cols=28  Identities=18%  Similarity=0.182  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       105 ~~~qi~~al~~lH~~~~~H~dl~p~nil  132 (254)
T cd05083         105 FSLDVAEGMEYLESKKLVHRDLAARNIL  132 (254)
T ss_pred             HHHHHHHHHHHHHhCCeeccccCcceEE
Confidence            3568999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki

>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase

Probab=85.39  E-value=0.41  Score=40.87  Aligned_cols=30  Identities=7%  Similarity=0.073  Sum_probs=26.3

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       102 ~~~~~~i~~~l~~lH~~~i~H~dl~p~ni~  131 (286)
T cd07832         102 KSYMRMLLKGVAYMHANGIMHRDLKPANLL  131 (286)
T ss_pred             HHHHHHHHHHHHHHHHCCeecCCcCHHHEE
Confidence            344578999999999999999999999986

Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea

>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85

Probab=85.39  E-value=0.41  Score=40.93  Aligned_cols=30  Identities=3%  Similarity=0.004  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.+|+
T Consensus       103 ~~~~~qi~~~l~~lH~~~i~h~dl~p~ni~  132 (284)
T cd07836         103 KSFTYQLLKGIAFCHENRVLHRDLKPQNLL  132 (284)
T ss_pred             HHHHHHHHHHHHHHHHCCeeeCCCCHHHEE
Confidence            344578999999999999999999999986

Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment.

>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2

Probab=85.30  E-value=0.42  Score=42.97  Aligned_cols=28  Identities=18%  Similarity=0.237  Sum_probs=24.6

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++ .|+|+|.+++|||
T Consensus       108 ~~~~i~~~l~~lH~~~~ivH~dlkp~Nil  136 (331)
T cd06649         108 VSIAVLRGLAYLREKHQIMHRDVKPSNIL  136 (331)
T ss_pred             HHHHHHHHHHHHhhcCCEEcCCCChhhEE
Confidence            357899999999986 5999999999986

Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst

>PTZ00024 cyclin-dependent protein kinase; Provisional

Probab=85.30  E-value=0.42  Score=42.63  Aligned_cols=30  Identities=17%  Similarity=0.082  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.|||
T Consensus       122 ~~~~~ql~~aL~~LH~~~i~H~dl~~~nil  151 (335)
T PTZ00024        122 KCILLQILNGLNVLHKWYFMHRDLSPANIF  151 (335)
T ss_pred             HHHHHHHHHHHHHHHhCCeecccccHHHeE
Confidence            445678999999999999999999999986

>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3

Probab=85.29  E-value=0.45  Score=40.64  Aligned_cols=29  Identities=14%  Similarity=0.200  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       110 ~~~~qi~~~l~~LH~~~i~H~~l~p~nil  138 (266)
T cd06651         110 KYTRQILEGMSYLHSNMIVHRDIKGANIL  138 (266)
T ss_pred             HHHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            44678999999999999999999999987

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6

Probab=85.25  E-value=0.47  Score=40.20  Aligned_cols=29  Identities=7%  Similarity=0.110  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       110 ~~~~~i~~~l~~LH~~~i~H~dl~~~nil  138 (267)
T cd08228         110 KYFVQLCSAVEHMHSRRVMHRDIKPANVF  138 (267)
T ss_pred             HHHHHHHHHHHHHhhCCeeCCCCCHHHEE
Confidence            44568999999999999999999999987

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis. Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1

Probab=85.23  E-value=0.43  Score=42.03  Aligned_cols=28  Identities=11%  Similarity=0.086  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       145 ~~~qi~~aL~~lH~~gi~H~dlkp~Nil  172 (307)
T cd05098         145 CAYQVARGMEYLASKKCIHRDLAARNVL  172 (307)
T ss_pred             HHHHHHHHHHHHHHCCcccccccHHheE
Confidence            3578899999999999999999999987

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases

Probab=85.23  E-value=0.37  Score=41.03  Aligned_cols=29  Identities=21%  Similarity=0.154  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.|||
T Consensus       110 ~~~~~l~~~l~~Lh~~~i~H~di~p~nil  138 (266)
T cd05033         110 GMLRGIASGMKYLSEMNYVHRDLAARNIL  138 (266)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCcceEE
Confidence            34467889999999999999999999987

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors

Probab=85.18  E-value=0.39  Score=41.01  Aligned_cols=29  Identities=17%  Similarity=0.141  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.+++||+
T Consensus       110 ~i~~~l~~al~~lH~~g~~H~dl~p~nil  138 (269)
T cd05065         110 GMLRGIAAGMKYLSEMNYVHRDLAARNIL  138 (269)
T ss_pred             HHHHHHHHHHHHHHHCCEeecccChheEE
Confidence            34468889999999999999999999986

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase

Probab=85.16  E-value=0.38  Score=40.72  Aligned_cols=28  Identities=11%  Similarity=0.105  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       105 ~~~~i~~~l~~lH~~~i~H~dl~p~ni~  132 (256)
T cd05114         105 MCQDVCEGMEYLERNSFIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHCCccccccCcceEE
Confidence            3467899999999999999999999986

Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases

Probab=85.10  E-value=0.4  Score=40.74  Aligned_cols=29  Identities=17%  Similarity=0.173  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       107 ~~~~~i~~~l~~lH~~~i~H~dl~p~Nil  135 (261)
T cd05068         107 DMAAQVASGMAYLEAQNYIHRDLAARNVL  135 (261)
T ss_pred             HHHHHHHHHHHHHHhCCeeeccCCcceEE
Confidence            44568999999999999999999999987

Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a

>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases

Probab=85.08  E-value=0.42  Score=40.16  Aligned_cols=29  Identities=14%  Similarity=0.051  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       105 ~~~~ql~~~l~~lh~~~i~h~dl~p~ni~  133 (262)
T cd06613         105 YVCRETLKGLAYLHETGKIHRDIKGANIL  133 (262)
T ss_pred             HHHHHHHHHHHHHHhCCceecCCChhhEE
Confidence            34567899999999999999999999975

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ

>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases

Probab=85.05  E-value=0.47  Score=40.69  Aligned_cols=30  Identities=3%  Similarity=-0.001  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|++.++.+|+
T Consensus       102 ~~~~~~i~~~L~~lH~~~~~H~dl~p~nil  131 (283)
T cd07835         102 KSYLYQLLQGIAYCHSHRVLHRDLKPQNLL  131 (283)
T ss_pred             HHHHHHHHHHHHHHHHCCeeCCCCCHHHEE
Confidence            445678999999999999999999999975

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc

>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases

Probab=85.03  E-value=0.37  Score=41.46  Aligned_cols=29  Identities=14%  Similarity=0.185  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|+++.||+
T Consensus       113 ~~~~qi~~~l~~LH~~~i~H~di~p~nil  141 (279)
T cd05057         113 NWCVQIAKGMSYLEEKRLVHRDLAARNVL  141 (279)
T ss_pred             HHHHHHHHHHHHHHhCCEEecccCcceEE
Confidence            34468999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea

>PLN00009 cyclin-dependent kinase A; Provisional

Probab=84.97  E-value=0.41  Score=41.53  Aligned_cols=29  Identities=3%  Similarity=0.020  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|++.++.||+
T Consensus       106 ~~~~qi~~aL~~LH~~~i~H~dl~p~nil  134 (294)
T PLN00009        106 TYLYQILRGIAYCHSHRVLHRDLKPQNLL  134 (294)
T ss_pred             HHHHHHHHHHHHHHhCCeeCCCCCcceEE
Confidence            34468999999999999999999999876

>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase

Probab=84.92  E-value=0.44  Score=40.61  Aligned_cols=28  Identities=11%  Similarity=0.116  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.+|+
T Consensus       105 ~~~qi~~~L~~LH~~~i~H~dl~p~ni~  132 (282)
T cd07831         105 YMYQLLKSLDHMHRNGIFHRDIKPENIL  132 (282)
T ss_pred             HHHHHHHHHHHHHHCCceecccCHHHEE
Confidence            4478999999999999999999999986

Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha

Probab=84.89  E-value=0.46  Score=45.16  Aligned_cols=29  Identities=14%  Similarity=0.099  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|+++.|||
T Consensus       241 ~~~~qi~~aL~~LH~~~ivH~dikp~Nil  269 (400)
T cd05105         241 SFTYQVARGMEFLASKNCVHRDLAARNVL  269 (400)
T ss_pred             HHHHHHHHHHHHHHhCCeeCCCCChHhEE
Confidence            45578999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-

>smart00219 TyrKc Tyrosine kinase, catalytic domain

Probab=84.79  E-value=0.42  Score=39.79  Aligned_cols=30  Identities=17%  Similarity=0.137  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       106 ~~~~~ql~~~l~~lh~~~~~h~dl~~~nil  135 (258)
T smart00219      106 LSFALQIARGMEYLESKNFIHRDLAARNCL  135 (258)
T ss_pred             HHHHHHHHHHHHHHhcCCeeecccccceEE
Confidence            345578999999999999999999999985

Phosphotransferases. Tyrosine-specific kinase subfamily.

>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional

Probab=84.76  E-value=0.47  Score=41.14  Aligned_cols=31  Identities=6%  Similarity=0.124  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||+..|+|+|.++.+|+
T Consensus       111 ~~~~~~qi~~~l~~lH~~~i~H~dl~p~nil  141 (267)
T PHA03390        111 VKKIIRQLVEALNDLHKHNIIHNDIKLENVL  141 (267)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            3445678999999999999999999999986

>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase

Probab=84.76  E-value=0.51  Score=40.69  Aligned_cols=28  Identities=14%  Similarity=0.205  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+++.||+
T Consensus       100 ~~~ql~~~l~~lH~~~i~H~di~p~Nil  127 (277)
T cd05577         100 YAAQIICGLEHLHQRRIVYRDLKPENVL  127 (277)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            3468999999999999999999999986

Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of

>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases

Probab=84.74  E-value=0.5  Score=39.23  Aligned_cols=28  Identities=21%  Similarity=0.177  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       104 ~~~~i~~~l~~lH~~~i~H~dl~p~ni~  131 (254)
T cd06627         104 YVYQVLQGLAYLHEQGVIHRDIKAANIL  131 (254)
T ss_pred             HHHHHHHHHHHHhhCCcccCCCCHHHEE
Confidence            4478999999999999999999999986

Serine/threonine kinases (STKs), (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast

>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]

Probab=84.72  E-value=0.32  Score=50.70  Aligned_cols=27  Identities=11%  Similarity=0.149  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|..+..|||.|.|||+|.|+-|||
T Consensus       494 AqQiaqGM~YLHAK~IIHrDLKSnNIF  520 (678)
T KOG0193|consen  494 AQQIAQGMDYLHAKNIIHRDLKSNNIF  520 (678)
T ss_pred             HHHHHHhhhhhhhhhhhhhhccccceE
Confidence            368889999999999999999999997

>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5

Probab=84.66  E-value=0.46  Score=39.75  Aligned_cols=29  Identities=14%  Similarity=0.147  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|++.++.+|+
T Consensus       105 ~~~~~l~~~l~~lh~~~i~H~dl~~~nil  133 (257)
T cd08225         105 SWFVQISLGLKHIHDRKILHRDIKSQNIF  133 (257)
T ss_pred             HHHHHHHHHHHHHHHCCcccccCCHHHEE
Confidence            34467999999999999999999999987

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src

Probab=84.63  E-value=0.46  Score=40.76  Aligned_cols=29  Identities=17%  Similarity=0.140  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.++.||+
T Consensus       106 ~~~~~l~~aL~~lH~~~i~H~dl~p~Nil  134 (262)
T cd05071         106 DMAAQIASGMAYVERMNYVHRDLRAANIL  134 (262)
T ss_pred             HHHHHHHHHHHHHHHCCccccccCcccEE
Confidence            34578999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn

Probab=84.57  E-value=0.46  Score=40.21  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       108 ~~~~l~~~l~~LH~~~i~H~dl~p~nil  135 (261)
T cd05072         108 FSAQIAEGMAYIERKNYIHRDLRAANVL  135 (261)
T ss_pred             HHHHHHHHHHHHHHCCeeccccchhhEE
Confidence            3468999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa

>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase

Probab=84.57  E-value=0.44  Score=41.06  Aligned_cols=29  Identities=14%  Similarity=0.146  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||...|+|+|.++.||+
T Consensus       107 ~~~~qi~~~L~~LH~~~i~H~dlkp~nil  135 (282)
T cd06643         107 VVCKQTLEALNYLHENKIIHRDLKAGNIL  135 (282)
T ss_pred             HHHHHHHHHHHHHHHCCeeecCCCcccEE
Confidence            34568999999999999999999999985

Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.

>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1

Probab=84.54  E-value=0.51  Score=41.56  Aligned_cols=32  Identities=13%  Similarity=0.117  Sum_probs=27.7

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|.+||++.|+|+|.++.||+
T Consensus       117 ~~~~i~~ql~~aL~~LH~~gi~H~dLkp~Nil  148 (296)
T cd06654         117 QIAAVCRECLQALEFLHSNQVIHRDIKSDNIL  148 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            33455678999999999999999999999986

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding

>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase

Probab=84.42  E-value=0.48  Score=41.35  Aligned_cols=28  Identities=18%  Similarity=0.178  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       120 ~~~ql~~~l~~lH~~~i~H~dl~p~Nil  147 (285)
T cd06648         120 VCLAVLKALSFLHAQGVIHRDIKSDSIL  147 (285)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCChhhEE
Confidence            4478999999999999999999999985

Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors

Probab=84.38  E-value=0.4  Score=41.00  Aligned_cols=29  Identities=21%  Similarity=0.150  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       110 ~i~~~i~~~l~~lH~~~i~h~dlkp~nil  138 (267)
T cd05066         110 GMLRGIASGMKYLSDMGYVHRDLAARNIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHHCCEeehhhchhcEE
Confidence            34467899999999999999999999985

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul

>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3

Probab=84.36  E-value=0.47  Score=40.02  Aligned_cols=29  Identities=3%  Similarity=0.045  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.+|+
T Consensus       104 ~~~~~i~~al~~lH~~~i~H~dl~p~nil  132 (255)
T cd08219         104 QWFVQMCLGVQHIHEKRVLHRDIKSKNIF  132 (255)
T ss_pred             HHHHHHHHHHHHHhhCCcccCCCCcceEE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati

>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6

Probab=84.32  E-value=0.52  Score=42.58  Aligned_cols=30  Identities=7%  Similarity=0.048  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+++|++||+..|+|+++++.|||
T Consensus       117 ~~~~~qi~~aL~~LH~~givH~dikp~Nil  146 (342)
T cd07854         117 RLFMYQLLRGLKYIHSANVLHRDLKPANVF  146 (342)
T ss_pred             HHHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            345678999999999999999999999986

Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi

>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases

Probab=84.20  E-value=0.53  Score=40.25  Aligned_cols=31  Identities=10%  Similarity=0.055  Sum_probs=27.2

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.+|+
T Consensus       101 ~~~~~~~l~~~l~~Lh~~~i~H~dl~~~ni~  131 (283)
T cd07830         101 IRSIIYQILQGLAHIHKHGFFHRDLKPENLL  131 (283)
T ss_pred             HHHHHHHHHHHHHHHHHCCcccCCCChhhEE
Confidence            3445679999999999999999999999986

Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili

>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1

Probab=84.17  E-value=0.54  Score=42.44  Aligned_cols=29  Identities=10%  Similarity=0.071  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||++.|+|++.++.||+
T Consensus       112 ~~~~ql~~aL~~LH~~~iiH~dl~p~Nil  140 (328)
T cd07856         112 YFLYQILRGLKYVHSAGVVHRDLKPSNIL  140 (328)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHEe
Confidence            45678999999999999999999999986

Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U

>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase

Probab=84.15  E-value=0.54  Score=41.60  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||+..|+|+|.++.|||
T Consensus       108 i~~~l~~~l~~LH~~gi~H~dlkp~nil  135 (330)
T cd07834         108 FLYQILRGLKYLHSANVIHRDLKPSNIL  135 (330)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            4578999999999999999999999986

Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and

>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]

Probab=83.94  E-value=0.49  Score=53.06  Aligned_cols=28  Identities=14%  Similarity=0.202  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+-+++++|.+||+..|.|||+|+||||
T Consensus      1339 yt~qll~gla~LH~~gIVHRDIK~aNI~ 1366 (1509)
T KOG4645|consen 1339 YTKQLLEGLAYLHEHGIVHRDIKPANIL 1366 (1509)
T ss_pred             HHHHHHHHHHHHHhcCceecCCCcccee
Confidence            3568999999999999999999999997

>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3

Probab=83.91  E-value=0.53  Score=40.38  Aligned_cols=29  Identities=7%  Similarity=0.015  Sum_probs=25.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|++.++.+|+
T Consensus       104 ~~~~~i~~~l~~lh~~~i~H~~l~p~nil  132 (284)
T cd07860         104 SYLFQLLQGLAFCHSHRVLHRDLKPQNLL  132 (284)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34567999999999999999999999976

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex

>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer

Probab=83.90  E-value=0.48  Score=39.76  Aligned_cols=28  Identities=11%  Similarity=0.014  Sum_probs=25.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+..|.+||++.|+|+|.+++||+
T Consensus        98 ~~~~i~~~l~~lH~~~~~H~dl~p~nil  125 (250)
T cd05085          98 FALDAAAGMAYLESKNCIHRDLAARNCL  125 (250)
T ss_pred             HHHHHHHHHHHHHhCCeeecccChheEE
Confidence            3467889999999999999999999976

Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2

Probab=83.83  E-value=0.5  Score=39.54  Aligned_cols=29  Identities=14%  Similarity=0.067  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|++.++.+|+
T Consensus       103 ~~~~~l~~~l~~lh~~~i~H~dl~~~ni~  131 (256)
T cd06612         103 AILYQTLKGLEYLHSNKKIHRDIKAGNIL  131 (256)
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCcceEE
Confidence            34578899999999999999999999986

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a

>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase

Probab=83.82  E-value=0.56  Score=42.50  Aligned_cols=29  Identities=3%  Similarity=0.074  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.+++||+
T Consensus       122 ~i~~qi~~al~~LH~~gi~H~dlkp~Nil  150 (343)
T cd07880         122 FLVYQMLKGLKYIHAAGIIHRDLKPGNLA  150 (343)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999985

Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4

Probab=83.70  E-value=0.47  Score=42.05  Aligned_cols=27  Identities=11%  Similarity=0.135  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||
T Consensus       140 ~~qi~~aL~~lH~~gi~H~dlkp~Nil  166 (314)
T cd05099         140 AYQVARGMEYLESRRCIHRDLAARNVL  166 (314)
T ss_pred             HHHHHHHHHHHHHCCeeeccccceeEE
Confidence            468999999999999999999999986

Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase

Probab=83.70  E-value=0.58  Score=42.29  Aligned_cols=28  Identities=4%  Similarity=0.124  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.|||
T Consensus       122 ~~~qi~~aL~~LH~~~i~H~dlkp~NIl  149 (342)
T cd07879         122 LVYQMLCGLKYIHSAGIIHRDLKPGNLA  149 (342)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            4578999999999999999999999985

Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13

>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2

Probab=83.63  E-value=0.59  Score=38.92  Aligned_cols=30  Identities=17%  Similarity=0.073  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhc-----cccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQ-----NQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~-----~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||     +..|+|+|.++.||+
T Consensus       108 ~~~~~~i~~~l~~lH~~~~~~~~i~h~dl~p~nil  142 (265)
T cd08217         108 WRILTQLLLALYECHNRSDPGNTVLHRDLKPANIF  142 (265)
T ss_pred             HHHHHHHHHHHHHHhcCccccCcceecCCCHHHEE
Confidence            345678999999999     999999999999986

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi

>PF14812 PBP1_TM: Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A

Probab=83.57  E-value=0.35  Score=38.38  Aligned_cols=9  Identities=33%  Similarity=0.693  Sum_probs=0.0

Q ss_pred             CCceecCCC
Q 024658          132 ENQVVPWSG  140 (264)
Q Consensus       132 enqvVp~s~  140 (264)
                      |.+.+|+-+
T Consensus        49 eee~m~rK~   57 (81)
T PF14812_consen   49 EEEPMPRKG   57 (81)
T ss_dssp             ---------
T ss_pred             hcccccccc
Confidence            444566655

>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]

Probab=83.56  E-value=0.56  Score=42.94  Aligned_cols=25  Identities=8%  Similarity=0.170  Sum_probs=23.4

Q ss_pred             HHHHHhhhhccccccccCcchhhhH
Q 024658          228 AIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       228 ~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ++++.|+.||+..++|||+|++|++
T Consensus       130 q~l~~l~~lH~~G~iHRDiKp~N~~  154 (322)
T KOG1164|consen  130 QNLNALEDLHSKGFIHRDIKPENFV  154 (322)
T ss_pred             HHHHHHHHHHhcCcccCCcCHHHee
Confidence            7889999999999999999999975

>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15

Probab=83.54  E-value=0.51  Score=42.21  Aligned_cols=28  Identities=7%  Similarity=0.126  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       112 i~~qi~~~L~~LH~~~i~H~dl~p~nil  139 (337)
T cd07852         112 IMYQLLKALKYIHSGNVIHRDLKPSNIL  139 (337)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4578899999999999999999999976

Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul

>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants

Probab=83.41  E-value=0.6  Score=42.01  Aligned_cols=30  Identities=3%  Similarity=0.040  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|++||++.|+|++.++.||+
T Consensus       111 ~~i~~qi~~aL~~LH~~~i~H~dlkp~Nil  140 (337)
T cd07858         111 QYFLYQLLRGLKYIHSANVLHRDLKPSNLL  140 (337)
T ss_pred             HHHHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            445678999999999999999999999985

Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati

>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases

Probab=83.41  E-value=0.62  Score=39.49  Aligned_cols=29  Identities=21%  Similarity=0.212  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.+|+
T Consensus       110 ~~~~~l~~~l~~lH~~~ivH~di~p~nil  138 (267)
T cd06628         110 NFVRQILKGLNYLHNRGIIHRDIKGANIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHhcCcccccCCHHHEE
Confidence            44578999999999999999999999986

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate

>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9

Probab=83.38  E-value=0.6  Score=39.32  Aligned_cols=29  Identities=10%  Similarity=0.023  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.++.+|+
T Consensus       105 ~~~~~l~~~l~~lh~~~i~h~dl~p~ni~  133 (256)
T cd08221         105 WYLFQIVSAVSYIHKAGILHRDIKTLNIF  133 (256)
T ss_pred             HHHHHHHHHHHHHHhCCccccCCChHhEE
Confidence            44578899999999999999999999986

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa

>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase

Probab=83.37  E-value=0.61  Score=39.53  Aligned_cols=28  Identities=7%  Similarity=0.101  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|++.++.+|+
T Consensus        98 ~~~~i~~~l~~lH~~~~~h~dl~~~nil  125 (262)
T cd05572          98 YIACVVLAFEYLHNRGIIYRDLKPENLL  125 (262)
T ss_pred             HHHHHHHHHHHHhhCCcccCCCCHHHEE
Confidence            3467999999999999999999999996

Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi

>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6

Probab=83.28  E-value=0.63  Score=39.80  Aligned_cols=29  Identities=10%  Similarity=0.235  Sum_probs=25.6

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+ .|+|+|.++.+||
T Consensus       107 ~~~~qi~~~l~~lH~~~~i~h~dlkp~nil  136 (283)
T cd06617         107 KIAVSIVKALEYLHSKLSVIHRDVKPSNVL  136 (283)
T ss_pred             HHHHHHHHHHHHHhhcCCeecCCCCHHHEE
Confidence            4457899999999987 8999999999986

Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs

>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3

Probab=83.13  E-value=0.53  Score=40.27  Aligned_cols=28  Identities=14%  Similarity=0.045  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       105 ~~~qi~~al~~lH~~~i~H~dlkp~nil  132 (269)
T cd05087         105 MACEIALGLLHLHKNNFIHSDLALRNCL  132 (269)
T ss_pred             HHHHHHHHHHHHHHCCEeccccCcceEE
Confidence            3468999999999999999999999976

Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells

>PTZ00415 transmission-blocking target antigen s230; Provisional

Probab=83.03  E-value=0.6  Score=53.78  Aligned_cols=15  Identities=33%  Similarity=0.667  Sum_probs=8.7

Q ss_pred             hhccccCCceecCCC
Q 024658          126 EEEEDDENQVVPWSG  140 (264)
Q Consensus       126 ~~ee~~enqvVp~s~  140 (264)
                      +|+|+++.||-|+--
T Consensus       171 ~e~~~~~~~~~~~~d  185 (2849)
T PTZ00415        171 EEEEEEEEEIKGFDD  185 (2849)
T ss_pred             cccccccccccCCCc
Confidence            444455557777754

>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4

Probab=83.02  E-value=0.63  Score=39.13  Aligned_cols=28  Identities=14%  Similarity=0.175  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       104 i~~~i~~~l~~lh~~~i~H~dl~~~nil  131 (264)
T cd06626         104 YTLQLLEGLAYLHSHGIVHRDIKPANIF  131 (264)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            3478999999999999999999999985

Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin

Probab=82.96  E-value=0.6  Score=40.42  Aligned_cols=28  Identities=14%  Similarity=0.135  Sum_probs=25.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||+..|+|++.++.+|+
T Consensus       133 ~~~qi~~al~~lH~~~ivH~dlkp~nil  160 (291)
T cd06639         133 ILYGALLGLQHLHNNRIIHRDVKGNNIL  160 (291)
T ss_pred             HHHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            3467899999999999999999999985

Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase

Probab=82.88  E-value=0.58  Score=39.39  Aligned_cols=29  Identities=10%  Similarity=0.069  Sum_probs=25.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.+++||+
T Consensus       104 ~~~~~l~~~l~~lH~~~i~h~dl~p~ni~  132 (256)
T cd05112         104 GMCLDVCEGMAYLESSNVIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHHCCccccccccceEE
Confidence            34468899999999999999999999976

Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ

>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase

Probab=82.87  E-value=0.58  Score=42.45  Aligned_cols=28  Identities=7%  Similarity=0.148  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.||+
T Consensus       125 i~~qi~~aL~~LH~~~ivH~dlkp~NIl  152 (345)
T cd07877         125 LIYQILRGLKYIHSADIIHRDLKPSNLA  152 (345)
T ss_pred             HHHHHHHHHHHHHHCCeeecCCChHHEE
Confidence            3468899999999999999999999986

Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases

Probab=82.86  E-value=0.61  Score=39.37  Aligned_cols=29  Identities=17%  Similarity=0.171  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       107 ~~~~~i~~al~~lh~~~i~h~di~p~nil  135 (261)
T cd05034         107 DMAAQIAEGMAYLESRNYIHRDLAARNIL  135 (261)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCcchheEE
Confidence            44568899999999999999999999986

Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta

Probab=82.82  E-value=0.6  Score=44.50  Aligned_cols=28  Identities=14%  Similarity=0.097  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.+++|||
T Consensus       244 ~~~qi~~aL~~LH~~~ivHrdlkp~NiL  271 (401)
T cd05107         244 FSYQVANGMEFLASKNCVHRDLAARNVL  271 (401)
T ss_pred             HHHHHHHHHHHHhcCCcCcccCCcceEE
Confidence            4468999999999999999999999985

Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D

>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases

Probab=82.65  E-value=0.66  Score=39.63  Aligned_cols=28  Identities=14%  Similarity=0.151  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|++.++.||+
T Consensus       106 i~~~i~~~l~~lh~~~i~H~dl~p~ni~  133 (277)
T cd06917         106 IIREVLVALKYIHKVGVIHRDIKAANIL  133 (277)
T ss_pred             HHHHHHHHHHHHHhCCcccCCcCHHHEE
Confidence            4467999999999999999999999986

Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent

>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1

Probab=82.62  E-value=0.66  Score=39.24  Aligned_cols=29  Identities=14%  Similarity=0.099  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|.|++.++.||+
T Consensus       104 ~~~~~i~~~l~~lh~~~i~h~dl~~~nil  132 (258)
T cd05578         104 FWICEIVLALEYLHSKGIIHRDIKPDNIL  132 (258)
T ss_pred             HHHHHHHHHHHHHHhCCeeccCCCHHHeE
Confidence            34578999999999999999999999987

Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3

Probab=82.62  E-value=0.64  Score=39.79  Aligned_cols=29  Identities=7%  Similarity=0.043  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       104 ~~~~~i~~~l~~LH~~~i~h~~l~p~ni~  132 (286)
T cd07846         104 KYLFQILRGIEFCHSHNIIHRDIKPENIL  132 (286)
T ss_pred             HHHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            34568999999999999999999999986

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI

>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1

Probab=82.61  E-value=0.66  Score=38.75  Aligned_cols=28  Identities=18%  Similarity=0.201  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.+|+
T Consensus       107 ~~~~i~~~l~~lH~~~i~H~dl~~~ni~  134 (258)
T cd06632         107 YTRQILLGLEYLHDRNTVHRDIKGANIL  134 (258)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            4568999999999999999999999985

Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops

>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]

Probab=82.55  E-value=0.37  Score=50.65  Aligned_cols=30  Identities=17%  Similarity=0.169  Sum_probs=28.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ++-|+.|..+++|||.-+|||||.|+-|||
T Consensus       215 v~Wsk~IA~GM~YLH~hKIIHRDLKSPNiL  244 (904)
T KOG4721|consen  215 VDWSKGIAGGMNYLHLHKIIHRDLKSPNIL  244 (904)
T ss_pred             HHHHHHhhhhhHHHHHhhHhhhccCCCceE
Confidence            377899999999999999999999999997

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7

Probab=82.38  E-value=0.67  Score=39.03  Aligned_cols=29  Identities=10%  Similarity=0.146  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||+..|+|++.++.||+
T Consensus       110 ~~~~~l~~~l~~lh~~~i~h~dl~p~nil  138 (267)
T cd08224         110 KYFVQLCSALEHMHSKRIMHRDIKPANVF  138 (267)
T ss_pred             HHHHHHHHHHHHHHhCCEecCCcChhhEE
Confidence            44578999999999999999999999975

Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a

>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed

Probab=82.37  E-value=0.66  Score=41.35  Aligned_cols=28  Identities=14%  Similarity=0.040  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+..|.+||.+.|+|+|.++.|||
T Consensus       147 ~~~~i~~~l~~lH~~GI~HrDlkp~NIL  174 (239)
T PRK01723        147 QWQAIGQLIARFHDAGVYHADLNAHNIL  174 (239)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCchhEE
Confidence            4568999999999999999999999996

>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases

Probab=82.32  E-value=0.66  Score=39.50  Aligned_cols=30  Identities=7%  Similarity=0.076  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||+..|+|++.++.||+
T Consensus       110 ~~~~~~i~~al~~LH~~~i~h~~l~~~nil  139 (287)
T cd07838         110 KDLMRQLLRGVDFLHSHRIVHRDLKPQNIL  139 (287)
T ss_pred             HHHHHHHHHHHHHHHHCCeeeccCChhhEE
Confidence            445678999999999999999999999985

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both

>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases

Probab=82.26  E-value=0.64  Score=39.50  Aligned_cols=29  Identities=10%  Similarity=0.053  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       102 ~~~~~i~~~l~~LH~~~i~H~~l~~~ni~  130 (282)
T cd07829         102 SIMYQLLRGLAYCHSHRILHRDLKPQNIL  130 (282)
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCChheEE
Confidence            34578999999999999999999999875

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the

>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases

Probab=82.20  E-value=0.61  Score=40.16  Aligned_cols=29  Identities=10%  Similarity=0.222  Sum_probs=25.0

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++ .|+|+|.++.||+
T Consensus       106 ~~~~~i~~~l~~LH~~~~i~H~dl~p~nil  135 (286)
T cd06622         106 RITYAVVKGLKFLKEEHNIIHRDVKPTNVL  135 (286)
T ss_pred             HHHHHHHHHHHHHHhcCCEeeCCCCHHHEE
Confidence            4457899999999964 8999999999986

Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include

>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases

Probab=82.09  E-value=0.75  Score=37.66  Aligned_cols=28  Identities=18%  Similarity=0.208  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|.|+|.++.||+
T Consensus       103 i~~~i~~~l~~lh~~~i~h~dl~p~ni~  130 (253)
T cd05122         103 VCKELLKGLEYLHSNGIIHRDIKAANIL  130 (253)
T ss_pred             HHHHHHHHHHHhhcCCEecCCCCHHHEE
Confidence            4568999999999999999999999985

Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase

Probab=82.05  E-value=0.63  Score=39.63  Aligned_cols=29  Identities=17%  Similarity=0.137  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||+..|+|+|+++.||+
T Consensus       106 ~~~~~l~~aL~~lH~~~i~H~dl~p~ni~  134 (260)
T cd05073         106 DFSAQIAEGMAFIEQRNYIHRDLRAANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHHhCCccccccCcceEE
Confidence            34468999999999999999999999976

Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2

Probab=82.03  E-value=0.58  Score=39.80  Aligned_cols=30  Identities=20%  Similarity=0.189  Sum_probs=26.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.+++||+
T Consensus       110 ~~~~~~l~~al~~lH~~~i~H~dlkp~Nil  139 (268)
T cd05063         110 VGMLRGIAAGMKYLSDMNYVHRDLAARNIL  139 (268)
T ss_pred             HHHHHHHHHHHHHHHHCCeeccccchhhEE
Confidence            344567889999999999999999999986

Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored

>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12

Probab=81.91  E-value=0.71  Score=39.99  Aligned_cols=31  Identities=10%  Similarity=0.057  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+-..+|+.+|.+||+..|+|++.++.+|+
T Consensus       118 ~~~i~~qi~~aL~~LH~~~i~H~dl~p~nil  148 (302)
T cd07864         118 IKSFMKQLLEGLNYCHKKNFLHRDIKCSNIL  148 (302)
T ss_pred             HHHHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            3455678999999999999999999999986

Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely

>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase

Probab=81.90  E-value=0.7  Score=40.64  Aligned_cols=27  Identities=11%  Similarity=0.091  Sum_probs=24.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.||+
T Consensus       107 ~~~i~~~l~~lH~~~i~H~dl~p~NIl  133 (305)
T cd05609         107 FAETVLALEYLHNYGIVHRDLKPDNLL  133 (305)
T ss_pred             HHHHHHHHHHHHHCCccccCCchHHEE
Confidence            357889999999999999999999985

Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a

>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4

Probab=81.78  E-value=0.73  Score=39.10  Aligned_cols=30  Identities=10%  Similarity=0.127  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ....+|+.+|.+||+..|+|++.++.||+=
T Consensus       106 ~~~~qi~~~l~~lH~~~i~H~dl~p~nil~  135 (265)
T cd06631         106 KYTKQILDGVAYLHNNCVVHRDIKGNNVML  135 (265)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCcCHHhEEE
Confidence            345789999999999999999999999873

Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.

>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1

Probab=81.62  E-value=0.69  Score=41.13  Aligned_cols=28  Identities=18%  Similarity=0.191  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       130 i~~~i~~~l~~lH~~~i~H~dL~p~Nil  157 (317)
T cd06635         130 ITHGALQGLAYLHSHNMIHRDIKAGNIL  157 (317)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCcccEE
Confidence            3467999999999999999999999986

Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron

>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins

Probab=81.57  E-value=0.68  Score=40.78  Aligned_cols=29  Identities=14%  Similarity=0.106  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|++.++.+|+
T Consensus       119 ~~~~ql~~~L~~LH~~~i~H~dl~p~nIl  147 (307)
T cd06607         119 AICHGALQGLAYLHSHERIHRDIKAGNIL  147 (307)
T ss_pred             HHHHHHHHHHHHHHHCCceecCCCcccEE
Confidence            34578999999999999999999999986

Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily

>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4

Probab=81.54  E-value=0.75  Score=40.62  Aligned_cols=29  Identities=17%  Similarity=0.207  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.+++||+
T Consensus       120 ~~~~ql~~~l~~lH~~givH~dl~p~Nil  148 (292)
T cd06657         120 AVCLAVLKALSVLHAQGVIHRDIKSDSIL  148 (292)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            45578999999999999999999999986

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo

>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases

Probab=81.46  E-value=0.69  Score=40.70  Aligned_cols=27  Identities=11%  Similarity=0.078  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.||+
T Consensus       109 ~~qi~~~l~~lH~~~i~H~dlkp~Nil  135 (316)
T cd05574         109 AAEVLLALEYLHLLGIVYRDLKPENIL  135 (316)
T ss_pred             HHHHHHHHHHHHHCCeeccCCChHHeE
Confidence            458999999999999999999999986

Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases

Probab=81.32  E-value=0.81  Score=39.14  Aligned_cols=30  Identities=17%  Similarity=0.079  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|++.++.+|+
T Consensus       101 ~~~~~ql~~~l~~lh~~~i~h~dl~p~ni~  130 (274)
T cd06609         101 AFILREVLLGLEYLHEEGKIHRDIKAANIL  130 (274)
T ss_pred             HHHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            445578999999999999999999999986

Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)

>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain

Probab=81.11  E-value=0.77  Score=38.62  Aligned_cols=31  Identities=6%  Similarity=-0.018  Sum_probs=27.0

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...-..+|+..|.+||...|+|+|.+++||+
T Consensus       127 ~~~~~~~i~~~l~~lh~~gi~H~Dl~p~Nil  157 (198)
T cd05144         127 PEEVLDEILEEIVKAYKHGIIHGDLSEFNIL  157 (198)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCcCCCCcccEE
Confidence            3445578999999999999999999999985

The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom

>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases

Probab=81.10  E-value=0.79  Score=39.08  Aligned_cols=27  Identities=11%  Similarity=0.196  Sum_probs=24.9

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.+|+
T Consensus       114 ~~qi~~~l~~lH~~~i~H~dl~~~nil  140 (272)
T cd06629         114 TEQVLEGLAYLHSKGILHRDLKADNLL  140 (272)
T ss_pred             HHHHHHHHHHHhhCCeeecCCChhhEE
Confidence            468999999999999999999999986

Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte

>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3

Probab=80.92  E-value=0.82  Score=40.28  Aligned_cols=30  Identities=10%  Similarity=0.107  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       118 ~~~~~~l~~~L~~LH~~~i~H~dL~p~Nil  147 (297)
T cd06656         118 AAVCRECLQALDFLHSNQVIHRDIKSDNIL  147 (297)
T ss_pred             HHHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            345578999999999999999999999986

Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding

>PTZ00415 transmission-blocking target antigen s230; Provisional

Probab=80.89  E-value=0.85  Score=52.62  Aligned_cols=6  Identities=17%  Similarity=0.373  Sum_probs=3.0

Q ss_pred             ccccCC
Q 024658           48 VCQSLT   53 (264)
Q Consensus        48 ~C~~~p   53 (264)
                      .|+.|.
T Consensus        95 ~~~~~~  100 (2849)
T PTZ00415         95 TCPFHK  100 (2849)
T ss_pred             cCcccc
Confidence            455544

>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]

Probab=80.70  E-value=0.8  Score=44.97  Aligned_cols=29  Identities=3%  Similarity=0.000  Sum_probs=26.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +..-+|+.++.+.|+..|||||+|+-|||
T Consensus       105 ~~l~Q~l~ai~~cHk~n~IHRDIKPENIL  133 (396)
T KOG0593|consen  105 KYLYQLLKAIHFCHKNNCIHRDIKPENIL  133 (396)
T ss_pred             HHHHHHHHHhhhhhhcCeecccCChhheE
Confidence            45678999999999999999999999998

>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms]

Probab=80.51  E-value=0.8  Score=43.92  Aligned_cols=26  Identities=12%  Similarity=0.139  Sum_probs=25.0

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .|||.++.|+|+..|.|||.|+-|||
T Consensus       127 ~Qlisav~y~H~~gi~HRDLK~ENil  152 (370)
T KOG0583|consen  127 RQLISAVAYCHSRGIVHRDLKPENIL  152 (370)
T ss_pred             HHHHHHHHHHHhCCEeeCCCCHHHEE
Confidence            89999999999999999999999986

>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1

Probab=80.44  E-value=0.83  Score=39.56  Aligned_cols=27  Identities=15%  Similarity=0.059  Sum_probs=24.7

Q ss_pred             HHHHHHhhhhccccccccCcchhhhHh
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .+|+.+|.+||+..|+|+|.++.|||-
T Consensus       112 ~qi~~al~~lH~~~i~H~dl~p~nil~  138 (290)
T cd05613         112 GEIVLALEHLHKLGIIYRDIKLENILL  138 (290)
T ss_pred             HHHHHHHHHHHhCCeeccCCCHHHeEE
Confidence            479999999999999999999999863

Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph

>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase

Probab=80.34  E-value=0.86  Score=38.25  Aligned_cols=29  Identities=14%  Similarity=0.134  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       106 ~~~~ql~~al~~lh~~~i~h~~l~p~ni~  134 (267)
T cd06610         106 TVLKEVLKGLEYLHSNGQIHRDIKAGNIL  134 (267)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHhEE
Confidence            34578999999999999999999999986

Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]

Probab=80.32  E-value=0.8  Score=50.14  Aligned_cols=14  Identities=21%  Similarity=0.327  Sum_probs=7.2

Q ss_pred             cccccccccccCCC
Q 024658           41 LRCLLCHVCQSLTP   54 (264)
Q Consensus        41 ~RvpLC~~C~~~p~   54 (264)
                      .|.+|-+.|-.++.
T Consensus      1358 v~R~~~Dlct~~~D 1371 (1516)
T KOG1832|consen 1358 VDRCLLDLCTEPTD 1371 (1516)
T ss_pred             cccchhhhhcCCcc
Confidence            34444456665553

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases

Probab=80.08  E-value=0.91  Score=38.81  Aligned_cols=29  Identities=7%  Similarity=0.056  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|++.++.+|+
T Consensus       104 ~~~~~i~~~l~~LH~~~i~H~dl~~~ni~  132 (288)
T cd07833         104 SYIWQLLQAIAYCHSHNIIHRDIKPENIL  132 (288)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            34568999999999999999999999987

Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	264
2ayu_A	417	Nucleosome assembly protein; histone chaperone; 3.	5e-05
2ayu_A	417	Nucleosome assembly protein; histone chaperone; 3.	7e-05
2ayu_A	417	Nucleosome assembly protein; histone chaperone; 3.	3e-04
2ayu_A	417	Nucleosome assembly protein; histone chaperone; 3.	5e-04
2ayu_A	417	Nucleosome assembly protein; histone chaperone; 3.	7e-04
1twf_F	155	ABC23, DNA-directed RNA polymerases I, II, and III	5e-04
1twf_F	155	ABC23, DNA-directed RNA polymerases I, II, and III	8e-04
2zd7_A	264	VPS75, vacuolar protein sorting-associated protein	8e-04

>2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417

 Score = 43.0 bits (100), Expect = 5e-05
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 99  GHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPP 150
           G     + ++ E+E D+D+D+E+ D+   E+DD         D +  P Q P
Sbjct: 362 GAALEFEFEEDEEEADEDEDEEEDDDHGLEDDDGES-AEEQDDFAGRPEQAP 412

>2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417

 Score = 42.6 bits (99), Expect = 7e-05
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 95  ERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPP 151
             +    E D+++  EDED+++DDD   ++++ E  +E        DD    P+  P
Sbjct: 363 AALEFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEE-------QDDFAGRPEQAP 412

>2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417

 Score = 40.7 bits (94), Expect = 3e-04
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 93  QSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQ 134
           + E     +E D+D+D E++DD   +D+D +  EE++D   +
Sbjct: 366 EFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEEQDDFAGR 407

>2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417

 Score = 39.9 bits (92), Expect = 5e-04
 Identities = 8/47 (17%), Positives = 25/47 (53%)

Query: 106 DDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPP 152
           + ++E+++++ D+DED +E+++   +++        D  +      P
Sbjct: 366 EFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEEQDDFAGRPEQAP 412

>2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A Length = 417

 Score = 39.5 bits (91), Expect = 7e-04
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 90  GGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDE 132
           G +        +E  D+D+ E+EDDD   ++D  E  EE+DD 
Sbjct: 362 GAALEFEFEEDEEEADEDEDEEEDDDHGLEDDDGESAEEQDDF 404

>1twf_F ABC23, DNA-directed RNA polymerases I, II, and III 23 KD polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: a.143.1.2 PDB: 1i3q_F 1i6h_F 1k83_F* 1nik_F 1nt9_F 1pqv_F 1r5u_F 1r9s_F* 1r9t_F* 1sfo_F* 1twa_F* 1twc_F* 1i50_F* 1twg_F* 1twh_F* 1wcm_F 1y1v_F 1y1w_F 1y1y_F 1y77_F* ... Length = 155

 Score = 38.5 bits (89), Expect = 5e-04
 Identities = 9/36 (25%), Positives = 17/36 (47%)

Query: 99  GHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQ 134
                D ++++ED D +   DE+  EE+ +  D   
Sbjct: 5   EEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGET 40

>1twf_F ABC23, DNA-directed RNA polymerases I, II, and III 23 KD polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: a.143.1.2 PDB: 1i3q_F 1i6h_F 1k83_F* 1nik_F 1nt9_F 1pqv_F 1r5u_F 1r9s_F* 1r9t_F* 1sfo_F* 1twa_F* 1twc_F* 1i50_F* 1twg_F* 1twh_F* 1wcm_F 1y1v_F 1y1w_F 1y1y_F 1y77_F* ... Length = 155

 Score = 38.1 bits (88), Expect = 8e-04
 Identities = 12/48 (25%), Positives = 21/48 (43%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQ 148
           +E  +D D E   D++  +E P  ++ E  D N     +G +     Q
Sbjct: 12  NENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQ 59

>2zd7_A VPS75, vacuolar protein sorting-associated protein 75; histone chaperone, VPS75, NAP1, nucleus, phosphoprotein; 1.85A {Saccharomyces cerevisiae} PDB: 3q66_A* 3q68_A* 3c9d_A 3c9b_A 3q33_B* 3q35_B* 3dm7_A Length = 264

 Score = 38.9 bits (90), Expect = 8e-04
 Identities = 10/51 (19%), Positives = 17/51 (33%), Gaps = 6/51 (11%)

Query: 103 TDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPP 153
            +   D EDE+ +     D D E+++            D   S  +P    
Sbjct: 217 AEAQRDLEDEEGESGLSADGDSEDDDGSLGEV------DLPLSDEEPSSKK 261

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	264
2jun_A	101	Midline-1; B-BOX, TRIM, ring finger, alternative s	98.59
4g31_A	299	Eukaryotic translation initiation factor 2-alpha;	96.3
4g3f_A	336	NF-kappa-beta-inducing kinase; non-RD kinase, prot	95.97
3hyh_A	275	Carbon catabolite-derepressing protein kinase; kin	95.77
4asz_A	299	BDNF/NT-3 growth factors receptor; transferase, TR	95.74
4b9d_A	350	Serine/threonine-protein kinase NEK1; transferase,	95.73
3fpq_A	290	Serine/threonine-protein kinase WNK1; protein seri	95.73
4f9c_A	361	Cell division cycle 7-related protein kinase; Ser/	95.73
3omv_A	307	RAF proto-oncogene serine/threonine-protein kinas;	95.72
4aw0_A	311	HPDK1, 3-phosphoinositide-dependent protein kinase	95.72
4fih_A	346	Serine/threonine-protein kinase PAK 4; kinase doma	95.71
3ubd_A	304	Ribosomal protein S6 kinase alpha-3; kinase-inhibi	95.66
4azs_A	569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	95.65
4b99_A	398	Mitogen-activated protein kinase 7; transferase, i	95.58
4ase_A	353	Vascular endothelial growth factor receptor 2; tra	95.44
4aoj_A	329	High affinity nerve growth factor receptor; transf	95.39
4gt4_A	308	Tyrosine-protein kinase transmembrane receptor RO;	95.38
4fie_A	423	Serine/threonine-protein kinase PAK 4; kinase doma	95.37
3e7e_A	365	HBUB1, BUB1A, mitotic checkpoint serine/threonine-	94.77
3hmm_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	94.55
2vuw_A	336	Serine/threonine-protein kinase haspin; cell cycle	94.42
3dzo_A	413	Rhoptry kinase domain; parasitic disease, transfer	94.33
3q60_A	371	ROP5B; pseudokinase, transferase; HET: ATP; 1.72A	94.22
1x8b_A	289	WEE1HU, WEE1-like protein kinase; cell cycle, tran	94.09
3rp9_A	458	Mitogen-activated protein kinase; structural genom	94.06
3op5_A	364	Serine/threonine-protein kinase VRK1; adenosine tr	93.98
2d8u_A	64	Ubiquitin ligase TRIM63; tripartite motif-containi	93.97
3qd2_B	332	Eukaryotic translation initiation factor 2-alpha;	93.92
3uqc_A	286	Probable conserved transmembrane protein; structur	93.91
2dja_A	84	Midline-2; tripartite motif protein 1, ZF-B_BOX, s	93.83
3v5w_A	689	G-protein coupled receptor kinase 2; inhibitor com	93.82
1wak_A	397	Serine/threonine-protein kinase SPRK1; SRPK, trans	93.81
3uto_A	573	Twitchin; kinase, muscle sarcomere, transferase; H	93.78
3llt_A	360	Serine/threonine kinase-1, pflammer; lammer kinase	93.77
4hgt_A	296	Casein kinase I isoform delta; CK1D, inhibitor, tr	93.76
2eu9_A	355	Dual specificity protein kinase CLK3; kinase domai	93.73
3byv_A	377	Rhoptry kinase; malaria, transferase, structural g	93.7
3poz_A	327	Epidermal growth factor receptor; kinase domain, a	93.62
2izr_A	330	Casein kinase I isoform gamma-3; serine/threonine-	93.59
3oz6_A	388	Mitogen-activated protein kinase 1, serine/threon	93.58
1csn_A	298	Casein kinase-1; phosphotransferase; HET: ATP; 2.0	93.57
3vhe_A	359	Vascular endothelial growth factor receptor 2; kin	93.53
4fvq_A	289	Tyrosine-protein kinase JAK2; janus protein kinase	93.52
1z57_A	339	Dual specificity protein kinase CLK1; protein tyro	93.45
1ob3_A	288	PFPK5, cell division control protein 2 homolog; tr	93.42
3dbq_A	343	Dual specificity protein kinase TTK; MPS1 structur	93.4
3gni_B	389	Strad alpha; kinase fold, pseudokinase, alpha heli	93.25
3o0g_A	292	Cell division protein kinase 5; kinase activator c	93.25
1j1b_A	420	Glycogen synthase kinase-3 beta; complex, TAU, AMP	93.23
3nsz_A	330	CK II alpha, casein kinase II subunit alpha; inhib	93.19
3kex_A	325	Receptor tyrosine-protein kinase ERBB-3; kinase do	93.19
3uzp_A	296	CKI-delta, CKID, casein kinase I isoform delta; CK	93.18
2ac3_A	316	MAP kinase-interacting serine/threonine kinase 2;	93.16
3g33_A	308	Cell division protein kinase 4; Ser/Thr protein ki	93.16
3p1a_A	311	MYT1 kinase, membrane-associated tyrosine- and thr	93.14
2zmd_A	390	Dual specificity protein kinase TTK; MPS1, T686A,	93.14
3lzb_A	327	Epidermal growth factor receptor; epidermal growth	93.07
2zv2_A	298	Calcium/calmodulin-dependent protein kinase kinas;	93.06
3l9p_A	367	Anaplastic lymphoma kinase; kinase domain, ATP-bin	93.04
3qup_A	323	Tyrosine-protein kinase receptor TYRO3; protein ki	93.02
3rgf_A	405	Cyclin-dependent kinase 8; protein kinase complex,	93.01
1mp8_A	281	Focal adhesion kinase 1; tyrosine protein kinase,	93.0
3txo_A	353	PKC-L, NPKC-ETA, protein kinase C ETA type; phosph	92.97
2i6l_A	320	Mitogen-activated protein kinase 6; MAPK6, ERK3, e	92.96
3c0i_A	351	Peripheral plasma membrane protein CASK; neurexin,	92.9
3gbz_A	329	Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-	92.89
2ivs_A	314	Proto-oncogene tyrosine-protein kinase receptor RE	92.89
3n9x_A	432	Phosphotransferase; malaria kinase, structural gen	92.89
2psq_A	370	Fibroblast growth factor receptor 2; kinase domain	92.86
3ugc_A	295	Tyrosine-protein kinase JAK2; small molecule inhib	92.85
3pls_A	298	Macrophage-stimulating protein receptor; protein k	92.85
1luf_A	343	Muscle-specific tyrosine kinase receptor MUSK; pho	92.79
3niz_A	311	Rhodanese family protein; structural genomics, str	92.75
1o6l_A	337	RAC-beta serine/threonine protein kinase; protein	92.73
3g2f_A	336	Bone morphogenetic protein receptor type-2; kinase	92.71
1vzo_A	355	Ribosomal protein S6 kinase alpha 5; protein kinas	92.69
3fe3_A	328	MAP/microtubule affinity-regulating kinase 3; seri	92.68
3ork_A	311	Serine/threonine protein kinase; structural genomi	92.66
3s95_A	310	LIMK-1, LIM domain kinase 1; structural genomics,	92.65
3q4u_A	301	Activin receptor type-1; structural genomics conso	92.65
3a8x_A	345	Protein kinase C IOTA type; transferase; HET: TPO;	92.65
3gen_A	283	Tyrosine-protein kinase BTK; bruton'S tyrosine kin	92.63
3brb_A	313	Proto-oncogene tyrosine-protein kinase MER; ATP-bi	92.6
3ttj_A	464	Mitogen-activated protein kinase 10; JNK3, protein	92.59
3m2w_A	299	MAP kinase-activated protein kinase 2; small molec	92.57
4euu_A	319	Serine/threonine-protein kinase TBK1; ATP binding,	92.55
1p4o_A	322	Insulin-like growth factor I receptor protein; IGF	92.53
4e7w_A	394	Glycogen synthase kinase 3; GSK3, PTyr195, transfe	92.53
3kmu_A	271	ILK, integrin-linked kinase; cell adhesion, ANK re	92.49
2pmi_A	317	Negative RE, cyclin-dependent protein kinase PHO85	92.49
3kn6_A	325	Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1	92.47
2i1m_A	333	Macrophage colony-stimulating factor 1 receptor; k	92.47
2xir_A	316	Vascular endothelial growth factor receptor 2; ang	92.44
4e5w_A	302	Tyrosine-protein kinase JAK1; kinase domain, trans	92.44
2v62_A	345	Serine/threonine-protein kinase VRK2; transferase,	92.44
1nxk_A	400	MAP kinase-activated protein kinase 2; MK2, phosph	92.44
2eue_A	275	Carbon catabolite derepressing protein kinase; kin	92.43
3fxz_A	297	Serine/threonine-protein kinase PAK 1; transferase	92.41
3ll6_A	337	Cyclin G-associated kinase; transferase, protein k	92.41
1t46_A	313	HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom	92.4
2jii_A	352	Serine/threonine-protein kinase VRK3 molecule: VA	92.39
3eb0_A	383	Putative uncharacterized protein; kinase cryptospo	92.38
3f66_A	298	Hepatocyte growth factor receptor; C-Met, protein	92.36
3uc3_A	361	Serine/threonine-protein kinase SRK2I; SNRK2, ABA	92.34
2bdw_A	362	Hypothetical protein K11E8.1D; kinase, calmodulin	92.32
1rjb_A	344	FL cytokine receptor; kinase, structure, autoinhib	92.29
3a62_A	327	Ribosomal protein S6 kinase beta-1; kinase domain,	92.28
3cc6_A	281	Protein tyrosine kinase 2 beta; focal adhesion kin	92.22
1q8y_A	373	SR protein kinase; transferase; HET: ADP ADE; 2.05	92.22
1cm8_A	367	Phosphorylated MAP kinase P38-gamma; phosphorylati	92.21
2rio_A	434	Serine/threonine-protein kinase/endoribonuclease I	92.18
3og7_A	289	AKAP9-BRAF fusion protein; proto-oncogene, V600E,	92.17
3kk8_A	284	Calcium/calmodulin dependent protein kinase II; AT	92.15
2wtk_C	305	Serine/threonine-protein kinase 11; transferase-me	92.13
1qcf_A	454	Haematopoetic cell kinase (HCK); tyrosine kinase-i	92.13
4eqm_A	294	Protein kinase; transferase; HET: ANP; 3.00A {Stap	92.12
1tki_A	321	Titin; serine kinase, muscle, autoinhibition; 2.00	92.12
2i0e_A	353	Protein kinase C-beta II; serine/threonine protein	92.11
4hcu_A	269	Tyrosine-protein kinase ITK/TSK; transferase-trans	92.11
4dc2_A	396	Protein kinase C IOTA type; kinase, substrate, cel	92.1
3a99_A	320	Proto-oncogene serine/threonine-protein kinase PI;	92.09
2r5t_A	373	Serine/threonine-protein kinase SGK1; AGC protein	92.08
3tt0_A	382	Basic fibroblast growth factor receptor 1; kinase	92.07
1xjd_A	345	Protein kinase C, theta type; PKC-theta, ATP, AMP,	92.07
2b9h_A	353	MAP kinase FUS3, mitogen-activated protein kinase	92.06
1rdq_E	350	PKA C-alpha, CAMP-dependent protein kinase, alpha-	92.05
1fvr_A	327	Tyrosine-protein kinase TIE-2; tyrosine kinase, tr	92.04
1zy4_A	303	Serine/threonine-protein kinase GCN2; translation	92.02
3is5_A	285	Calcium-dependent protein kinase; CDPK, structural	92.01
3ddt_A	48	E3 ubiquitin-protein ligase TRIM63; zinc-binding m	92.0
1ua2_A	346	CAK, cell division protein kinase 7; cell cycle, p	91.99
3p23_A	432	Serine/threonine-protein kinase/endoribonuclease;	91.99
2a19_B	284	Interferon-induced, double-stranded RNA-activated	91.95
3mi9_A	351	Cell division protein kinase 9; P-TEFB, HIV-1, pro	91.95
3pg1_A	362	Mitogen-activated protein kinase, putative (MAP K	91.95
2ycf_A	322	Serine/threonine-protein kinase CHK2; transferase,	91.94
4f0f_A	287	Serine/threonine-protein kinase ROCO4; LRRK2, ATP-	91.92
4agu_A	311	Cyclin-dependent kinase-like 1; transferase, phosp	91.9
3sxs_A	268	Cytoplasmic tyrosine-protein kinase BMX; transfera	91.9
2r3i_A	299	Cell division protein kinase 2; serine/threonine-p	91.89
3kul_A	325	Ephrin type-A receptor 8; ATP-binding, kinase, nuc	91.86
3hko_A	345	Calcium/calmodulin-dependent protein kinase with d	91.86
1zar_A	282	RIO2 kinase; serine kinase, winged-helix, RIO doma	91.85
3cek_A	313	Dual specificity protein kinase TTK; HMPS1, PYT, E	91.85
2fst_X	367	Mitogen-activated protein kinase 14; active mutant	91.84
3f3z_A	277	Calcium/calmodulin-dependent protein kinase with d	91.84
2xrw_A	371	Mitogen-activated protein kinase 8; transcription,	91.82
3fdn_A	279	Serine/threonine-protein kinase 6; aurora kinase i	91.82
2buj_A	317	Serine/threonine-protein kinase 16; transferase, A	91.79
3mtl_A	324	Cell division protein kinase 16; pctaire1, indirub	91.78
3kvw_A	429	DYRK2, dual specificity tyrosine-phosphorylation-r	91.78
3lb7_A	307	RAF proto-oncogene serine/threonine-protein kinas;	91.78
3tki_A	323	Serine/threonine-protein kinase CHK1; cell checkpo	91.76
3qyz_A	364	Mitogen-activated protein kinase 1; transferase, s	91.74
2qol_A	373	Ephrin receptor; receptor tyrosine kinase, juxtame	91.73
1fot_A	318	TPK1 delta, CAMP-dependent protein kinase type 1;	91.72
3cbl_A	377	C-FES, proto-oncogene tyrosine-protein kinase FES/	91.72
2y0a_A	326	Death-associated protein kinase 1; transferase, ca	91.71
3i6u_A	419	CDS1, serine/threonine-protein kinase CHK2; Ser/Th	91.71
3dls_A	335	PAS domain-containing serine/threonine-protein KI;	91.68
2yvr_A	50	Transcription intermediary factor 1-beta; ZF-B_BOX	91.63
3fme_A	290	Dual specificity mitogen-activated protein kinase;	91.61
3mdy_A	337	Bone morphogenetic protein receptor type-1B; compl	91.61
1qpc_A	279	LCK kinase; alpha beta fold, transferase; HET: PTR	91.6
3sv0_A	483	Casein kinase I-like; typical kinase domain fold,	91.6
4aw2_A	437	Serine/threonine-protein kinase MRCK alpha; transf	91.59
1u46_A	291	ACK-1, activated CDC42 kinase 1; tyrosine kinase,	91.59
3kfa_A	288	Tyrosine-protein kinase ABL1; CML, drug resistance	91.58
4ejn_A	446	RAC-alpha serine/threonine-protein kinase; AKT1, a	91.57
1xbb_A	291	Tyrosine-protein kinase SYK; gleevec, STI-571, ima	91.57
3nyv_A	484	Calmodulin-domain protein kinase 1; serine/threoni	91.56
3coi_A	353	Mitogen-activated protein kinase 13; P38D, P38delt	91.56
2qr7_A	342	Ribosomal protein S6 kinase alpha-3; kinase domain	91.54
2vd5_A	412	DMPK protein; serine/threonine-protein kinase, kin	91.52
2nru_A	307	Interleukin-1 receptor-associated kinase 4; inhibi	91.48
4eut_A	396	Serine/threonine-protein kinase TBK1; ATP binding,	91.47
2w4o_A	349	Calcium/calmodulin-dependent protein kinase type I	91.45
1zth_A	258	RIO1 serine protein kinase; ribosome biogenesis, r	91.44
2y4i_B	319	KSR2, HKSR2, kinase suppressor of RAS 2; transfera	91.44
3zgw_A	347	Maternal embryonic leucine zipper kinase; transfer	91.43
3en9_A	540	Glycoprotease, O-sialoglycoprotein endopeptidase/p	91.42
3v8s_A	410	RHO-associated protein kinase 1; dimerization, myo	91.42
4fr4_A	384	YANK1, serine/threonine-protein kinase 32A; struct	91.41
1blx_A	326	Cyclin-dependent kinase 6; inhibitor protein, cycl	91.4
2qkw_B	321	Protein kinase; three-helix bundle motif, AVRPTO-P	91.4
3cok_A	278	Serine/threonine-protein kinase PLK4; POLO-like ki	91.4
3gxj_A	303	TGF-beta receptor type-1; ALK5, kinase, inhibitor,	91.4
4exu_A	371	Mitogen-activated protein kinase 13; P38 kinase, t	91.37
2vwi_A	303	Serine/threonine-protein kinase OSR1; STE kinase,	91.36
2vgo_A	284	Serine/threonine-protein kinase 12-A; nucleotide-b	91.35
2yfx_A	327	Tyrosine-protein kinase receptor; nucleotide-bindi	91.34
2a2a_A	321	Death-associated protein kinase 2; autoinhibition,	91.31
3soa_A	444	Calcium/calmodulin-dependent protein kinase type a	91.3
3c1x_A	373	Hepatocyte growth factor receptor; receptor tyrosi	91.25
3mwu_A	486	Calmodulin-domain protein kinase 1; serine/threoni	91.23
2j7t_A	302	Serine/threonine-protein kinase 10; transferase, A	91.17
2did_A	53	Tripartite motif protein 39; ZF-B-box domian, Zn b	91.16
1u5q_A	348	Serine/threonine protein kinase TAO2; transferase;	91.16
2yab_A	361	Death-associated protein kinase 2; apoptosis, tran	91.16
1byg_A	278	CSK, protein (C-terminal SRC kinase); protein kina	91.12
3e3p_A	360	Protein kinase, putative glycogen synthase kinase;	91.1
2x4f_A	373	Myosin light chain kinase family member 4; LUNG, b	91.1
3fhr_A	336	MAP kinase-activated protein kinase 3; kinase-inhi	91.09
2pvf_A	334	Fibroblast growth factor receptor 2; kinase domain	91.03
2rku_A	294	Serine/threonine-protein kinase PLK1; structure of	91.01
1fmk_A	452	C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros	91.01
2iwi_A	312	Serine/threonine-protein kinase PIM-2; nucleotide-	91.0
3lm5_A	327	Serine/threonine-protein kinase 17B; STK17B, serin	91.0
1kob_A	387	Twitchin; kinase, intrasteric regulation; 2.30A {A	90.98
2h6d_A	276	5'-AMP-activated protein kinase catalytic subunit	90.98
1opk_A	495	P150, C-ABL, proto-oncogene tyrosine-protein kinas	90.95
2owb_A	335	Serine/threonine-protein kinase PLK1; catalytic do	90.94
3t9t_A	267	Tyrosine-protein kinase ITK/TSK; kinase domain, al	90.92
3p86_A	309	Serine/threonine-protein kinase CTR1; ETR1, ERS1,	90.92
2c30_A	321	Serine/threonine-protein kinase PAK 6; CRIB domain	90.89
2clq_A	295	Mitogen-activated protein kinase kinase kinase 5;	90.88
1fre_A	42	Nuclear factor XNF7; zinc-binding protein, BBOX, d	90.87
2yex_A	276	Serine/threonine-protein kinase CHK1; transferase,	90.84
2jam_A	304	Calcium/calmodulin-dependent protein kinase type 1	90.84
1u59_A	287	Tyrosine-protein kinase ZAP-70; transferase; HET:	90.81
1mqb_A	333	Ephrin type-A receptor 2; tyrosine protein kinase,	90.8
3lxl_A	327	Tyrosine-protein kinase JAK3; TYK2, inflammation,	90.78
4aaa_A	331	Cyclin-dependent kinase-like 2; transferase, phosp	90.75
3bhy_A	283	Death-associated protein kinase 3; death associate	90.71
1t4h_A	290	Serine/threonine-protein kinase WNK1; protein seri	90.66
1k9a_A	450	Carboxyl-terminal SRC kinase; COOH-terminal SRC ki	90.64
2ayu_A	417	Nucleosome assembly protein; histone chaperone; 3.	90.61
4fl3_A	635	Tyrosine-protein kinase SYK; transferase; HET: ANP	90.61
3lij_A	494	Calcium/calmodulin dependent protein kinase with A	90.57
3soc_A	322	Activin receptor type-2A; structural genomics cons	90.53
3dtc_A	271	Mitogen-activated protein kinase kinase kinase 9;	90.5
3pfq_A	674	PKC-B, PKC-beta, protein kinase C beta type; phosp	90.46
2x7f_A	326	TRAF2 and NCK-interacting protein kinase; serine/t	90.44
2h8h_A	535	Proto-oncogene tyrosine-protein kinase SRC; SRC ki	90.43
3h4j_B	336	AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin	90.33
3uim_A	326	Brassinosteroid insensitive 1-associated receptor;	90.19
1phk_A	298	Phosphorylase kinase; glycogen metabolism, transfe	90.19
3lxp_A	318	Non-receptor tyrosine-protein kinase TYK2; JAK3, i	90.11
2ozo_A	613	Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t	90.11
3an0_A	340	Dual specificity mitogen-activated protein kinase;	90.08
2pzi_A	681	Probable serine/threonine-protein kinase PKNG; ATP	89.93
2h34_A	309	Serine/threonine-protein kinase PKNE; apoenzyme, t	89.87
2w1i_A	326	JAK2; chromosomal rearrangement, nucleotide-bindin	89.78
2eva_A	307	TAK1 kinase - TAB1 chimera fusion protein; transfe	89.75
2wei_A	287	Calmodulin-domain protein kinase 1, putative; nucl	89.7
2wqm_A	310	Serine/threonine-protein kinase NEK7; ATP-binding,	89.67
3q5i_A	504	Protein kinase; CDPK, malaria, phosphotransferase,	89.63
3a7i_A	303	MST3 kinase, serine/threonine kinase 24 (STE20 hom	89.57
1b6c_B	342	TGF-B superfamily receptor type I; complex (isomer	89.23
3com_A	314	Serine/threonine-protein kinase 4; MST1, STE20-lik	89.21
2y94_A	476	5'-AMP-activated protein kinase catalytic subunit;	89.05
2acx_A	576	G protein-coupled receptor kinase 6; GRK, G transf	88.81
2y7j_A	365	Phosphorylase B kinase gamma catalytic chain, test	88.71
2dyl_A	318	Dual specificity mitogen-activated protein kinase	88.65
2vx3_A	382	Dual specificity tyrosine-phosphorylation- regula	88.64
2w5a_A	279	Serine/threonine-protein kinase NEK2; Ser/Thr prot	88.52
2pml_X	348	PFPK7, Ser/Thr protein kinase; phosphorylati trans	88.39
3c4z_A	543	Rhodopsin kinase; Ser/Thr kinase, RGS homology dom	88.29
3eqc_A	360	Dual specificity mitogen-activated protein kinase;	88.26
2j0j_A	656	Focal adhesion kinase 1; cell migration, FERM, tra	87.69
3aln_A	327	Dual specificity mitogen-activated protein kinase;	87.46
4gyi_A	397	RIO2 kinase; protein kinase, ADP complex, phosphoa	85.47
4fp9_B	335	Mterf domain-containing protein 2; modification en	85.34
2yrg_A	59	Tripartite motif-containing protein 5; B-box domai	84.44
2csv_A	72	Tripartite motif protein 29; ZF-B_BOX domain, TRIM	83.33
1weo_A	93	Cellulose synthase, catalytic subunit (IRX3); stru	80.45
2ffw_A	78	Midline-1; B-BOX, ring finger, zinc-finger, ligase	80.38

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}

Probab=98.59  E-value=2.8e-08  Score=75.56  Aligned_cols=85  Identities=16%  Similarity=0.236  Sum_probs=69.4

Q ss_pred             CCCCCCC---C-CceEEecCCCcccccccCcccccccccCCccccc-ccc------cccccCCCCceecccCCCCcccCc
Q 024658            2 RKCELCE---C-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRC-LLC------HVCQSLTPWKASGPKLGPTVSVCD   70 (264)
Q Consensus         2 ~~Cd~C~---~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~Rv-pLC------~~C~~~p~~ka~~~C~~d~~~LC~   70 (264)
                      ..|++|.   . +|+++|-.+.+.||..|...+|..++.+++|..+ ++-      ..|+.|+..+..+||..|...+|.
T Consensus         4 ~~C~~C~~~~~~~av~~C~~C~~~~C~~Cl~~~h~~~~~~~~h~l~~~~~~~~~~~~~C~~H~~e~l~~fC~~~~~~iC~   83 (101)
T 2jun_A            4 VLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHEDEKVNMYCVTDDQLICA   83 (101)
T ss_dssp             CBCTTCCSSSCCBCCEEETTTTEEECHHHHHHHSCSCSSSTTCCBSSCCCSCCSSCCCCSSCSSSCCCEEETTTTEEECH
T ss_pred             CCCcCCCCCCCCCceEECCcCChHHhHHHCHHHhccCCccCCCeeeccccccCccCCcCcCcCCCcceEECCCCCCccch
Confidence            4799997   3 7999999999999999999999988878899876 332      369999877899999999999999


Q ss_pred             hhhhcccCCCCCCccc
Q 024658           71 ACVAAARCGVNDDDKA   86 (264)
Q Consensus        71 ~Cd~~~n~~~H~r~pV   86 (264)
                      .|...+.-.+|.-++|
T Consensus        84 ~C~~~~~H~~H~~~~l   99 (101)
T 2jun_A           84 LCKLVGRHRDHQVAAL   99 (101)
T ss_dssp             HHHHHTTTSSSCBCCC
T ss_pred             hcCCCCCcCCCCeecC
Confidence            9997443345654443

>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A*

Probab=96.30  E-value=0.0011  Score=58.90  Aligned_cols=27  Identities=11%  Similarity=0.081  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.|||++.|+|||+|++|||
T Consensus       124 ~~qi~~al~ylH~~~IiHRDlKp~NIL  150 (299)
T 4g31_A          124 FLQIAEAVEFLHSKGLMHRDLKPSNIF  150 (299)
T ss_dssp             HHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHCcCccccCcHHHeE
Confidence            468999999999999999999999997

>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A*

Probab=95.97  E-value=0.002  Score=59.10  Aligned_cols=29  Identities=10%  Similarity=0.047  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||+|++|||
T Consensus       154 ~~~~qi~~aL~ylH~~~IiHRDlKp~NIL  182 (336)
T 4g3f_A          154 YYLGQALEGLEYLHTRRILHGDVKADNVL  182 (336)
T ss_dssp             HHHHHHHHHHHHHHTTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCceecccCHHHEE
Confidence            34578999999999999999999999997

>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A

Probab=95.77  E-value=0.0026  Score=56.61  Aligned_cols=31  Identities=10%  Similarity=0.057  Sum_probs=27.7

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...-..+|+.+|.|||++.|+|||+|++|||
T Consensus       114 ~~~~~~qi~~al~ylH~~~IiHRDiKP~NIL  144 (275)
T 3hyh_A          114 ARRFFQQIISAVEYCHRHKIVHRDLKPENLL  144 (275)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCCCCCTTTEE
T ss_pred             HHHHHHHHHHHHHHHHHCCcccccCChHHeE
Confidence            3345689999999999999999999999997

>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A*

Probab=95.74  E-value=0.0031  Score=56.30  Aligned_cols=30  Identities=13%  Similarity=0.091  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|..+|.|||++.|+|||.|++|||
T Consensus       131 ~~i~~qia~gl~yLH~~~iiHRDlKp~NIL  160 (299)
T 4asz_A          131 LHIAQQIAAGMVYLASQHFVHRDLATRNCL  160 (299)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHhCCcccCccCHhhEE
Confidence            345679999999999999999999999996

>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A*

Probab=95.73  E-value=0.0026  Score=58.73  Aligned_cols=28  Identities=11%  Similarity=0.131  Sum_probs=26.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.|||++.|+|||+|++|||
T Consensus       130 ~~~qi~~aL~ylH~~~IiHRDlKp~NIL  157 (350)
T 4b9d_A          130 WFVQICLALKHVHDRKILHRDIKSQNIF  157 (350)
T ss_dssp             HHHHHHHHHHHHHHTTCEETTCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeeeccCCHHHEE
Confidence            4579999999999999999999999997

>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus}

Probab=95.73  E-value=0.0033  Score=56.23  Aligned_cols=28  Identities=18%  Similarity=0.200  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.|||++.  |+|||+|++|||
T Consensus       134 ~~~qi~~aL~ylH~~~~~IiHRDlKp~NIL  163 (290)
T 3fpq_A          134 WCRQILKGLQFLHTRTPPIIHRDLKCDNIF  163 (290)
T ss_dssp             HHHHHHHHHHHHHTSSSCCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCCEEecccChhhee
Confidence            4578999999999888  999999999996

>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A*

Probab=95.73  E-value=0.0028  Score=57.86  Aligned_cols=29  Identities=3%  Similarity=0.107  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|+|||++.|+|||+|++|||
T Consensus       121 ~~~~qll~al~ylH~~gIiHRDiKPeNiL  149 (361)
T 4f9c_A          121 EYMLNLFKALKRIHQFGIVHRDVKPSNFL  149 (361)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeEeCcCCHHHeE
Confidence            44578999999999999999999999998

>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens}

Probab=95.72  E-value=0.0026  Score=57.38  Aligned_cols=30  Identities=7%  Similarity=0.105  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|..+|.|||++.|+|||.|++|||
T Consensus       135 ~~i~~qia~gL~yLH~~~IiHRDlKp~NIL  164 (307)
T 3omv_A          135 IDIARQTAQGMDYLHAKNIIHRDMKSNNIF  164 (307)
T ss_dssp             HHHHHHHHHHHHHHHHTTCBCSCCCSSSEE
T ss_pred             HHHHHHHHHHHHHHHHCCccCCccCHHHEE
Confidence            344578999999999999999999999996

>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ...

Probab=95.72  E-value=0.0028  Score=57.69  Aligned_cols=29  Identities=17%  Similarity=0.192  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||+|++|||
T Consensus       136 ~~~~qi~~al~ylH~~~IiHRDlKPeNIL  164 (311)
T 4aw0_A          136 FYTAEIVSALEYLHGKGIIHRDLKPENIL  164 (311)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCccCCCCHHHeE
Confidence            34579999999999999999999999997

>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A*

Probab=95.71  E-value=0.0028  Score=58.48  Aligned_cols=29  Identities=17%  Similarity=0.208  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||+|++|||
T Consensus       174 ~~~~qi~~aL~ylH~~~IiHRDlKp~NIL  202 (346)
T 4fih_A          174 AVCLAVLQALSVLHAQGVIHRDIKSDSIL  202 (346)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccccCCHHHEE
Confidence            34578999999999999999999999997

>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A*

Probab=95.66  E-value=0.0033  Score=56.75  Aligned_cols=29  Identities=10%  Similarity=-0.002  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||.|++|||
T Consensus       130 ~~~~qi~~aL~ylH~~~IiHRDlKp~NIL  158 (304)
T 3ubd_A          130 FYLAELALALDHLHSLGIIYRDLKPENIL  158 (304)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSSCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCcCCCCCHHHeE
Confidence            34578999999999999999999999997

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*

Probab=95.65  E-value=0.003  Score=61.03  Aligned_cols=27  Identities=15%  Similarity=0.155  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|++|||
T Consensus       345 ~~QIl~AL~ylH~~GIIHRDIKPeNIL  371 (569)
T 4azs_A          345 LGSLLRSLAALEKQGFWHDDVRPWNVM  371 (569)
T ss_dssp             HHHHHHHHHHHHHTTCEESCCCGGGEE
T ss_pred             HHHHHHHHHHHHHCCceeccCchHhEE
Confidence            379999999999999999999999995

>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens}

Probab=95.58  E-value=0.0038  Score=57.95  Aligned_cols=29  Identities=3%  Similarity=0.061  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||+|++|||
T Consensus       162 ~~~~qil~al~ylH~~~iiHRDlKP~NIl  190 (398)
T 4b99_A          162 YFLYQLLRGLKYMHSAQVIHRDLKPSNLL  190 (398)
T ss_dssp             HHHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCcCcCCCcCccccc
Confidence            44679999999999999999999999997

>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A*

Probab=95.44  E-value=0.0045  Score=56.67  Aligned_cols=29  Identities=17%  Similarity=0.098  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|..+|.|||++.|+|||.|++|||
T Consensus       189 ~~~~qia~gl~yLH~~~iiHRDLK~~NIL  217 (353)
T 4ase_A          189 CYSFQVAKGMEFLASRKCIHRDLAARNIL  217 (353)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHhHhhCCeecCccCcccee
Confidence            34578999999999999999999999996

>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens}

Probab=95.39  E-value=0.0049  Score=55.73  Aligned_cols=30  Identities=7%  Similarity=0.064  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|..+|.|||++.|+|||.|++|||
T Consensus       161 ~~i~~qia~gl~yLH~~~iiHRDLKp~NIL  190 (329)
T 4aoj_A          161 LAVASQVAAGMVYLAGLHFVHRDLATRNCL  190 (329)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhcCCeecccccHhhEE
Confidence            345678999999999999999999999996

>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A

Probab=95.38  E-value=0.0049  Score=55.22  Aligned_cols=29  Identities=10%  Similarity=0.122  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|..+|.|||++.|+|||.|++|||
T Consensus       149 ~i~~qia~gl~yLH~~~iiHRDLK~~NIL  177 (308)
T 4gt4_A          149 HLVAQIAAGMEYLSSHHVVHKDLATRNVL  177 (308)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCCCCCCccccceE
Confidence            34578999999999999999999999997

>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens}

Probab=95.37  E-value=0.0039  Score=59.12  Aligned_cols=29  Identities=17%  Similarity=0.208  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||+|+.|||
T Consensus       251 ~~~~qil~aL~ylH~~~IiHRDiKp~NIL  279 (423)
T 4fie_A          251 AVCLAVLQALSVLHAQGVIHRDIKSDSIL  279 (423)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSTTTEE
T ss_pred             HHHHHHHHHHHHHHHCCeecccCCHHHEE
Confidence            34578999999999999999999999997

>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens}

Probab=94.77  E-value=0.0095  Score=52.30  Aligned_cols=29  Identities=3%  Similarity=0.038  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       176 ~i~~qi~~~L~~lH~~~ivHrDiKp~NIl  204 (365)
T 3e7e_A          176 SFAMRMLYMIEQVHDCEIIHGDIKPDNFI  204 (365)
T ss_dssp             HHHHHHHHHHHHHHTTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhhCCeecCCCCHHHEE
Confidence            45678999999999999999999999996

>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A*

Probab=94.55  E-value=0.012  Score=52.00  Aligned_cols=29  Identities=14%  Similarity=0.130  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccc--------cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ--------TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~--------~i~~~d~~~a~i~  252 (264)
                      .-..+|..+|.|||++        .|+|||.|++|||
T Consensus       104 ~i~~~ia~gl~ylH~~~~~~~~~~~IiHRDlKp~NIL  140 (303)
T 3hmm_A          104 KLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL  140 (303)
T ss_dssp             HHHHHHHHHHHHHHCCBCSTTCBCCEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHhhhhccCCCCEeeccCCcccEE
Confidence            3456899999999977        8999999999997

>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A

Probab=94.42  E-value=0.012  Score=51.00  Aligned_cols=31  Identities=10%  Similarity=-0.009  Sum_probs=27.5

Q ss_pred             CcchhHHHHHHhhhhc-cccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQ-NQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~-~~~i~~~d~~~a~i~  252 (264)
                      ...-..+|+.+|.+|| ++.|+|||+|+.|||
T Consensus       163 ~~~i~~qi~~aL~~lH~~~~ivHrDlKp~NIL  194 (336)
T 2vuw_A          163 AKSILHQLTASLAVAEASLRFEHRDLHWGNVL  194 (336)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCBCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHHHhCCEeECCCCHHHEE
Confidence            3345678999999999 999999999999998

>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii}

Probab=94.33  E-value=0.013  Score=53.30  Aligned_cols=26  Identities=15%  Similarity=0.123  Sum_probs=25.1

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+|+.+|.+||++.|+|||+|++|||
T Consensus       218 ~qi~~aL~~LH~~~iiHrDiKp~NIL  243 (413)
T 3dzo_A          218 LQVIRLLASLHHYGLVHTYLRPVDIV  243 (413)
T ss_dssp             HHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHhCCcccCCcccceEE
Confidence            78999999999999999999999997

>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A*

Probab=94.22  E-value=0.013  Score=51.68  Aligned_cols=27  Identities=11%  Similarity=0.128  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       200 ~~qi~~aL~~LH~~~ivHrDikp~NIl  226 (371)
T 3q60_A          200 TAQLIRLAANLQSKGLVHGHFTPDNLF  226 (371)
T ss_dssp             HHHHHHHHHHHHHTTEEETTCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCCccCcCCHHHEE
Confidence            379999999999999999999999997

>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A*

Probab=94.09  E-value=0.015  Score=47.73  Aligned_cols=28  Identities=11%  Similarity=0.051  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       120 i~~qi~~al~~lH~~~ivH~Dikp~NIl  147 (289)
T 1x8b_A          120 LLLQVGRGLRYIHSMSLVHMDIKPSNIF  147 (289)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEeecCCCHHHEE
Confidence            3578999999999999999999999997

>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii}

Probab=94.06  E-value=0.017  Score=52.55  Aligned_cols=28  Identities=4%  Similarity=0.007  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|+|||.|+.|||
T Consensus       161 ~~~qi~~aL~~LH~~~iiHrDlKp~NIL  188 (458)
T 3rp9_A          161 LLYNLLVGVKYVHSAGILHRDLKPANCL  188 (458)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCcCCCCCChhhEE
Confidence            4578999999999999999999999997

>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A

Probab=93.98  E-value=0.017  Score=50.86  Aligned_cols=29  Identities=14%  Similarity=0.117  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       156 ~i~~qi~~~l~~lH~~~iiHrDlkp~Nil  184 (364)
T 3op5_A          156 QLSLRILDILEYIHEHEYVHGDIKASNLL  184 (364)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeEEecCCHHHEE
Confidence            34578999999999999999999999997

>2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1

Probab=93.97  E-value=0.031  Score=38.93  Aligned_cols=38  Identities=16%  Similarity=0.142  Sum_probs=29.1

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|+.|+..+..+||..|..++|..|...+.-..|.-+|
T Consensus        10 ~C~~H~~e~l~lfC~~d~~~iC~~C~~~~~H~~H~~~~   47 (64)
T 2d8u_A           10 MCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAP   47 (64)
T ss_dssp             CCSSCTTCCCCSEESSSCCCCCSHHHHSSSTTSSCEEC
T ss_pred             cCcCcCCCccceEcCcCCceeCccccCCCcCCCCCeeC
Confidence            47888778899999999999999998754323454433

>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus}

Probab=93.92  E-value=0.018  Score=48.63  Aligned_cols=28  Identities=11%  Similarity=0.058  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       169 i~~qi~~aL~~LH~~~ivH~Dlkp~NIl  196 (332)
T 3qd2_B          169 IFIQIAEAVEFLHSKGLMHRDLKPSNIF  196 (332)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeecCCCcccEE
Confidence            4578999999999999999999999996

>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A

Probab=93.91  E-value=0.018  Score=49.53  Aligned_cols=29  Identities=3%  Similarity=0.032  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       133 ~i~~ql~~aL~~lH~~givH~Dikp~NIl  161 (286)
T 3uqc_A          133 RAMQSLAAAADAAHRAGVALSIDHPSRVR  161 (286)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCccCCCCcccEE
Confidence            34578999999999999999999999997

>2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A

Probab=93.83  E-value=0.041  Score=40.27  Aligned_cols=39  Identities=13%  Similarity=0.135  Sum_probs=29.8

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCccc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKA   86 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~pV   86 (264)
                      .|+.|+..+..+||..|...+|..|...+.-.+|.-+||
T Consensus        20 ~C~~H~~e~l~lfC~~d~~~iC~~C~~~~~H~~H~~~~l   58 (84)
T 2dja_A           20 TCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVASL   58 (84)
T ss_dssp             CCSSCSSSCCCEEETTTTEEECHHHHHTSTTTTCCBCCC
T ss_pred             cCcCcCCccccEEcCCCCceEcccCcCCCCCCCCCccCH
Confidence            688887677999999999999999998443344544443

>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A

Probab=93.82  E-value=0.019  Score=58.15  Aligned_cols=28  Identities=21%  Similarity=0.209  Sum_probs=26.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.|||++.|+|||+|+.|||
T Consensus       297 y~~qIl~aL~yLH~~gIiHRDLKPeNIL  324 (689)
T 3v5w_A          297 YAAEIILGLEHMHNRFVVYRDLKPANIL  324 (689)
T ss_dssp             HHHHHHHHHHHHHTTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCCchHHeE
Confidence            3578999999999999999999999997

>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A*

Probab=93.81  E-value=0.018  Score=49.99  Aligned_cols=28  Identities=11%  Similarity=0.118  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++ .|+|||+|++|||
T Consensus       151 i~~qi~~aL~~lH~~~givHrDikp~NIl  179 (397)
T 1wak_A          151 IIQQVLQGLDYLHTKCRIIHTDIKPENIL  179 (397)
T ss_dssp             HHHHHHHHHHHHHHTTCEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCEecCCCCHHHee
Confidence            457899999999999 9999999999998

>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A

Probab=93.78  E-value=0.018  Score=55.67  Aligned_cols=30  Identities=10%  Similarity=0.077  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.|||++.|+|||+|+.|||
T Consensus       258 ~~~~~qi~~al~ylH~~~iiHRDlKp~Nil  287 (573)
T 3uto_A          258 VEYMRQVCKGLCHMHENNYVHLDLKPENIM  287 (573)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHHCCeeeccCChhhcc
Confidence            344578999999999999999999999997

>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7}

Probab=93.77  E-value=0.019  Score=49.81  Aligned_cols=28  Identities=18%  Similarity=0.203  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       142 i~~qi~~aL~~LH~~~ivHrDlkp~NIl  169 (360)
T 3llt_A          142 YCIEILKALNYLRKMSLTHTDLKPENIL  169 (360)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeeeCCCCcccEE
Confidence            3568999999999999999999999997

>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A

Probab=93.76  E-value=0.02  Score=47.65  Aligned_cols=29  Identities=7%  Similarity=0.121  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       109 ~i~~qi~~~l~~LH~~~ivH~Dlkp~NIl  137 (296)
T 4hgt_A          109 LLADQMISRIEYIHSKNFIHRDVKPDNFL  137 (296)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHee
Confidence            44578999999999999999999999998

>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A*

Probab=93.73  E-value=0.022  Score=48.55  Aligned_cols=29  Identities=17%  Similarity=0.164  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       127 ~i~~qi~~~L~~lH~~~ivH~Dlkp~NIl  155 (355)
T 2eu9_A          127 HMAYQLCHALRFLHENQLTHTDLKPENIL  155 (355)
T ss_dssp             HHHHHHHHHHHHHHTTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            34578999999999999999999999997

>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A

Probab=93.70  E-value=0.02  Score=50.71  Aligned_cols=28  Identities=14%  Similarity=0.106  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       211 i~~qi~~aL~~LH~~~ivHrDikp~NIl  238 (377)
T 3byv_A          211 LTLQVIRLLASLHHYGLVHTYLRPVDIV  238 (377)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            4578999999999999999999999997

>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ...

Probab=93.62  E-value=0.023  Score=49.20  Aligned_cols=28  Identities=14%  Similarity=0.202  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       122 ~~~qi~~~l~~LH~~~ivH~Dikp~NIl  149 (327)
T 3poz_A          122 WCVQIAKGMNYLEDRRLVHRDLAARNVL  149 (327)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhCCeeCCCCChheEE
Confidence            4578999999999999999999999997

>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A*

Probab=93.59  E-value=0.022  Score=49.17  Aligned_cols=29  Identities=7%  Similarity=0.092  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       109 ~i~~qi~~~l~~LH~~~iiHrDlkp~Nil  137 (330)
T 2izr_A          109 MIAIQLISRMEYVHSKNLIYRDVKPENFL  137 (330)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeccCCCHHHee
Confidence            34578999999999999999999999997

>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II}

Probab=93.58  E-value=0.021  Score=50.71  Aligned_cols=28  Identities=11%  Similarity=0.124  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|||.|+.|||
T Consensus       114 i~~qi~~~L~~LH~~~ivHrDlkp~NIl  141 (388)
T 3oz6_A          114 VVYQLIKVIKYLHSGGLLHRDMKPSNIL  141 (388)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEEeCCCCHHHeE
Confidence            3468999999999999999999999996

>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A*

Probab=93.57  E-value=0.023  Score=47.43  Aligned_cols=29  Identities=0%  Similarity=0.158  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       110 ~i~~qi~~~l~~lH~~~ivH~Dlkp~NIl  138 (298)
T 1csn_A          110 MAAKQMLARVQSIHEKSLVYRDIKPDNFL  138 (298)
T ss_dssp             HHHHHHHHHHHHHHTTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            44578999999999999999999999997

>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A*

Probab=93.53  E-value=0.025  Score=48.87  Aligned_cols=29  Identities=17%  Similarity=0.098  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       197 ~~~~ql~~aL~~LH~~~ivH~Dikp~NIl  225 (359)
T 3vhe_A          197 CYSFQVAKGMEFLASRKCIHRDLAARNIL  225 (359)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCChhhEE
Confidence            34578999999999999999999999996

>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A*

Probab=93.52  E-value=0.025  Score=47.14  Aligned_cols=29  Identities=14%  Similarity=0.126  Sum_probs=26.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||=
T Consensus       118 i~~qi~~~L~~LH~~~ivH~Dlkp~NIll  146 (289)
T 4fvq_A          118 VAKQLAAAMHFLEENTLIHGNVCAKNILL  146 (289)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEEE
T ss_pred             HHHHHHHHHHHHhhCCeECCCcCcceEEE
Confidence            45789999999999999999999999983

>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A*

Probab=93.45  E-value=0.024  Score=47.81  Aligned_cols=29  Identities=17%  Similarity=0.123  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       122 ~~~~qi~~~l~~lH~~~ivH~Dlkp~Nil  150 (339)
T 1z57_A          122 KMAYQICKSVNFLHSNKLTHTDLKPENIL  150 (339)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCcCCCCCHHHEE
Confidence            34578999999999999999999999997

>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A

Probab=93.42  E-value=0.025  Score=47.65  Aligned_cols=29  Identities=3%  Similarity=0.036  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       104 ~~~~qi~~~l~~lH~~~i~H~dlkp~Nil  132 (288)
T 1ob3_A          104 SFLLQLLNGIAYCHDRRVLHRDLKPQNLL  132 (288)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34578999999999999999999999997

>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens}

Probab=93.40  E-value=0.025  Score=49.30  Aligned_cols=29  Identities=7%  Similarity=0.123  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       112 ~i~~qi~~al~~lH~~~iiHrDikp~NIl  140 (343)
T 3dbq_A          112 SYWKNMLEAVHTIHQHGIVHSDLKPANFL  140 (343)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCcceEE
Confidence            34578999999999999999999999997

>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B*

Probab=93.25  E-value=0.026  Score=49.92  Aligned_cols=28  Identities=11%  Similarity=0.122  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       133 ~~~qi~~~l~~LH~~~ivHrDlkp~NIl  160 (389)
T 3gni_B          133 ILQGVLKALDYIHHMGYVHRSVKASHIL  160 (389)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            3468999999999999999999999997

>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A

Probab=93.25  E-value=0.027  Score=47.45  Aligned_cols=29  Identities=7%  Similarity=0.005  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       105 ~~~~ql~~~l~~lH~~~ivH~dikp~Nil  133 (292)
T 3o0g_A          105 SFLFQLLKGLGFCHSRNVLHRDLKPQNLL  133 (292)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999997

>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ...

Probab=93.23  E-value=0.027  Score=51.21  Aligned_cols=27  Identities=7%  Similarity=0.052  Sum_probs=25.4

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       162 ~~qi~~aL~~LH~~~ivHrDlkp~NIL  188 (420)
T 1j1b_A          162 MYQLFRSLAYIHSFGICHRDIKPQNLL  188 (420)
T ss_dssp             HHHHHHHHHHHHTTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCccccCCChhhEE
Confidence            468999999999999999999999997

>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ...

Probab=93.19  E-value=0.026  Score=48.08  Aligned_cols=28  Identities=7%  Similarity=0.043  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       135 ~~~qi~~~l~~lH~~~ivH~Dikp~Nil  162 (330)
T 3nsz_A          135 YMYEILKALDYCHSMGIMHRDVKPHNVM  162 (330)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            3568999999999999999999999997

>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A*

Probab=93.19  E-value=0.027  Score=48.63  Aligned_cols=29  Identities=17%  Similarity=0.177  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       119 ~~~~qi~~~l~~lH~~~ivH~Dikp~Nil  147 (325)
T 3kex_A          119 NWGVQIAKGMYYLEEHGMVHRNLAARNVL  147 (325)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSSTTEE
T ss_pred             HHHHHHHHHHHHHHhCCCCCCccchheEE
Confidence            34578999999999999999999999997

>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A

Probab=93.18  E-value=0.027  Score=47.00  Aligned_cols=29  Identities=7%  Similarity=0.121  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       109 ~i~~qi~~~l~~lH~~~ivH~dlkp~NIl  137 (296)
T 3uzp_A          109 LLADQMISRIEYIHSKNFIHRDVKPDNFL  137 (296)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeeCCCCHHHeE
Confidence            34578999999999999999999999997

>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A

Probab=93.16  E-value=0.029  Score=47.50  Aligned_cols=28  Identities=18%  Similarity=0.164  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       116 i~~qi~~~l~~lH~~~ivH~dlkp~Nil  143 (316)
T 2ac3_A          116 VVQDVASALDFLHNKGIAHRDLKPENIL  143 (316)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCceeCCCCHHHEE
Confidence            3478999999999999999999999998

>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens}

Probab=93.16  E-value=0.027  Score=47.85  Aligned_cols=29  Identities=10%  Similarity=0.082  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       124 ~i~~qi~~al~~lH~~~ivH~Dlkp~Nil  152 (308)
T 3g33_A          124 DLMRQFLRGLDFLHANCIVHRDLKPENIL  152 (308)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCTTTEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            34578999999999999999999999997

>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens}

Probab=93.14  E-value=0.027  Score=48.40  Aligned_cols=28  Identities=18%  Similarity=0.110  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       162 i~~qi~~aL~~LH~~~ivH~Dikp~NIl  189 (311)
T 3p1a_A          162 YLRDTLLALAHLHSQGLVHLDVKPANIF  189 (311)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEecCCCCHHHEE
Confidence            3468999999999999999999999996

>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A*

Probab=93.14  E-value=0.031  Score=50.33  Aligned_cols=28  Identities=4%  Similarity=0.101  Sum_probs=26.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       160 i~~qi~~aL~~lH~~~ivHrDlkp~NIl  187 (390)
T 2zmd_A          160 YWKNMLEAVHTIHQHGIVHSDLKPANFL  187 (390)
T ss_dssp             HHHHHHHHHHHHHTTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeeecCCCHHHEE
Confidence            4578999999999999999999999997

>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens}

Probab=93.07  E-value=0.032  Score=48.56  Aligned_cols=28  Identities=14%  Similarity=0.202  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       122 i~~qi~~aL~~LH~~~ivH~Dikp~NIl  149 (327)
T 3lzb_A          122 WCVQIAKGMNYLEDRRLVHRDLAARNVL  149 (327)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhCCCcCCCCCHHHEE
Confidence            3578999999999999999999999997

>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens}

Probab=93.06  E-value=0.028  Score=47.44  Aligned_cols=29  Identities=10%  Similarity=0.091  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       141 ~~~~qi~~~l~~lH~~~ivH~Dlkp~Nil  169 (298)
T 2zv2_A          141 FYFQDLIKGIEYLHYQKIIHRDIKPSNLL  169 (298)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            34568999999999999999999999997

>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens}

Probab=93.04  E-value=0.032  Score=49.59  Aligned_cols=28  Identities=14%  Similarity=0.074  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       186 i~~qi~~aL~~LH~~~ivHrDlkp~NIl  213 (367)
T 3l9p_A          186 VARDIACGCQYLEENHFIHRDIAARNCL  213 (367)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCChhhEE
Confidence            4578999999999999999999999997

>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus}

Probab=93.02  E-value=0.032  Score=47.58  Aligned_cols=29  Identities=14%  Similarity=0.072  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       141 ~i~~qi~~al~~LH~~~ivH~Dikp~NIl  169 (323)
T 3qup_A          141 RFMVDIACGMEYLSSRNFIHRDLAARNCM  169 (323)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHcCCcccCCCCcceEE
Confidence            34578999999999999999999999996

>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens}

Probab=93.01  E-value=0.032  Score=49.86  Aligned_cols=29  Identities=17%  Similarity=0.094  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       132 ~i~~qi~~al~~LH~~~ivH~Dlkp~NIl  160 (405)
T 3rgf_A          132 SLLYQILDGIHYLHANWVLHRDLKPANIL  160 (405)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCEeCCCcCHHHeE
Confidence            34578999999999999999999999997

>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A*

Probab=93.00  E-value=0.032  Score=46.69  Aligned_cols=27  Identities=15%  Similarity=0.192  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.|||
T Consensus       122 ~~qi~~~l~~lH~~~i~H~dlkp~Nil  148 (281)
T 1mp8_A          122 AYQLSTALAYLESKRFVHRDIAARNVL  148 (281)
T ss_dssp             HHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhCCeecccccHHHEE
Confidence            468999999999999999999999997

>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens}

Probab=92.97  E-value=0.033  Score=49.79  Aligned_cols=28  Identities=18%  Similarity=0.150  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       129 ~~~qi~~aL~~LH~~givHrDlkp~NIL  156 (353)
T 3txo_A          129 YAAEIISALMFLHDKGIIYRDLKLDNVL  156 (353)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCcccCCCHHHEE
Confidence            3578999999999999999999999996

>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens}

Probab=92.96  E-value=0.035  Score=46.54  Aligned_cols=28  Identities=7%  Similarity=0.096  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       125 ~~~qi~~~l~~lH~~~i~H~dlkp~Nil  152 (320)
T 2i6l_A          125 FMYQLLRGLKYIHSANVLHRDLKPANLF  152 (320)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            3578999999999999999999999996

>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A

Probab=92.90  E-value=0.03  Score=49.30  Aligned_cols=27  Identities=11%  Similarity=0.206  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       136 ~~qi~~al~~lH~~~ivHrDlkp~NIl  162 (351)
T 3c0i_A          136 MRQILEALRYCHDNNIIHRDVKPHCVL  162 (351)
T ss_dssp             HHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCceeccCChHHeE
Confidence            468999999999999999999999998

>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A*

Probab=92.89  E-value=0.033  Score=48.22  Aligned_cols=28  Identities=4%  Similarity=-0.043  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       137 i~~ql~~~l~~LH~~~ivH~Dlkp~NIl  164 (329)
T 3gbz_A          137 FLYQLINGVNFCHSRRCLHRDLKPQNLL  164 (329)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEECCCCCHHHEE
Confidence            3568999999999999999999999997

>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A*

Probab=92.89  E-value=0.033  Score=46.87  Aligned_cols=29  Identities=21%  Similarity=0.125  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       154 ~i~~qi~~~l~~lH~~~ivH~dikp~NIl  182 (314)
T 2ivs_A          154 SFAWQISQGMQYLAEMKLVHRDLAARNIL  182 (314)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCcccccchheEE
Confidence            34578999999999999999999999997

>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A*

Probab=92.89  E-value=0.032  Score=50.86  Aligned_cols=29  Identities=3%  Similarity=-0.060  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||.|++|||
T Consensus       133 ~i~~qil~aL~~LH~~givHrDlkp~NIL  161 (432)
T 3n9x_A          133 TILYNLLLGENFIHESGIIHRDLKPANCL  161 (432)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHeE
Confidence            44578999999999999999999999997

>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A

Probab=92.86  E-value=0.032  Score=49.74  Aligned_cols=28  Identities=14%  Similarity=0.101  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       208 i~~qi~~aL~~LH~~~ivHrDlkp~NIl  235 (370)
T 2psq_A          208 CTYQLARGMEYLASQKCIHRDLAARNVL  235 (370)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeccccchhhEE
Confidence            3578999999999999999999999997

>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ...

Probab=92.85  E-value=0.036  Score=46.57  Aligned_cols=28  Identities=14%  Similarity=0.126  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~~~qi~~~l~~lH~~~ivH~Dikp~Nil  146 (295)
T 3ugc_A          119 YTSQICKGMEYLGTKRYIHRDLATRNIL  146 (295)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhcCCcccCCCCHhhEE
Confidence            3568999999999999999999999997

>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7

Probab=92.85  E-value=0.037  Score=46.21  Aligned_cols=28  Identities=14%  Similarity=0.082  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       129 i~~qi~~~l~~LH~~~i~H~dikp~Nil  156 (298)
T 3pls_A          129 FGLQVARGMEYLAEQKFVHRDLAARNCM  156 (298)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCcceEE
Confidence            3468999999999999999999999997

>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7

Probab=92.79  E-value=0.036  Score=47.40  Aligned_cols=28  Identities=7%  Similarity=0.077  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       179 i~~qi~~~l~~LH~~~ivH~Dlkp~NIl  206 (343)
T 1luf_A          179 IARQVAAGMAYLSERKFVHRDLATRNCL  206 (343)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCcceEE
Confidence            4578999999999999999999999997

>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A*

Probab=92.75  E-value=0.033  Score=47.99  Aligned_cols=28  Identities=0%  Similarity=0.016  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       124 ~~~qi~~~l~~LH~~~ivH~Dikp~NIl  151 (311)
T 3niz_A          124 YLYQLLRGVAHCHQHRILHRDLKPQNLL  151 (311)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCcccCCCchHhEE
Confidence            3578999999999999999999999997

>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ...

Probab=92.73  E-value=0.038  Score=49.11  Aligned_cols=28  Identities=14%  Similarity=0.175  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       110 ~~~qi~~aL~~LH~~~ivHrDlkp~NIl  137 (337)
T 1o6l_A          110 YGAEIVSALEYLHSRDVVYRDIKLENLM  137 (337)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeecCcCCHHHEE
Confidence            3478999999999999999999999997

>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens}

Probab=92.71  E-value=0.04  Score=47.11  Aligned_cols=28  Identities=7%  Similarity=0.163  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccc---------cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ---------TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~---------~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++         .|+|+|+|++|||
T Consensus       116 i~~qi~~~L~~LH~~~~~~~~~~~~ivH~Dikp~Nil  152 (336)
T 3g2f_A          116 LAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVL  152 (336)
T ss_dssp             HHHHHHHHHHHHHCCBCCGGGCBCCEECSSCSGGGEE
T ss_pred             HHHHHHHHHHHHHhhhccccccccceeecccccceEE
Confidence            346899999999999         9999999999997

>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7

Probab=92.69  E-value=0.037  Score=48.86  Aligned_cols=27  Identities=15%  Similarity=0.101  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       165 ~~qi~~aL~~LH~~~ivH~Dlkp~NIl  191 (355)
T 1vzo_A          165 VGEIVLALEHLHKLGIIYRDIKLENIL  191 (355)
T ss_dssp             HHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            457999999999999999999999997

>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A

Probab=92.68  E-value=0.037  Score=48.78  Aligned_cols=29  Identities=14%  Similarity=0.195  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||.++.|||
T Consensus       118 ~~~~qi~~al~~lH~~~ivHrDlkp~NIl  146 (328)
T 3fe3_A          118 SKFRQIVSAVQYCHQKRIVHRDLKAENLL  146 (328)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCEeccCCCHHHEE
Confidence            34578999999999999999999999997

>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A*

Probab=92.66  E-value=0.038  Score=47.23  Aligned_cols=29  Identities=10%  Similarity=0.014  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       120 ~~~~qi~~~l~~lH~~~ivH~dlkp~Nil  148 (311)
T 3ork_A          120 EVIADACQALNFSHQNGIIHRDVKPANIM  148 (311)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCCcCCCCHHHEE
Confidence            34578999999999999999999999997

>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens}

Probab=92.65  E-value=0.032  Score=47.40  Aligned_cols=29  Identities=14%  Similarity=0.079  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       112 ~i~~qi~~al~~lH~~~ivH~dlkp~Nil  140 (310)
T 3s95_A          112 SFAKDIASGMAYLHSMNIIHRDLNSHNCL  140 (310)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSTTSEE
T ss_pred             HHHHHHHHHHHHHHhCCccCCCCCcCeEE
Confidence            34578999999999999999999999997

>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A*

Probab=92.65  E-value=0.039  Score=46.13  Aligned_cols=29  Identities=17%  Similarity=0.165  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhc--------cccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQ--------NQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~--------~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||        ++.|+|+|.|+.|||
T Consensus       109 ~i~~~i~~~l~~lH~~~~~~~~~~~ivH~Dlkp~Nil  145 (301)
T 3q4u_A          109 RIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNIL  145 (301)
T ss_dssp             HHHHHHHHHHHHHHSCBCSTTCBCEEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHhhhhccCCCCeecCCCChHhEE
Confidence            34578999999999        999999999999997

>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A*

Probab=92.65  E-value=0.04  Score=48.93  Aligned_cols=28  Identities=14%  Similarity=0.065  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       115 ~~~qi~~aL~~LH~~~ivHrDlkp~NIl  142 (345)
T 3a8x_A          115 YSAEISLALNYLHERGIIYRDLKLDNVL  142 (345)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCceecCCCHHHEE
Confidence            3478999999999999999999999996

>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A

Probab=92.63  E-value=0.041  Score=45.82  Aligned_cols=28  Identities=11%  Similarity=0.105  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       125 i~~qi~~~l~~lH~~~i~H~dikp~Nil  152 (283)
T 3gen_A          125 MCKDVCEAMEYLESKQFLHRDLAARNCL  152 (283)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSSCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccCCCCccceEE
Confidence            3568899999999999999999999997

>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A*

Probab=92.60  E-value=0.043  Score=46.56  Aligned_cols=29  Identities=17%  Similarity=0.076  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       151 ~i~~qi~~aL~~LH~~~ivH~dikp~NIl  179 (313)
T 3brb_A          151 KFMVDIALGMEYLSNRNFLHRDLAARNCM  179 (313)
T ss_dssp             HHHHHHHHHHHHHHTTTCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCcceEE
Confidence            34578999999999999999999999997

>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A*

Probab=92.59  E-value=0.037  Score=51.41  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|||.|+.|||
T Consensus       169 ~~~qil~aL~~lH~~~iiHrDlkp~NIl  196 (464)
T 3ttj_A          169 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  196 (464)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCcccCCCChHhEE
Confidence            4578999999999999999999999997

>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A*

Probab=92.57  E-value=0.038  Score=46.94  Aligned_cols=29  Identities=7%  Similarity=0.079  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       121 ~i~~qi~~~l~~lH~~~i~H~dlkp~Nil  149 (299)
T 3m2w_A          121 EIMKSIGEAIQYLHSINIAHRDVKPENLL  149 (299)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            34578999999999999999999999997

>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens}

Probab=92.55  E-value=0.039  Score=47.22  Aligned_cols=28  Identities=7%  Similarity=0.176  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       117 i~~qi~~~L~~LH~~~ivH~Dlkp~NIl  144 (319)
T 4euu_A          117 VLRDVVGGMNHLRENGIVHRNIKPGNIM  144 (319)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEecCCCCHHHEE
Confidence            4578999999999999999999999997

>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ...

Probab=92.53  E-value=0.041  Score=46.71  Aligned_cols=27  Identities=15%  Similarity=0.117  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.|||
T Consensus       144 ~~qi~~~l~~lH~~~i~H~dikp~NIl  170 (322)
T 1p4o_A          144 AGEIADGMAYLNANKFVHRDLAARNCM  170 (322)
T ss_dssp             HHHHHHHHHHHHHTTCBCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCCccCCCccceEE
Confidence            468999999999999999999999997

>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis}

Probab=92.53  E-value=0.038  Score=49.71  Aligned_cols=27  Identities=7%  Similarity=0.083  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       147 ~~qi~~aL~~LH~~~ivHrDlkp~Nil  173 (394)
T 4e7w_A          147 MYQLLRSLAYIHSIGICHRDIKPQNLL  173 (394)
T ss_dssp             HHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCccCCCCCHHHEE
Confidence            468999999999999999999999997

>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A*

Probab=92.49  E-value=0.051  Score=44.40  Aligned_cols=29  Identities=3%  Similarity=0.038  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.  |+|+|.++.|||
T Consensus       115 ~i~~qi~~~l~~lH~~~~~i~H~dikp~Nil  145 (271)
T 3kmu_A          115 KFALDMARGMAFLHTLEPLIPRHALNSRSVM  145 (271)
T ss_dssp             HHHHHHHHHHHHHTTSSSCCTTCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhcCCCceecCCCccceEE
Confidence            44578999999999999  999999999997

>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A*

Probab=92.49  E-value=0.038  Score=47.64  Aligned_cols=27  Identities=4%  Similarity=0.032  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+++.|||
T Consensus       114 ~~qi~~aL~~lH~~~ivH~Dlkp~NIl  140 (317)
T 2pmi_A          114 QWQLLQGLAFCHENKILHRDLKPQNLL  140 (317)
T ss_dssp             HHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHCCeeeCCCChHHeE
Confidence            358999999999999999999999997

>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A

Probab=92.47  E-value=0.038  Score=48.18  Aligned_cols=28  Identities=4%  Similarity=0.113  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       111 i~~qi~~~l~~LH~~~ivH~Dlkp~NIl  138 (325)
T 3kn6_A          111 IMRKLVSAVSHMHDVGVVHRDLKPENLL  138 (325)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCeecCCCHHHEE
Confidence            4578999999999999999999999997

>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A*

Probab=92.47  E-value=0.041  Score=47.09  Aligned_cols=28  Identities=14%  Similarity=0.123  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       169 ~~~qi~~~l~~lH~~~ivH~Dlkp~NIl  196 (333)
T 2i1m_A          169 FSSQVAQGMAFLASKNCIHRDVAARNVL  196 (333)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGCE
T ss_pred             HHHHHHHHHHHHhcCCcccCCcccceEE
Confidence            3468999999999999999999999996

>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ...

Probab=92.44  E-value=0.043  Score=46.22  Aligned_cols=28  Identities=18%  Similarity=0.100  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       153 ~~~qi~~al~~lH~~~i~H~dikp~Nil  180 (316)
T 2xir_A          153 YSFQVAKGMEFLASRKCIHRDLAARNIL  180 (316)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCcccccCccceEE
Confidence            3468999999999999999999999997

>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A*

Probab=92.44  E-value=0.041  Score=46.14  Aligned_cols=28  Identities=14%  Similarity=0.120  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       131 ~~~~i~~~l~~lH~~~i~H~dikp~Nil  158 (302)
T 4e5w_A          131 YAVQICKGMDYLGSRQYVHRDLAARNVL  158 (302)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHhhcCCcccCCCchheEE
Confidence            3568999999999999999999999997

>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens}

Probab=92.44  E-value=0.04  Score=48.03  Aligned_cols=29  Identities=10%  Similarity=0.106  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       155 ~i~~qi~~aL~~LH~~~ivH~Dlkp~NIl  183 (345)
T 2v62_A          155 QLGIRMLDVLEYIHENEYVHGDIKAANLL  183 (345)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeCCCcCHHHEE
Confidence            44578999999999999999999999997

>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C

Probab=92.44  E-value=0.038  Score=50.06  Aligned_cols=28  Identities=7%  Similarity=0.080  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       166 i~~qi~~aL~~LH~~~ivHrDlkp~Nil  193 (400)
T 1nxk_A          166 IMKSIGEAIQYLHSINIAHRDVKPENLL  193 (400)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCcCcceEE
Confidence            3568899999999999999999999997

>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A*

Probab=92.41  E-value=0.039  Score=47.20  Aligned_cols=29  Identities=10%  Similarity=0.117  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       120 ~~~~qi~~~l~~lH~~~i~H~Dlkp~Nil  148 (297)
T 3fxz_A          120 AVCRECLQALEFLHSNQVIHRDIKSDNIL  148 (297)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCceeCCCCHHHEE
Confidence            34578999999999999999999999996

>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens}

Probab=92.41  E-value=0.049  Score=45.98  Aligned_cols=29  Identities=3%  Similarity=0.023  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.  |+|+|+++.|||
T Consensus       140 ~i~~qi~~~l~~LH~~~~~ivH~Dikp~NIl  170 (337)
T 3ll6_A          140 KIFYQTCRAVQHMHRQKPPIIHRDLKVENLL  170 (337)
T ss_dssp             HHHHHHHHHHHHHHTSSSCCBCCCCCGGGCE
T ss_pred             HHHHHHHHHHHHHHhCCCCEEEccCCcccEE
Confidence            34578999999999999  999999999997

>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A*

Probab=92.40  E-value=0.045  Score=45.98  Aligned_cols=28  Identities=18%  Similarity=0.080  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       150 ~~~qi~~~l~~lH~~~i~H~dlkp~Nil  177 (313)
T 1t46_A          150 FSYQVAKGMAFLASKNCIHRDLAARNIL  177 (313)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeecCCCccceEE
Confidence            4568999999999999999999999997

>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens}

Probab=92.39  E-value=0.043  Score=47.83  Aligned_cols=29  Identities=14%  Similarity=0.146  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       163 ~i~~qi~~~L~~LH~~~ivH~Dikp~NIl  191 (352)
T 2jii_A          163 QVACRLLDALEFLHENEYVHGNVTAENIF  191 (352)
T ss_dssp             HHHHHHHHHHHHHHHTTCBCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCccCCCCCHHHEE
Confidence            34578999999999999999999999997

>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II}

Probab=92.38  E-value=0.044  Score=48.59  Aligned_cols=28  Identities=0%  Similarity=-0.022  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       146 i~~qi~~aL~~LH~~gi~H~Dikp~Nil  173 (383)
T 3eb0_A          146 YIYQLFRAVGFIHSLGICHRDIKPQNLL  173 (383)
T ss_dssp             HHHHHHHHHHHHHTTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCcCccCccCHHHEE
Confidence            3478999999999999999999999997

>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ...

Probab=92.36  E-value=0.046  Score=45.86  Aligned_cols=27  Identities=11%  Similarity=0.142  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.|||
T Consensus       134 ~~ql~~~l~~lH~~~i~H~dikp~Nil  160 (298)
T 3f66_A          134 GLQVAKGMKYLASKKFVHRDLAARNCM  160 (298)
T ss_dssp             HHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhCCccCCCCchheEE
Confidence            458999999999999999999999996

>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A

Probab=92.34  E-value=0.045  Score=48.63  Aligned_cols=29  Identities=3%  Similarity=-0.082  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.++.|||
T Consensus       120 ~i~~ql~~~L~~LH~~~ivH~Dlkp~Nil  148 (361)
T 3uc3_A          120 FFFQQLLSGVSYCHSMQICHRDLKLENTL  148 (361)
T ss_dssp             HHHHHHHHHHHHHHHTTCCSCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            34578999999999999999999999997

>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B

Probab=92.32  E-value=0.044  Score=48.83  Aligned_cols=29  Identities=7%  Similarity=0.061  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       132 ~~~~qi~~al~~lH~~~ivH~Dlkp~NIl  160 (362)
T 2bdw_A          132 HCIQQILESIAYCHSNGIVHRNLKPENLL  160 (362)
T ss_dssp             HHHHHHHHHHHHHHHTTCBCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeEeccCchHHEE
Confidence            34578999999999999999999999998

>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7

Probab=92.29  E-value=0.04  Score=47.35  Aligned_cols=28  Identities=11%  Similarity=0.062  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       177 i~~qi~~aL~~LH~~~ivH~Dikp~NIl  204 (344)
T 1rjb_A          177 FAYQVAKGMEFLEFKSCVHRDLAARNVL  204 (344)
T ss_dssp             HHHHHHHHHHHHHHTTEEETTCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCcccCCCChhhEE
Confidence            4568999999999999999999999997

>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A*

Probab=92.28  E-value=0.041  Score=47.88  Aligned_cols=28  Identities=14%  Similarity=0.076  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.++.|||
T Consensus       126 ~~~qi~~al~~lH~~~ivH~Dlkp~Nil  153 (327)
T 3a62_A          126 YLAEISMALGHLHQKGIIYRDLKPENIM  153 (327)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCTTTEE
T ss_pred             HHHHHHHHHHHHHhCCEEcccCCHHHeE
Confidence            3468999999999999999999999996

>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A*

Probab=92.22  E-value=0.049  Score=45.43  Aligned_cols=27  Identities=19%  Similarity=0.123  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~~~i~~~l~~lH~~~i~H~dlkp~Nil  145 (281)
T 3cc6_A          119 SLQICKAMAYLESINCVHRDIAVRNIL  145 (281)
T ss_dssp             HHHHHHHHHHHHHTTCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCcccCCCccceEE
Confidence            468999999999999999999999997

>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A

Probab=92.22  E-value=0.043  Score=47.47  Aligned_cols=28  Identities=7%  Similarity=0.097  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++ .|+|+|+++.|||
T Consensus       136 i~~qi~~aL~~lH~~~~ivH~Dikp~NIl  164 (373)
T 1q8y_A          136 ISKQLLLGLDYMHRRCGIIHTDIKPENVL  164 (373)
T ss_dssp             HHHHHHHHHHHHHHTTCEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhcCCEEecCCChHHeE
Confidence            457899999999998 9999999999998

>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7

Probab=92.21  E-value=0.042  Score=48.94  Aligned_cols=28  Identities=7%  Similarity=0.133  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|+|.+++|||
T Consensus       133 ~~~qi~~~L~~LH~~~ivH~Dlkp~NIl  160 (367)
T 1cm8_A          133 LVYQMLKGLRYIHAAGIIHRDLKPGNLA  160 (367)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCcCHHHEE
Confidence            3468999999999999999999999997

>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A*

Probab=92.18  E-value=0.042  Score=50.17  Aligned_cols=28  Identities=14%  Similarity=0.092  Sum_probs=26.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       120 i~~qi~~aL~~LH~~~ivHrDLkp~NIL  147 (434)
T 2rio_A          120 LLRQIASGVAHLHSLKIIHRDLKPQNIL  147 (434)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCCChHhEE
Confidence            4579999999999999999999999998

>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ...

Probab=92.17  E-value=0.05  Score=45.84  Aligned_cols=29  Identities=7%  Similarity=0.069  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       124 ~i~~qi~~~L~~lH~~~i~H~Dlkp~Nil  152 (289)
T 3og7_A          124 DIARQTARGMDYLHAKSIIHRDLKSNNIF  152 (289)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCcccccCccceEE
Confidence            34578999999999999999999999996

>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A*

Probab=92.15  E-value=0.045  Score=45.49  Aligned_cols=28  Identities=7%  Similarity=0.065  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       110 ~~~~i~~~l~~lH~~~i~H~dikp~Nil  137 (284)
T 3kk8_A          110 CIQQILESIAYCHSNGIVHRNLKPENLL  137 (284)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCcCcCCCCHHHEE
Confidence            3478999999999999999999999997

>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens}

Probab=92.13  E-value=0.045  Score=45.96  Aligned_cols=29  Identities=14%  Similarity=0.154  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       113 ~~~~qi~~al~~LH~~~i~H~dlkp~NIl  141 (305)
T 2wtk_C          113 GYFCQLIDGLEYLHSQGIVHKDIKPGNLL  141 (305)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeecCCCcccEE
Confidence            34568999999999999999999999997

>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B

Probab=92.13  E-value=0.049  Score=49.91  Aligned_cols=28  Identities=18%  Similarity=0.135  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       289 ~~~qi~~~l~~LH~~~ivHrDlkp~Nil  316 (454)
T 1qcf_A          289 FSAQIAEGMAFIEQRNYIHRDLRAANIL  316 (454)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSSCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCccCCCCCHHHEE
Confidence            3578999999999999999999999996

>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp}

Probab=92.12  E-value=0.051  Score=46.31  Aligned_cols=29  Identities=7%  Similarity=0.176  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       115 ~~~~qi~~~l~~lH~~~i~H~Dlkp~Nil  143 (294)
T 4eqm_A          115 NFTNQILDGIKHAHDMRIVHRDIKPQNIL  143 (294)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            34578999999999999999999999996

>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7

Probab=92.12  E-value=0.044  Score=47.77  Aligned_cols=29  Identities=14%  Similarity=0.101  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       106 ~i~~qi~~al~~lH~~givH~Dlkp~NIl  134 (321)
T 1tki_A          106 SYVHQVCEALQFLHSHNIGHFDIRPENII  134 (321)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCCcCCCCHHHEE
Confidence            34578999999999999999999999997

>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A*

Probab=92.11  E-value=0.05  Score=48.73  Aligned_cols=28  Identities=14%  Similarity=0.030  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       126 ~~~qi~~aL~~LH~~givHrDlkp~NIl  153 (353)
T 2i0e_A          126 YAAEIAIGLFFLQSKGIIYRDLKLDNVM  153 (353)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEEeccCCHHHEE
Confidence            4578999999999999999999999996

>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=92.11  E-value=0.052  Score=44.99  Aligned_cols=28  Identities=11%  Similarity=0.050  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       111 i~~~i~~~l~~lH~~~i~H~dikp~Nil  138 (269)
T 4hcu_A          111 MCLDVCEGMAYLEEACVIHRDLAARNCL  138 (269)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeecCCcchheEE
Confidence            3468899999999999999999999997

>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus}

Probab=92.10  E-value=0.05  Score=50.04  Aligned_cols=28  Identities=14%  Similarity=0.065  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       158 ~~~qi~~aL~~LH~~givHrDLKp~NIL  185 (396)
T 4dc2_A          158 YSAEISLALNYLHERGIIYRDLKLDNVL  185 (396)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEEeccCCHHHEE
Confidence            3568999999999999999999999996

>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ...

Probab=92.09  E-value=0.045  Score=47.21  Aligned_cols=28  Identities=11%  Similarity=0.036  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       154 i~~qi~~~L~~LH~~~ivH~Dlkp~NIl  181 (320)
T 3a99_A          154 FFWQVLEAVRHCHNCGVLHRDIKDENIL  181 (320)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCcEeCCCCHHHEE
Confidence            3468999999999999999999999997

>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A*

Probab=92.08  E-value=0.05  Score=49.23  Aligned_cols=27  Identities=19%  Similarity=0.148  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       145 ~~qi~~aL~~LH~~givHrDlkp~NIl  171 (373)
T 2r5t_A          145 AAEIASALGYLHSLNIVYRDLKPENIL  171 (373)
T ss_dssp             HHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHCCceecCCCHHHEE
Confidence            468999999999999999999999997

>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens}

Probab=92.07  E-value=0.051  Score=48.32  Aligned_cols=29  Identities=14%  Similarity=0.108  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+|++|||
T Consensus       195 ~i~~qi~~aL~~LH~~~ivH~Dlkp~NIl  223 (382)
T 3tt0_A          195 SCAYQVARGMEYLASKKCIHRDLAARNVL  223 (382)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCEecCCCCcceEE
Confidence            34578999999999999999999999996

>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A*

Probab=92.07  E-value=0.051  Score=48.53  Aligned_cols=28  Identities=18%  Similarity=0.131  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       123 ~~~qi~~aL~~LH~~~ivHrDlkp~NIl  150 (345)
T 1xjd_A          123 YAAEIILGLQFLHSKGIVYRDLKLDNIL  150 (345)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeEeCCCChhhEE
Confidence            3578999999999999999999999997

>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A*

Probab=92.06  E-value=0.046  Score=47.04  Aligned_cols=28  Identities=4%  Similarity=0.058  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       117 ~~~qi~~~L~~LH~~~ivH~Dlkp~Nil  144 (353)
T 2b9h_A          117 FIYQTLRAVKVLHGSNVIHRDLKPSNLL  144 (353)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            4578999999999999999999999997

>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ...

Probab=92.05  E-value=0.045  Score=48.77  Aligned_cols=28  Identities=7%  Similarity=0.088  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.++.|||
T Consensus       146 ~~~qi~~aL~~LH~~~ivHrDlkp~NIl  173 (350)
T 1rdq_E          146 YAAQIVLTFEYLHSLDLIYRDLKPENLL  173 (350)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCcccccCccceEE
Confidence            3578999999999999999999999997

>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A*

Probab=92.04  E-value=0.046  Score=46.89  Aligned_cols=29  Identities=14%  Similarity=0.129  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       146 ~i~~qi~~aL~~LH~~~ivH~dlkp~NIl  174 (327)
T 1fvr_A          146 HFAADVARGMDYLSQKQFIHRDLAARNIL  174 (327)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCccCCCCccceEE
Confidence            34578999999999999999999999997

>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A

Probab=92.02  E-value=0.052  Score=45.00  Aligned_cols=28  Identities=14%  Similarity=0.116  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       121 i~~qi~~~l~~LH~~~i~H~dlkp~Nil  148 (303)
T 1zy4_A          121 LFRQILEALSYIHSQGIIHRDLKPMNIF  148 (303)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeecccCCHHhEE
Confidence            3468999999999999999999999997

>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii}

Probab=92.01  E-value=0.051  Score=45.82  Aligned_cols=28  Identities=11%  Similarity=0.134  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       129 i~~qi~~~L~~LH~~~ivH~dikp~NIl  156 (285)
T 3is5_A          129 LMKQMMNALAYFHSQHVVHKDLKPENIL  156 (285)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEEECCCCHHHEE
Confidence            3468899999999999999999999997

>3ddt_A E3 ubiquitin-protein ligase TRIM63; zinc-binding motif, ring-like fold, coiled coil, cytoplasm, metal-binding, muscle protein, nucleus; 1.90A {Homo sapiens} SCOP: g.43.1.1 PDB: 3q1d_A

Probab=92.00  E-value=0.072  Score=35.45  Aligned_cols=39  Identities=15%  Similarity=0.129  Sum_probs=29.2

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCccc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKA   86 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~pV   86 (264)
                      .|+.|...+..+||..|..++|..|...+.-..|.-+||
T Consensus         8 ~C~~H~~e~l~lfC~~d~~~iC~~C~~~~~H~~H~~~~l   46 (48)
T 3ddt_A            8 MCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPL   46 (48)
T ss_dssp             BCSSSTTSBCCEEETTTTEEECHHHHHHSTTTTSCEEEC
T ss_pred             cCCCCCCccccEEcCCCCeeEcccccCCCcCCCCcEEeC
Confidence            578888677899999999999999986443345554443

>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7

Probab=91.99  E-value=0.051  Score=47.41  Aligned_cols=30  Identities=7%  Similarity=0.014  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       115 ~~~~~qi~~~l~~lH~~~ivH~Dlkp~Nil  144 (346)
T 1ua2_A          115 KAYMLMTLQGLEYLHQHWILHRDLKPNNLL  144 (346)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHHCCEECCCCCHHHEE
Confidence            345578999999999999999999999997

>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens}

Probab=91.99  E-value=0.043  Score=50.51  Aligned_cols=30  Identities=13%  Similarity=0.035  Sum_probs=27.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||=
T Consensus       122 ~i~~qi~~aL~~LH~~~ivHrDlKp~NIll  151 (432)
T 3p23_A          122 TLLQQTTSGLAHLHSLNIVHRDLKPHNILI  151 (432)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCSTTSEEE
T ss_pred             HHHHHHHHHHHHHHHCcCEeCCCCHHHEEE
Confidence            455789999999999999999999999973

>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B*

Probab=91.95  E-value=0.049  Score=44.98  Aligned_cols=28  Identities=7%  Similarity=0.087  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       127 i~~qi~~~l~~lH~~~i~H~dlkp~Nil  154 (284)
T 2a19_B          127 LFEQITKGVDYIHSKKLINRDLKPSNIF  154 (284)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeeccCCHHHEE
Confidence            3468999999999999999999999996

>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A*

Probab=91.95  E-value=0.048  Score=47.29  Aligned_cols=29  Identities=10%  Similarity=0.140  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       128 ~i~~qi~~~l~~LH~~~ivH~Dlkp~NIl  156 (351)
T 3mi9_A          128 RVMQMLLNGLYYIHRNKILHRDMKAANVL  156 (351)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeCCCCCHHHEE
Confidence            34578999999999999999999999996

>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A*

Probab=91.95  E-value=0.052  Score=47.14  Aligned_cols=29  Identities=14%  Similarity=0.048  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       138 ~~~~qi~~~l~~lH~~~ivH~Dlkp~NIl  166 (362)
T 3pg1_A          138 YFMYHILLGLHVLHEAGVVHRDLHPGNIL  166 (362)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCcCEecCCChHHEE
Confidence            34578999999999999999999999997

>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A*

Probab=91.94  E-value=0.048  Score=46.68  Aligned_cols=28  Identities=4%  Similarity=0.049  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~~~qi~~~l~~lH~~~ivH~dlkp~NIl  146 (322)
T 2ycf_A          119 YFYQMLLAVQYLHENGIIHRDLKPENVL  146 (322)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            4578999999999999999999999997

>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A*

Probab=91.92  E-value=0.063  Score=44.79  Aligned_cols=29  Identities=17%  Similarity=0.124  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.  |+|+|.++.|||
T Consensus       126 ~~~~~l~~~l~~lH~~~~~ivH~dikp~Nil  156 (287)
T 4f0f_A          126 RLMLDIALGIEYMQNQNPPIVHRDLRSPNIF  156 (287)
T ss_dssp             HHHHHHHHHHHHHHTSSSCCBCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCCCeecCCCCcceEE
Confidence            34568899999999999  999999999997

>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens}

Probab=91.90  E-value=0.052  Score=45.87  Aligned_cols=28  Identities=4%  Similarity=-0.022  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       107 i~~~l~~~l~~lH~~~ivH~dlkp~Nil  134 (311)
T 4agu_A          107 ITWQTLQAVNFCHKHNCIHRDVKPENIL  134 (311)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCcCCCCChhhEE
Confidence            3468999999999999999999999997

>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A*

Probab=91.90  E-value=0.049  Score=44.97  Aligned_cols=28  Identities=11%  Similarity=0.051  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       109 i~~qi~~~l~~lH~~~i~H~dikp~Nil  136 (268)
T 3sxs_A          109 MCYDVCEGMAFLESHQFIHRDLAARNCL  136 (268)
T ss_dssp             HHHHHHHHHHHHHHTTEEESSCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeecCCcCcceEE
Confidence            3578999999999999999999999997

>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ...

Probab=91.89  E-value=0.054  Score=45.34  Aligned_cols=28  Identities=4%  Similarity=-0.011  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       108 ~~~~i~~~l~~lH~~~i~H~dlkp~Nil  135 (299)
T 2r3i_A          108 YLFQLLQGLAFCHSHRVLHRDLKPQNLL  135 (299)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccCCCCCHHHeE
Confidence            3468999999999999999999999996

>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens}

Probab=91.86  E-value=0.052  Score=47.17  Aligned_cols=29  Identities=14%  Similarity=0.091  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       155 ~i~~qi~~~L~~LH~~~ivH~Dlkp~NIl  183 (325)
T 3kul_A          155 GMLRGVGAGMRYLSDLGYVHRDLAARNVL  183 (325)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeCCCCCcceEE
Confidence            34568899999999999999999999997

>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II}

Probab=91.86  E-value=0.052  Score=46.53  Aligned_cols=28  Identities=21%  Similarity=0.178  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       173 i~~qi~~~l~~LH~~~ivH~Dlkp~NIl  200 (345)
T 3hko_A          173 IMRQIFSALHYLHNQGICHRDIKPENFL  200 (345)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCCChhhEE
Confidence            3468999999999999999999999997

>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A*

Probab=91.85  E-value=0.043  Score=47.75  Aligned_cols=30  Identities=3%  Similarity=0.001  Sum_probs=27.3

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       196 ~~i~~qi~~~l~~lH~~giiHrDlkp~NIL  225 (282)
T 1zar_A          196 DEVLDMILEEVAKFYHRGIVHGDLSQYNVL  225 (282)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECSCCSTTSEE
T ss_pred             HHHHHHHHHHHHHHHHCCCEeCCCCHHHEE
Confidence            346789999999999999999999999996

>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A*

Probab=91.85  E-value=0.055  Score=46.02  Aligned_cols=29  Identities=7%  Similarity=0.123  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       131 ~i~~qi~~aL~~LH~~~ivH~dlkp~NIl  159 (313)
T 3cek_A          131 SYWKNMLEAVHTIHQHGIVHSDLKPANFL  159 (313)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCceecCCCcccEE
Confidence            34578999999999999999999999997

>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ...

Probab=91.84  E-value=0.053  Score=48.50  Aligned_cols=29  Identities=7%  Similarity=0.111  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||.++.|||
T Consensus       136 ~i~~qi~~aL~~LH~~givH~Dlkp~NIl  164 (367)
T 2fst_X          136 FLIYQILRGLKYIHSADIIHRDLKPSNLA  164 (367)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeeCCCCHhhEE
Confidence            34578999999999999999999999997

>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A*

Probab=91.84  E-value=0.051  Score=45.11  Aligned_cols=28  Identities=4%  Similarity=0.018  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       111 i~~~i~~~l~~lH~~~i~H~dlkp~Nil  138 (277)
T 3f3z_A          111 IMKDVLSAVAYCHKLNVAHRDLKPENFL  138 (277)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccCCCCCHHHEE
Confidence            4578999999999999999999999997

>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ...

Probab=91.82  E-value=0.054  Score=47.94  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       132 i~~qi~~al~~lH~~~ivH~Dlkp~NIl  159 (371)
T 2xrw_A          132 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  159 (371)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeecccCCHHHEE
Confidence            3578999999999999999999999997

>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ...

Probab=91.82  E-value=0.055  Score=45.10  Aligned_cols=28  Identities=7%  Similarity=0.061  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       114 ~~~qi~~~l~~LH~~~i~H~dlkp~Nil  141 (279)
T 3fdn_A          114 YITELANALSYCHSKRVIHRDIKPENLL  141 (279)
T ss_dssp             HHHHHHHHHHHHHTTTCEECCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEecccCChHhEE
Confidence            4478999999999999999999999996

>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens}

Probab=91.79  E-value=0.052  Score=45.99  Aligned_cols=28  Identities=11%  Similarity=0.101  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       139 i~~qi~~~L~~LH~~~ivH~dlkp~NIl  166 (317)
T 2buj_A          139 LLLGICRGLEAIHAKGYAHRDLKPTNIL  166 (317)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            4578999999999999999999999997

>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens}

Probab=91.78  E-value=0.048  Score=47.09  Aligned_cols=27  Identities=7%  Similarity=0.036  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+++.|||
T Consensus       106 ~~qi~~aL~~LH~~~ivH~Dikp~NIl  132 (324)
T 3mtl_A          106 LFQLLRGLAYCHRQKVLHRDLKPQNLL  132 (324)
T ss_dssp             HHHHHHHHHHHHHTTEEESSCCGGGEE
T ss_pred             HHHHHHHHHHHHHCCccCCCcCHHHEE
Confidence            468999999999999999999999997

>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A*

Probab=91.78  E-value=0.046  Score=49.95  Aligned_cols=28  Identities=14%  Similarity=0.178  Sum_probs=26.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       205 i~~qi~~aL~~LH~~~ivHrDlKp~NIL  232 (429)
T 3kvw_A          205 FAHSILQCLDALHKNRIIHCDLKPENIL  232 (429)
T ss_dssp             HHHHHHHHHHHHHHHTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            4578999999999999999999999998

>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A*

Probab=91.76  E-value=0.054  Score=47.14  Aligned_cols=30  Identities=7%  Similarity=0.017  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       108 ~~i~~qi~~aL~~LH~~givH~Dlkp~NIl  137 (323)
T 3tki_A          108 QRFFHQLMAGVVYLHGIGITHRDIKPENLL  137 (323)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHHCCccccccchHHEE
Confidence            344578999999999999999999999996

>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ...

Probab=91.74  E-value=0.054  Score=47.58  Aligned_cols=28  Identities=7%  Similarity=0.097  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       133 i~~qi~~aL~~LH~~~ivH~Dikp~NIl  160 (364)
T 3qyz_A          133 FLYQILRGLKYIHSANVLHRDLKPSNLL  160 (364)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeecCCCChHhEE
Confidence            3578999999999999999999999997

>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ...

Probab=91.73  E-value=0.056  Score=48.36  Aligned_cols=28  Identities=21%  Similarity=0.151  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       152 i~~qi~~aL~~LH~~~ivH~Dlkp~NIl  179 (373)
T 2qol_A          152 MLRGIASGMKYLSDMGYVHRDLAARNIL  179 (373)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeeCCCCCcceEE
Confidence            4578999999999999999999999997

>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7

Probab=91.72  E-value=0.059  Score=47.26  Aligned_cols=28  Identities=11%  Similarity=0.096  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.++.|||
T Consensus       111 ~~~qi~~aL~~LH~~~ivHrDlkp~NIl  138 (318)
T 1fot_A          111 YAAEVCLALEYLHSKDIIYRDLKPENIL  138 (318)
T ss_dssp             HHHHHHHHHHHHHTTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCCChheEE
Confidence            3478999999999999999999999997

>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A*

Probab=91.72  E-value=0.054  Score=48.16  Aligned_cols=28  Identities=11%  Similarity=0.010  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       218 ~~~qi~~~l~~LH~~~ivHrDlkp~Nil  245 (377)
T 3cbl_A          218 MVGDAAAGMEYLESKCCIHRDLAARNCL  245 (377)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCcCCcccCHHHEE
Confidence            4468899999999999999999999996

>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens}

Probab=91.71  E-value=0.052  Score=47.17  Aligned_cols=29  Identities=10%  Similarity=0.041  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       118 ~i~~qi~~al~~lH~~~ivH~Dlkp~NIl  146 (326)
T 2y0a_A          118 EFLKQILNGVYYLHSLQIAHFDLKPENIM  146 (326)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeEcCCCCHHHEE
Confidence            44578999999999999999999999997

>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A

Probab=91.71  E-value=0.056  Score=49.13  Aligned_cols=28  Identities=4%  Similarity=0.049  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       244 i~~qi~~~l~~LH~~~ivHrDlkp~NIl  271 (419)
T 3i6u_A          244 YFYQMLLAVQYLHENGIIHRDLKPENVL  271 (419)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCCChHhEE
Confidence            3478999999999999999999999997

>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens}

Probab=91.68  E-value=0.053  Score=47.55  Aligned_cols=28  Identities=11%  Similarity=0.092  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       135 i~~qi~~~L~~LH~~~ivH~Dlkp~NIl  162 (335)
T 3dls_A          135 IFRQLVSAVGYLRLKDIIHRDIKDENIV  162 (335)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeEEeccCHHHEE
Confidence            4578999999999999999999999997

>2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens}

Probab=91.63  E-value=0.089  Score=35.12  Aligned_cols=37  Identities=8%  Similarity=-0.070  Sum_probs=28.3

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|+.|+..+..+||..|..++|..|.. +.-.+|..+|
T Consensus         8 ~C~~H~~e~l~lfC~~~~~~iC~~C~~-~~H~~H~~~~   44 (50)
T 2yvr_A            8 YCNVHKHEPLVLFCESCDTLTCRDCQL-NAHKDHQYQF   44 (50)
T ss_dssp             BCSSSTTCBCCEEETTTTEEECHHHHH-TTTTTCCEEE
T ss_pred             cCcCCCCCCEEEEeCCCCEEEecccCC-CcCCCCceec
Confidence            478888788999999999999999988 2223454433

>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A

Probab=91.61  E-value=0.057  Score=44.85  Aligned_cols=28  Identities=11%  Similarity=0.273  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++ .|+|+|.++.|||
T Consensus       114 i~~qi~~~l~~lH~~~~i~H~dlkp~Nil  142 (290)
T 3fme_A          114 IAVSIVKALEHLHSKLSVIHRDVKPSNVL  142 (290)
T ss_dssp             HHHHHHHHHHHHHHHSCCCCCCCSGGGCE
T ss_pred             HHHHHHHHHHHHhhcCCeecCCCCHHHEE
Confidence            457899999999998 9999999999997

>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7

Probab=91.61  E-value=0.061  Score=45.68  Aligned_cols=28  Identities=14%  Similarity=0.171  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccc--------cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ--------TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~--------~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++        .|+|+|.|+.|||
T Consensus       139 i~~~i~~~l~~lH~~~~~~~~~~~ivH~Dikp~Nil  174 (337)
T 3mdy_A          139 LAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNIL  174 (337)
T ss_dssp             HHHHHHHHHHHHHSCBCSTTCBCCEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhhhhhccCCCEEecccchHHEE
Confidence            346889999999998        9999999999997

>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ...

Probab=91.60  E-value=0.056  Score=44.90  Aligned_cols=28  Identities=14%  Similarity=0.143  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       114 i~~qi~~~l~~lH~~~i~H~dikp~Nil  141 (279)
T 1qpc_A          114 MAAQIAEGMAFIEERNYIHRDLRAANIL  141 (279)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeeccCCCHhhEE
Confidence            3578999999999999999999999997

>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group}

Probab=91.60  E-value=0.053  Score=51.25  Aligned_cols=29  Identities=3%  Similarity=0.070  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       107 ~i~~qi~~aL~yLH~~gIvHrDIKP~NIL  135 (483)
T 3sv0_A          107 MLADQMINRVEFVHSKSFLHRDIKPDNFL  135 (483)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCEeecccCcceEE
Confidence            34578999999999999999999999997

>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A*

Probab=91.59  E-value=0.056  Score=50.36  Aligned_cols=28  Identities=4%  Similarity=0.077  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       180 ~~~qi~~aL~~LH~~giiHrDLKp~NIL  207 (437)
T 4aw2_A          180 YLAEMVIAIDSVHQLHYVHRDIKPDNIL  207 (437)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeEecccCHHHee
Confidence            4578999999999999999999999996

>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B*

Probab=91.59  E-value=0.059  Score=44.78  Aligned_cols=28  Identities=11%  Similarity=0.146  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       126 ~~~~i~~~l~~lH~~~i~H~dikp~Nil  153 (291)
T 1u46_A          126 YAVQVAEGMGYLESKRFIHRDLAARNLL  153 (291)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCcccCCCchheEE
Confidence            3468999999999999999999999997

>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ...

Probab=91.58  E-value=0.054  Score=45.10  Aligned_cols=27  Identities=22%  Similarity=0.213  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.||+
T Consensus       117 ~~~i~~~l~~lH~~~i~H~dikp~Nil  143 (288)
T 3kfa_A          117 ATQISSAMEYLEKKNFIHRDLAARNCL  143 (288)
T ss_dssp             HHHHHHHHHHHHHHTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCccCCCCCcceEE
Confidence            368999999999999999999999997

>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A*

Probab=91.57  E-value=0.059  Score=49.04  Aligned_cols=27  Identities=15%  Similarity=0.198  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          226 STAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+ +.|+|||+|+.|||
T Consensus       254 ~~qi~~aL~~LH~~~giiHrDlkp~NIl  281 (446)
T 4ejn_A          254 GAEIVSALDYLHSEKNVVYRDLKLENLM  281 (446)
T ss_dssp             HHHHHHHHHHHHHHTCCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHhhcCCEEECCCCHHHEE
Confidence            4689999999998 88999999999996

>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A*

Probab=91.57  E-value=0.059  Score=45.31  Aligned_cols=29  Identities=10%  Similarity=0.127  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       121 ~i~~qi~~~l~~LH~~~i~H~dikp~Nil  149 (291)
T 1xbb_A          121 ELVHQVSMGMKYLEESNFVHRDLAARNVL  149 (291)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeEcCCCCcceEE
Confidence            34578999999999999999999999996

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*

Probab=91.56  E-value=0.059  Score=49.33  Aligned_cols=29  Identities=3%  Similarity=0.111  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       130 ~i~~qi~~~l~~lH~~~ivH~Dlkp~Nil  158 (484)
T 3nyv_A          130 RIIRQVLSGITYMHKNKIVHRDLKPENLL  158 (484)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeeCCCCHHHEE
Confidence            34578999999999999999999999997

>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens}

Probab=91.56  E-value=0.061  Score=46.77  Aligned_cols=29  Identities=3%  Similarity=0.094  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       130 ~i~~qi~~al~~LH~~~ivH~dlkp~NIl  158 (353)
T 3coi_A          130 YLVYQMLKGLKYIHSAGVVHRDLKPGNLA  158 (353)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSSCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEe
Confidence            34578999999999999999999999997

>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A

Probab=91.54  E-value=0.056  Score=47.90  Aligned_cols=29  Identities=14%  Similarity=0.095  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.++.|||
T Consensus       120 ~~~~qi~~al~~lH~~givHrDlkp~NIl  148 (342)
T 2qr7_A          120 AVLFTITKTVEYLHAQGVVHRDLKPSNIL  148 (342)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcEeccCCHHHEE
Confidence            34578999999999999999999999998

>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens}

Probab=91.52  E-value=0.058  Score=49.79  Aligned_cols=27  Identities=7%  Similarity=0.111  Sum_probs=25.4

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       168 ~~qi~~aL~~LH~~giiHrDLKp~NIL  194 (412)
T 2vd5_A          168 LAEIVMAIDSVHRLGYVHRDIKPDNIL  194 (412)
T ss_dssp             HHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCeeecccCHHHee
Confidence            468999999999999999999999997

>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A*

Probab=91.48  E-value=0.059  Score=45.44  Aligned_cols=27  Identities=11%  Similarity=0.095  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.|||
T Consensus       139 ~~~i~~~l~~lH~~~i~H~dlkp~Nil  165 (307)
T 2nru_A          139 AQGAANGINFLHENHHIHRDIKSANIL  165 (307)
T ss_dssp             HHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHhcCCeecCCCCHHHEE
Confidence            467899999999999999999999997

>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens}

Probab=91.47  E-value=0.06  Score=48.23  Aligned_cols=28  Identities=7%  Similarity=0.176  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       117 i~~qi~~aL~~LH~~~ivH~Dlkp~NIl  144 (396)
T 4eut_A          117 VLRDVVGGMNHLRENGIVHRNIKPGNIM  144 (396)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEEECCcCHHHEE
Confidence            4578999999999999999999999996

>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens}

Probab=91.45  E-value=0.063  Score=47.37  Aligned_cols=29  Identities=7%  Similarity=0.133  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       152 ~i~~qi~~~L~~LH~~~ivH~Dikp~NIl  180 (349)
T 2w4o_A          152 DAVKQILEAVAYLHENGIVHRDLKPENLL  180 (349)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeEecCCCcccEE
Confidence            34578999999999999999999999997

>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A*

Probab=91.44  E-value=0.057  Score=45.95  Aligned_cols=30  Identities=7%  Similarity=0.094  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhc-cccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQ-NQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~-~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+|| +..|+|+|.+++|||
T Consensus       173 ~~i~~qi~~~l~~lH~~~givHrDlkp~NIL  203 (258)
T 1zth_A          173 EGIFNDVVENVKRLYQEAELVHADLSEYNIM  203 (258)
T ss_dssp             HHHHHHHHHHHHHHHHTSCEECSSCSTTSEE
T ss_pred             HHHHHHHHHHHHHHHHHCCEEeCCCCHHHEE
Confidence            344578999999999 999999999999997

>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens}

Probab=91.44  E-value=0.06  Score=45.51  Aligned_cols=29  Identities=7%  Similarity=0.114  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       134 ~i~~qi~~al~~lH~~~i~H~dlkp~NIl  162 (319)
T 2y4i_B          134 QIAQEIVKGMGYLHAKGILHKDLKSKNVF  162 (319)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCSTTEE
T ss_pred             HHHHHHHHHHHHHHhCCccccCCChhhEE
Confidence            44578999999999999999999999996

>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A*

Probab=91.42  E-value=0.05  Score=52.08  Aligned_cols=29  Identities=7%  Similarity=0.023  Sum_probs=26.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       435 ~i~~qi~~aL~~LH~~gIiHrDiKp~NIL  463 (540)
T 3en9_A          435 DIAYKIGEIVGKLHKNDVIHNDLTTSNFI  463 (540)
T ss_dssp             HHHHHHHHHHHHHHHTTEECTTCCTTSEE
T ss_pred             HHHHHHHHHHHHHHHCcCccCCCCHHHEE
Confidence            45689999999999999999999999996

>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A*

Probab=91.42  E-value=0.06  Score=49.64  Aligned_cols=28  Identities=4%  Similarity=0.158  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       173 ~~~qi~~aL~~LH~~givHrDLKp~NIL  200 (410)
T 3v8s_A          173 YTAEVVLALDAIHSMGFIHRDVKPDNML  200 (410)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeEeccCCHHHee
Confidence            3478999999999999999999999997

>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens}

Probab=91.41  E-value=0.06  Score=49.19  Aligned_cols=28  Identities=21%  Similarity=0.189  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       120 ~~~qi~~aL~~LH~~givHrDlkp~NIl  147 (384)
T 4fr4_A          120 FICELVMALDYLQNQRIIHRDMKPDNIL  147 (384)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCceeccCcHHHeE
Confidence            4578999999999999999999999996

>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B

Probab=91.40  E-value=0.065  Score=45.42  Aligned_cols=28  Identities=11%  Similarity=0.093  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       125 ~~~qi~~~l~~lH~~gi~H~dlkp~Nil  152 (326)
T 1blx_A          125 MMFQLLRGLDFLHSHRVVHRDLKPQNIL  152 (326)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCceeccCCHHHeE
Confidence            3468999999999999999999999997

>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A*

Probab=91.40  E-value=0.053  Score=46.40  Aligned_cols=28  Identities=11%  Similarity=0.096  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       144 i~~~i~~~l~~lH~~~ivH~dlkp~Nil  171 (321)
T 2qkw_B          144 ICIGAARGLHYLHTRAIIHRDVKSINIL  171 (321)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCSTTEE
T ss_pred             HHHHHHHHHHHhcCCCeecCCCCHHHEE
Confidence            4567899999999999999999999997

>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens}

Probab=91.40  E-value=0.061  Score=44.65  Aligned_cols=29  Identities=10%  Similarity=0.098  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       116 ~~~~qi~~~l~~lH~~~i~H~dl~p~Nil  144 (278)
T 3cok_A          116 HFMHQIITGMLYLHSHGILHRDLTLSNLL  144 (278)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSSCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34578999999999999999999999997

>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A

Probab=91.37  E-value=0.068  Score=47.32  Aligned_cols=28  Identities=4%  Similarity=0.120  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       149 i~~qi~~aL~~LH~~~ivH~Dikp~NIl  176 (371)
T 4exu_A          149 LVYQMLKGLKYIHSAGVVHRDLKPGNLA  176 (371)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCcCCCcCHHHeE
Confidence            4568999999999999999999999996

>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A*

Probab=91.36  E-value=0.067  Score=44.59  Aligned_cols=29  Identities=14%  Similarity=0.137  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       125 ~i~~qi~~~l~~lH~~~i~H~dl~p~Nil  153 (303)
T 2vwi_A          125 TILREVLEGLEYLHKNGQIHRDVKAGNIL  153 (303)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCCCCCCCChhhEE
Confidence            34468999999999999999999999997

>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ...

Probab=91.35  E-value=0.067  Score=44.69  Aligned_cols=28  Identities=4%  Similarity=0.026  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       119 ~~~qi~~~l~~lH~~~i~H~dl~p~Nil  146 (284)
T 2vgo_A          119 FMEELADALHYCHERKVIHRDIKPENLL  146 (284)
T ss_dssp             HHHHHHHHHHHHHTTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCceecCCCHHHEE
Confidence            4578999999999999999999999997

>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A*

Probab=91.34  E-value=0.066  Score=45.92  Aligned_cols=28  Identities=14%  Similarity=0.074  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       145 i~~qi~~al~~LH~~~i~H~dlkp~NIl  172 (327)
T 2yfx_A          145 VARDIACGCQYLEENHFIHRDIAARNCL  172 (327)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhCCeecCcCCHhHEE
Confidence            3468999999999999999999999997

>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A

Probab=91.31  E-value=0.062  Score=46.11  Aligned_cols=29  Identities=14%  Similarity=0.119  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~i~~qi~~aL~~lH~~~ivH~dikp~NIl  147 (321)
T 2a2a_A          119 SFIKQILDGVNYLHTKKIAHFDLKPENIM  147 (321)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCChHHEE
Confidence            34578999999999999999999999997

>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens}

Probab=91.30  E-value=0.058  Score=50.13  Aligned_cols=28  Identities=4%  Similarity=0.019  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       115 i~~qil~aL~~lH~~givHrDlKp~NIl  142 (444)
T 3soa_A          115 CIQQILEAVLHCHQMGVVHRNLKPENLL  142 (444)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCSSTTEE
T ss_pred             HHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            4578999999999999999999999997

>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7

Probab=91.25  E-value=0.07  Score=47.95  Aligned_cols=27  Identities=11%  Similarity=0.127  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       198 ~~qi~~aL~~LH~~~ivHrDlkp~NIl  224 (373)
T 3c1x_A          198 GLQVAKGMKFLASKKFVHRDLAARNCM  224 (373)
T ss_dssp             HHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHCCEecCccchheEE
Confidence            468999999999999999999999997

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*

Probab=91.23  E-value=0.067  Score=49.24  Aligned_cols=29  Identities=7%  Similarity=0.118  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+++.|||
T Consensus       125 ~i~~qi~~al~~lH~~~ivH~Dlkp~Nil  153 (486)
T 3mwu_A          125 RIIKQVFSGITYMHKHNIVHRDLKPENIL  153 (486)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeEeccCchHHEE
Confidence            34578999999999999999999999997

>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A*

Probab=91.17  E-value=0.071  Score=44.67  Aligned_cols=29  Identities=10%  Similarity=0.159  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       121 ~~~~~i~~~l~~lH~~~i~H~dlkp~Nil  149 (302)
T 2j7t_A          121 VVCRQMLEALNFLHSKRIIHRDLKAGNVL  149 (302)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhcCCcccCCCCHHHEE
Confidence            34578999999999999999999999996

>2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A

Probab=91.16  E-value=0.1  Score=35.28  Aligned_cols=38  Identities=13%  Similarity=0.059  Sum_probs=28.6

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCccc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKA   86 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~pV   86 (264)
                      .|+.|. .+..+||..|...||..|...+.-..|..+||
T Consensus        10 ~C~~H~-e~l~lfC~~d~~~iC~~C~~~~~H~~H~~~~l   47 (53)
T 2did_A           10 LCPQHH-EALSLFCYEDQEAVCLICAISHTHRAHTVVPL   47 (53)
T ss_dssp             BCTTTC-CBCCEEESSSCSEECHHHHTSSTTTTSCEEEC
T ss_pred             cChhhC-CeeeEEeCCCCeEEeccccCCCCCCCCcEeeH
Confidence            478887 77899999999999999997443345544443

>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A*

Probab=91.16  E-value=0.074  Score=47.11  Aligned_cols=28  Identities=18%  Similarity=0.207  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       159 i~~qi~~aL~~LH~~~ivH~Dlkp~NIl  186 (348)
T 1u5q_A          159 VTHGALQGLAYLHSHNMIHRDVKAGNIL  186 (348)
T ss_dssp             HHHHHHHHHHHHHHTTCBCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            4468899999999999999999999997

>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A*

Probab=91.16  E-value=0.064  Score=48.21  Aligned_cols=29  Identities=14%  Similarity=0.119  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~i~~qi~~aL~~LH~~givHrDlkp~NIl  147 (361)
T 2yab_A          119 SFIKQILDGVNYLHTKKIAHFDLKPENIM  147 (361)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            44578999999999999999999999986

>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A*

Probab=91.12  E-value=0.077  Score=44.18  Aligned_cols=28  Identities=14%  Similarity=0.151  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       122 ~~~~i~~~l~~lH~~~i~H~dlkp~Nil  149 (278)
T 1byg_A          122 FSLDVCEAMEYLEGNNFVHRDLAARNVL  149 (278)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCccccCCCcceEE
Confidence            3468999999999999999999999997

>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major}

Probab=91.10  E-value=0.084  Score=45.50  Aligned_cols=28  Identities=11%  Similarity=0.073  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhc--cccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQ--NQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~--~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||  ++.|+|+|+|+.|||
T Consensus       134 ~~~qi~~al~~lH~~~~~ivH~Dlkp~NIl  163 (360)
T 3e3p_A          134 FLFQLIRSIGCLHLPSVNVCHRDIKPHNVL  163 (360)
T ss_dssp             HHHHHHHHHHHHTSTTTCCBCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhCCCCCeecCcCCHHHEE
Confidence            3468999999999  999999999999997

>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens}

Probab=91.10  E-value=0.065  Score=48.04  Aligned_cols=27  Identities=11%  Similarity=0.105  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.|||
T Consensus       193 ~~qi~~aL~~LH~~~ivH~Dlkp~NIl  219 (373)
T 2x4f_A          193 MKQICEGIRHMHQMYILHLDLKPENIL  219 (373)
T ss_dssp             HHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHCCcccccCCHHHEE
Confidence            468999999999999999999999997

>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A*

Probab=91.09  E-value=0.066  Score=46.71  Aligned_cols=29  Identities=7%  Similarity=0.096  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       132 ~i~~ql~~~l~~LH~~~ivH~dlkp~NIl  160 (336)
T 3fhr_A          132 EIMRDIGTAIQFLHSHNIAHRDVKPENLL  160 (336)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999997

>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ...

Probab=91.03  E-value=0.071  Score=45.98  Aligned_cols=28  Identities=14%  Similarity=0.101  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       162 i~~qi~~aL~~LH~~~ivH~Dlkp~NIl  189 (334)
T 2pvf_A          162 CTYQLARGMEYLASQKCIHRDLAARNVL  189 (334)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCccceEE
Confidence            3568999999999999999999999997

>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A*

Probab=91.01  E-value=0.069  Score=44.83  Aligned_cols=29  Identities=7%  Similarity=-0.004  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~i~~qi~~~l~~lH~~~i~H~dl~p~Nil  147 (294)
T 2rku_A          119 YYLRQIVLGCQYLHRNRVIHRDLKLGNLF  147 (294)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCccccCCChHhEE
Confidence            34578999999999999999999999996

>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ...

Probab=91.01  E-value=0.076  Score=48.76  Aligned_cols=29  Identities=17%  Similarity=0.140  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       284 ~i~~qi~~~l~~LH~~~ivHrDlkp~Nil  312 (452)
T 1fmk_A          284 DMAAQIASGMAYVERMNYVHRDLRAANIL  312 (452)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeCCCCChhhEE
Confidence            34578999999999999999999999997

>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens}

Probab=91.00  E-value=0.06  Score=45.59  Aligned_cols=28  Identities=4%  Similarity=0.080  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       144 ~~~qi~~~l~~lH~~~i~H~dlkp~Nil  171 (312)
T 2iwi_A          144 FFGQVVAAIQHCHSRGVVHRDIKDENIL  171 (312)
T ss_dssp             HHHHHHHHHHHHHHHTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeeecCCChhhEE
Confidence            4568899999999999999999999997

>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A*

Probab=91.00  E-value=0.069  Score=46.19  Aligned_cols=29  Identities=10%  Similarity=0.068  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       135 ~i~~ql~~~L~~LH~~givH~Dikp~NIl  163 (327)
T 3lm5_A          135 RLIKQILEGVYYLHQNNIVHLDLKPQNIL  163 (327)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeecCcCChHHEE
Confidence            44578999999999999999999999997

>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7

Probab=90.98  E-value=0.068  Score=48.61  Aligned_cols=29  Identities=7%  Similarity=0.111  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       153 ~i~~qi~~aL~~LH~~givHrDlkp~NIl  181 (387)
T 1kob_A          153 NYMRQACEGLKHMHEHSIVHLDIKPENIM  181 (387)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeecccchHHeE
Confidence            34578999999999999999999999997

>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A*

Probab=90.98  E-value=0.067  Score=44.22  Aligned_cols=29  Identities=7%  Similarity=0.046  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       115 ~~~~qi~~~l~~lH~~~i~H~dl~p~Nil  143 (276)
T 2h6d_A          115 RLFQQILSAVDYCHRHMVVHRDLKPENVL  143 (276)
T ss_dssp             HHHHHHHHHHHHHHHHCSSCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCccCCCChhhEE
Confidence            34578999999999999999999999997

>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A

Probab=90.95  E-value=0.071  Score=49.75  Aligned_cols=27  Identities=22%  Similarity=0.217  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       324 ~~qi~~~L~~LH~~~ivHrDlkp~NIl  350 (495)
T 1opk_A          324 ATQISSAMEYLEKKNFIHRNLAARNCL  350 (495)
T ss_dssp             HHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhCCcccCCCChhhEE
Confidence            468999999999999999999999997

>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A*

Probab=90.94  E-value=0.07  Score=46.30  Aligned_cols=28  Identities=7%  Similarity=0.018  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       146 i~~qi~~aL~~LH~~~ivH~dlkp~NIl  173 (335)
T 2owb_A          146 YLRQIVLGCQYLHRNRVIHRDLKLGNLF  173 (335)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCCEecCCCchhEE
Confidence            3468999999999999999999999996

>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A*

Probab=90.92  E-value=0.084  Score=43.29  Aligned_cols=28  Identities=11%  Similarity=0.050  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       109 ~~~~i~~~l~~lH~~~i~H~dl~p~Nil  136 (267)
T 3t9t_A          109 MCLDVCEGMAYLEEACVIHRDLAARNCL  136 (267)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSSCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCcccCCCchheEE
Confidence            3468999999999999999999999997

>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A*

Probab=90.92  E-value=0.088  Score=45.51  Aligned_cols=28  Identities=7%  Similarity=0.158  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.  |+|+|+++.|||
T Consensus       142 i~~qi~~aL~~LH~~~~~ivH~Dikp~NIl  171 (309)
T 3p86_A          142 MAYDVAKGMNYLHNRNPPIVHRNLKSPNLL  171 (309)
T ss_dssp             HHHHHHHHHHHHHTSSSCCCCTTCCGGGEE
T ss_pred             HHHHHHHHHHHHHcCCCCEECCCCChhhEE
Confidence            3468999999999999  999999999997

>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A*

Probab=90.89  E-value=0.071  Score=46.21  Aligned_cols=29  Identities=17%  Similarity=0.213  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       145 ~i~~qi~~~L~~LH~~~ivH~Dlkp~NIl  173 (321)
T 2c30_A          145 TVCEAVLQALAYLHAQGVIHRDIKSDSIL  173 (321)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34578999999999999999999999997

>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens}

Probab=90.88  E-value=0.073  Score=44.31  Aligned_cols=27  Identities=11%  Similarity=0.268  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.|||
T Consensus       128 ~~qi~~~l~~lH~~~i~H~dl~p~Nil  154 (295)
T 2clq_A          128 TKQILEGLKYLHDNQIVHRDIKGDNVL  154 (295)
T ss_dssp             HHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHhCCEEccCCChhhEE
Confidence            468999999999999999999999997

>1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1

Probab=90.87  E-value=0.19  Score=32.25  Aligned_cols=37  Identities=8%  Similarity=0.007  Sum_probs=27.3

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|+.|. .+..+||..|...||..|...+.-.+|..+|
T Consensus         5 ~C~~H~-e~l~lfC~~d~~~iC~~C~~~~~H~~H~~~~   41 (42)
T 1fre_A            5 KCSEHD-ERLKLYCKDDGTLSCVICRDSLKHASHNFLP   41 (42)
T ss_dssp             CCCSSC-SSCCCCCCSSSSSSCCTTSSCSSCTTCCCCC
T ss_pred             cchhhC-CeeeEEeCCCCeEEeccCCCCCCCCCCcEec
Confidence            477775 6689999999999999998744334554433

>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ...

Probab=90.84  E-value=0.078  Score=43.70  Aligned_cols=29  Identities=7%  Similarity=0.035  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       109 ~~~~~i~~~l~~lH~~~i~H~dl~p~Nil  137 (276)
T 2yex_A          109 RFFHQLMAGVVYLHGIGITHRDIKPENLL  137 (276)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeccCCChHHEE
Confidence            44578999999999999999999999997

>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A

Probab=90.84  E-value=0.082  Score=44.72  Aligned_cols=28  Identities=7%  Similarity=0.157  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       111 ~~~qi~~~l~~lH~~~i~H~dikp~NIl  138 (304)
T 2jam_A          111 VIQQVLSAVKYLHENGIVHRDLKPENLL  138 (304)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCSCCGGGCE
T ss_pred             HHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            3478999999999999999999999997

>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=90.81  E-value=0.078  Score=44.49  Aligned_cols=29  Identities=10%  Similarity=0.130  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       114 ~~~~qi~~~l~~lH~~~i~H~dlkp~Nil  142 (287)
T 1u59_A          114 ELLHQVSMGMKYLEEKNFVHRDLAARNVL  142 (287)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCEeeCCCchheEE
Confidence            34578999999999999999999999997

>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7

Probab=90.80  E-value=0.08  Score=46.02  Aligned_cols=28  Identities=21%  Similarity=0.171  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       152 i~~qi~~aL~~LH~~~ivH~Dikp~NIl  179 (333)
T 1mqb_A          152 MLRGIAAGMKYLANMNYVHRDLAARNIL  179 (333)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCChheEE
Confidence            4568999999999999999999999997

>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A*

Probab=90.78  E-value=0.078  Score=45.47  Aligned_cols=28  Identities=21%  Similarity=0.159  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       132 i~~qi~~al~~lH~~~ivH~Dikp~NIl  159 (327)
T 3lxl_A          132 YSSQICKGMEYLGSRRCVHRDLAARNIL  159 (327)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCccCCCCChhhEE
Confidence            3468999999999999999999999996

>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A*

Probab=90.75  E-value=0.085  Score=45.44  Aligned_cols=28  Identities=11%  Similarity=0.054  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       129 ~~~qi~~~l~~LH~~~ivH~dlkp~Nil  156 (331)
T 4aaa_A          129 YLFQIINGIGFCHSHNIIHRDIKPENIL  156 (331)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEEccCcChheEE
Confidence            4578999999999999999999999997

>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ...

Probab=90.71  E-value=0.077  Score=44.01  Aligned_cols=29  Identities=10%  Similarity=0.098  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       112 ~~~~~i~~~l~~lH~~~i~H~dl~p~Nil  140 (283)
T 3bhy_A          112 QFLKQILDGVHYLHSKRIAHFDLKPENIM  140 (283)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCccCCCCChHHEE
Confidence            34578999999999999999999999997

>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A

Probab=90.66  E-value=0.099  Score=43.79  Aligned_cols=28  Identities=18%  Similarity=0.200  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.  |+|+|.++.|||
T Consensus       134 ~~~qi~~~l~~lH~~~~~i~H~dikp~Nil  163 (290)
T 1t4h_A          134 WCRQILKGLQFLHTRTPPIIHRDLKCDNIF  163 (290)
T ss_dssp             HHHHHHHHHHHHHTSSSCCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHcCCCCEEECCCCHHHEE
Confidence            3578999999999999  999999999986

>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A

Probab=90.64  E-value=0.079  Score=48.59  Aligned_cols=28  Identities=14%  Similarity=0.151  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       294 ~~~qi~~~l~~LH~~~ivHrDlkp~Nil  321 (450)
T 1k9a_A          294 FSLDVCEAMEYLEGNNFVHRDLAARNVL  321 (450)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCCHhhEE
Confidence            4578999999999999999999999997

>2ayu_A Nucleosome assembly protein; histone chaperone; 3.00A {Saccharomyces cerevisiae} SCOP: d.305.1.1 PDB: 2z2r_A

Probab=90.61  E-value=0.018  Score=55.47  Aligned_cols=15  Identities=13%  Similarity=-0.232  Sum_probs=9.1

Q ss_pred             cccccCCCCccccCC
Q 024658           85 KAVVRGGSQSERISG   99 (264)
Q Consensus        85 pV~~~~g~p~~~~~~   99 (264)
                      +|.=|+|-...-+.+
T Consensus       356 AV~yftGea~~~e~e  370 (417)
T 2ayu_A          356 AVDWFTGAALEFEFE  370 (417)
T ss_dssp             HHHHHHSHHHHHHHC
T ss_pred             HHHHhcccccccccc
Confidence            555688876554443

>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A*

Probab=90.61  E-value=0.084  Score=51.42  Aligned_cols=28  Identities=11%  Similarity=0.130  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       474 i~~qi~~~L~yLH~~~iiHrDLkp~NIL  501 (635)
T 4fl3_A          474 LVHQVSMGMKYLEESNFVHRDLAARNVL  501 (635)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEeCCCCChHhEE
Confidence            4568999999999999999999999996

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*

Probab=90.57  E-value=0.077  Score=49.04  Aligned_cols=28  Identities=7%  Similarity=0.134  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       141 i~~qi~~~l~~lH~~~ivH~Dlkp~Nil  168 (494)
T 3lij_A          141 IIKQVLSGVTYLHKHNIVHRDLKPENLL  168 (494)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCceeccCChhhEE
Confidence            4578999999999999999999999997

>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A*

Probab=90.53  E-value=0.092  Score=45.30  Aligned_cols=28  Identities=7%  Similarity=0.146  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccc----------cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ----------TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~----------~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++          .|+|+|.|+.|||
T Consensus       126 i~~qi~~al~~LH~~~~~l~~~~~~~ivH~Dlkp~Nil  163 (322)
T 3soc_A          126 IAETMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVL  163 (322)
T ss_dssp             HHHHHHHHHHHHTCCEEEETTEEECEEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhhccccccccCCCEEeCCCChHhEE
Confidence            356889999999999          9999999999997

>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0

Probab=90.50  E-value=0.096  Score=43.15  Aligned_cols=29  Identities=10%  Similarity=0.192  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhcccc---ccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQT---MTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~---i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.   |+|+|.++.|||
T Consensus       109 ~i~~~l~~~l~~lH~~~~~~i~H~dikp~Nil  140 (271)
T 3dtc_A          109 NWAVQIARGMNYLHDEAIVPIIHRDLKSSNIL  140 (271)
T ss_dssp             HHHHHHHHHHHHHHHSSSSCCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCCCceeecCCchHHEE
Confidence            34578999999999998   999999999997

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A

Probab=90.46  E-value=0.073  Score=52.20  Aligned_cols=27  Identities=15%  Similarity=0.053  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       448 ~~qi~~aL~~LH~~gIiHrDLKp~NIL  474 (674)
T 3pfq_A          448 AAEIAIGLFFLQSKGIIYRDLKLDNVM  474 (674)
T ss_dssp             HHHHHHHHHHHHHTSEECCCCCSTTEE
T ss_pred             HHHHHHHHHHHHhCCeEeccCChhhEE
Confidence            468999999999999999999999996

>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens}

Probab=90.44  E-value=0.091  Score=44.65  Aligned_cols=28  Identities=11%  Similarity=0.177  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       134 i~~qi~~~l~~lH~~~ivH~dlkp~NIl  161 (326)
T 2x7f_A          134 ICREILRGLSHLHQHKVIHRDIKGQNVL  161 (326)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccccCCcHHHEE
Confidence            3468999999999999999999999997

>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7

Probab=90.43  E-value=0.09  Score=49.64  Aligned_cols=28  Identities=18%  Similarity=0.139  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       368 i~~qi~~~L~~LH~~~ivHrDlkp~NIl  395 (535)
T 2h8h_A          368 MAAQIASGMAYVERMNYVHRDLRAANIL  395 (535)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCCHhhEE
Confidence            3568999999999999999999999997

>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe}

Probab=90.33  E-value=0.073  Score=47.34  Aligned_cols=29  Identities=7%  Similarity=0.059  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.++.|||
T Consensus       112 ~i~~qi~~aL~~LH~~givH~Dlkp~NIl  140 (336)
T 3h4j_B          112 RFFQQIICAIEYCHRHKIVHRDLKPENLL  140 (336)
T ss_dssp             HHHHHHHHHHHHHHHHTCCCCCCSTTTEE
T ss_pred             HHHHHHHHHHHHHHHCCeEecCCchhhEE
Confidence            34578999999999999999999999997

>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A*

Probab=90.19  E-value=0.095  Score=44.65  Aligned_cols=28  Identities=18%  Similarity=0.138  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccc---cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ---TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~---~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++   .|+|+|+++.|||
T Consensus       136 i~~~i~~~l~~lH~~~~~~ivH~Dlkp~Nil  166 (326)
T 3uim_A          136 IALGSARGLAYLHDHCDPKIIHRDVKAANIL  166 (326)
T ss_dssp             HHHHHHHHHHHHHHSSSSCEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCCCCeEeCCCchhhEE
Confidence            346788999999999   9999999999996

>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A*

Probab=90.19  E-value=0.091  Score=43.92  Aligned_cols=29  Identities=10%  Similarity=0.141  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       128 ~~~~qi~~~l~~lH~~~i~H~dl~p~Nil  156 (298)
T 1phk_A          128 KIMRALLEVICALHKLNIVHRDLKPENIL  156 (298)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCcceEE
Confidence            44578999999999999999999999997

>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A*

Probab=90.11  E-value=0.097  Score=44.96  Aligned_cols=29  Identities=17%  Similarity=0.088  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|+++.|||
T Consensus       138 ~i~~~l~~~l~~LH~~~ivH~Dikp~Nil  166 (318)
T 3lxp_A          138 LFAQQICEGMAYLHAQHYIHRDLAARNVL  166 (318)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCccCCCCchheEE
Confidence            34578999999999999999999999996

>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens}

Probab=90.11  E-value=0.099  Score=50.52  Aligned_cols=28  Identities=11%  Similarity=0.135  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       441 i~~qi~~~L~~LH~~~iiHrDlkp~NIL  468 (613)
T 2ozo_A          441 LLHQVSMGMKYLEEKNFVHRNLAARNVL  468 (613)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEEcCcCCHHHEE
Confidence            3568999999999999999999999996

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}

Probab=89.93  E-value=0.092  Score=50.87  Aligned_cols=30  Identities=13%  Similarity=0.113  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|+|+.|||
T Consensus       185 ~~~~~qi~~aL~~lH~~giiHrDlkp~NIl  214 (681)
T 2pzi_A          185 IAYLLEILPALSYLHSIGLVYNDLKPENIM  214 (681)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHHCCCeecccChHHeE
Confidence            345678999999999999999999999996

>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis}

Probab=89.87  E-value=0.11  Score=44.47  Aligned_cols=29  Identities=17%  Similarity=0.070  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       138 ~i~~qi~~~l~~lH~~~i~H~dlkp~NIl  166 (309)
T 2h34_A          138 AIVRQIGSALDAAHAAGATHRDVKPENIL  166 (309)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCcCCcCCCChHHEE
Confidence            34578999999999999999999999997

>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens}

Probab=89.78  E-value=0.11  Score=44.73  Aligned_cols=28  Identities=14%  Similarity=0.126  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       150 i~~qi~~aL~~LH~~~ivH~dikp~NIl  177 (326)
T 2w1i_A          150 YTSQICKGMEYLGTKRYIHRDLATRNIL  177 (326)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEeccCCCcceEE
Confidence            3568999999999999999999999997

>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens}

Probab=89.75  E-value=0.12  Score=44.20  Aligned_cols=27  Identities=4%  Similarity=0.043  Sum_probs=24.6

Q ss_pred             hHHHHHHhhhhcc---ccccccCcchhhhH
Q 024658          226 STAIISSLRGLQN---QTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~---~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+   +.|+|+|.++.|||
T Consensus       108 ~~qi~~~l~~LH~~~~~~ivH~dlkp~NIl  137 (307)
T 2eva_A          108 CLQCSQGVAYLHSMQPKALIHRDLKPPNLL  137 (307)
T ss_dssp             HHHHHHHHHHHHTCSSSCCCCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHhCCCCCeecCCCChhHEE
Confidence            3578899999999   88999999999997

>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A*

Probab=89.70  E-value=0.11  Score=43.46  Aligned_cols=29  Identities=7%  Similarity=0.118  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       125 ~i~~qi~~~l~~LH~~~i~H~dl~p~NIl  153 (287)
T 2wei_A          125 RIIKQVFSGITYMHKHNIVHRDLKPENIL  153 (287)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCChhhEE
Confidence            34578999999999999999999999997

>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A*

Probab=89.67  E-value=0.11  Score=43.83  Aligned_cols=28  Identities=11%  Similarity=0.139  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       141 i~~qi~~~l~~LH~~~i~H~dl~p~NIl  168 (310)
T 2wqm_A          141 YFVQLCSALEHMHSRRVMHRDIKPANVF  168 (310)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhCCeeCCCCcHHHEE
Confidence            3468999999999999999999999996

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}

Probab=89.63  E-value=0.1  Score=48.34  Aligned_cols=28  Identities=14%  Similarity=0.154  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.++.|||
T Consensus       151 i~~qi~~~l~~lH~~~ivH~Dlkp~Nil  178 (504)
T 3q5i_A          151 IMKQILSGICYLHKHNIVHRDIKPENIL  178 (504)
T ss_dssp             HHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCeEeCCCcHHHEE
Confidence            4578999999999999999999999998

>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A*

Probab=89.57  E-value=0.11  Score=43.82  Aligned_cols=29  Identities=17%  Similarity=0.161  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       123 ~~~~qi~~~l~~lH~~~i~H~dl~p~Nil  151 (303)
T 3a7i_A          123 TILREILKGLDYLHSEKKIHRDIKAANVL  151 (303)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCccCCCChheEE
Confidence            34578999999999999999999999996

>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A*

Probab=89.23  E-value=0.13  Score=43.87  Aligned_cols=29  Identities=14%  Similarity=0.142  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhc--------cccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQ--------NQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~--------~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||        ++.|+|+|.++.|||
T Consensus       143 ~i~~~i~~~l~~lH~~~~~~~~~~~ivH~Dlkp~NIl  179 (342)
T 1b6c_B          143 KLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL  179 (342)
T ss_dssp             HHHHHHHHHHHHHHCCBCSTTCBCEEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHHHhhhcccCCeeeCCCCHHHEE
Confidence            34578999999999        899999999999997

>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens}

Probab=89.21  E-value=0.12  Score=43.66  Aligned_cols=28  Identities=14%  Similarity=0.023  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       130 i~~~i~~~l~~lH~~~i~H~dl~p~Nil  157 (314)
T 3com_A          130 ILQSTLKGLEYLHFMRKIHRDIKAGNIL  157 (314)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhCCCcCCCcCHHHEE
Confidence            4578999999999999999999999997

>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus}

Probab=89.05  E-value=0.13  Score=48.53  Aligned_cols=29  Identities=7%  Similarity=0.038  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.++.|||
T Consensus       120 ~i~~qi~~aL~~LH~~givHrDLkp~NIl  148 (476)
T 2y94_A          120 RLFQQILSGVDYCHRHMVVHRDLKPENVL  148 (476)
T ss_dssp             HHHHHHHHHHHHHHTTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCCcccccHHHEE
Confidence            34578999999999999999999999996

>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A*

Probab=88.81  E-value=0.13  Score=50.38  Aligned_cols=28  Identities=14%  Similarity=0.173  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       291 i~~qIl~aL~yLH~~gIvHrDLKPeNIL  318 (576)
T 2acx_A          291 YAAEICCGLEDLHRERIVYRDLKPENIL  318 (576)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCEeccCCchheEE
Confidence            3468999999999999999999999997

>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A

Probab=88.71  E-value=0.13  Score=45.54  Aligned_cols=29  Identities=10%  Similarity=0.134  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       204 ~i~~qi~~~L~~LH~~gi~H~Dlkp~NIl  232 (365)
T 2y7j_A          204 SIMRSLLEAVSFLHANNIVHRDLKPENIL  232 (365)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999997

>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens}

Probab=88.65  E-value=0.14  Score=43.11  Aligned_cols=29  Identities=17%  Similarity=0.221  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++ .|+|+|.++.|||
T Consensus       128 ~~~~~i~~~l~~lH~~~~i~H~dlkp~Nil  157 (318)
T 2dyl_A          128 KMTVAIVKALYYLKEKHGVIHRDVKPSNIL  157 (318)
T ss_dssp             HHHHHHHHHHHHHHHHHCCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhhCCEEeCCCCHHHEE
Confidence            3457899999999997 8999999999997

>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A*

Probab=88.64  E-value=0.16  Score=44.93  Aligned_cols=29  Identities=10%  Similarity=0.017  Sum_probs=25.3

Q ss_pred             chhHHHHHHhhhhc--cccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQ--NQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~--~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||  ++.|+|||+|+.|||
T Consensus       161 ~i~~qi~~al~~lH~~~~~ivHrDlkp~NIl  191 (382)
T 2vx3_A          161 KFAQQMCTALLFLATPELSIIHCDLKPENIL  191 (382)
T ss_dssp             HHHHHHHHHHHHHTSTTTCEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHhccCCCCEEcCCCCcccEE
Confidence            34578999999999  568999999999997

>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A*

Probab=88.52  E-value=0.13  Score=42.50  Aligned_cols=29  Identities=10%  Similarity=0.117  Sum_probs=25.0

Q ss_pred             chhHHHHHHhhhhcccc-----ccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQT-----MTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~-----i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.     |+|+|.++.|||
T Consensus       115 ~i~~~i~~~l~~lH~~~~~~~~ivH~dl~p~NIl  148 (279)
T 2w5a_A          115 RVMTQLTLALKECHRRSDGGHTVLHRDLKPANVF  148 (279)
T ss_dssp             HHHHHHHHHHHHHHHHC------CCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhcccCCCCeeEEeccchhhEE
Confidence            34578999999999999     999999999997

>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X*

Probab=88.39  E-value=0.15  Score=43.63  Aligned_cols=29  Identities=10%  Similarity=0.211  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+ +.|+|+|.++.|||
T Consensus       155 ~i~~qi~~~l~~lH~~~~i~H~dl~p~Nil  184 (348)
T 2pml_X          155 CIIKSVLNSFSYIHNEKNICHRDVKPSNIL  184 (348)
T ss_dssp             HHHHHHHHHHHHHHHTSCEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhccCCEeecCCChHhEE
Confidence            345789999999999 99999999999997

>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B

Probab=88.29  E-value=0.15  Score=49.33  Aligned_cols=27  Identities=15%  Similarity=0.256  Sum_probs=25.4

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       295 ~~qi~~aL~~LH~~gIvHrDLKP~NIL  321 (543)
T 3c4z_A          295 TAQIVSGLEHLHQRNIIYRDLKPENVL  321 (543)
T ss_dssp             HHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHcCCcccCCChHHEE
Confidence            568999999999999999999999996

>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ...

Probab=88.26  E-value=0.15  Score=44.31  Aligned_cols=28  Identities=21%  Similarity=0.261  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++ .|+|+|+++.|||
T Consensus       136 i~~~i~~~l~~lh~~~~i~H~dlkp~Nil  164 (360)
T 3eqc_A          136 VSIAVIKGLTYLREKHKIMHRDVKPSNIL  164 (360)
T ss_dssp             HHHHHHHHHHHHHHHHCCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCEEcCCccHHHEE
Confidence            457899999999997 8999999999997

>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A*

Probab=87.69  E-value=0.18  Score=49.24  Aligned_cols=27  Identities=15%  Similarity=0.192  Sum_probs=25.4

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       497 ~~qi~~aL~~LH~~givHrDikp~NIL  523 (656)
T 2j0j_A          497 AYQLSTALAYLESKRFVHRDIAARNVL  523 (656)
T ss_dssp             HHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhCCccccccchHhEE
Confidence            468999999999999999999999997

>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A*

Probab=87.46  E-value=0.18  Score=43.06  Aligned_cols=29  Identities=14%  Similarity=0.204  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++ .|+|+|.++.|||
T Consensus       129 ~i~~~i~~~l~~lH~~~~ivH~dlkp~NIl  158 (327)
T 3aln_A          129 KITLATVKALNHLKENLKIIHRDIKPSNIL  158 (327)
T ss_dssp             HHHHHHHHHHHHHHHHHSCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhccCCEeECCCCHHHEE
Confidence            3457899999999998 9999999999997

>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A

Probab=85.47  E-value=0.22  Score=47.15  Aligned_cols=31  Identities=13%  Similarity=0.067  Sum_probs=27.6

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +..--.+|+..|.+||+..|+|||.++.|||
T Consensus       207 ~~~l~~qll~~l~~lH~~gIVHrDLKp~NIL  237 (397)
T 4gyi_A          207 PASLYADLIALILRLAKHGLIHGDFNEFNIL  237 (397)
T ss_dssp             HHHHHHHHHHHHHHHHHTTEECSCCSTTSEE
T ss_pred             HHHHHHHHHHHHHHHHHCCCcCCCCCHHHEE
Confidence            3445678999999999999999999999997

>4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens}

Probab=85.34  E-value=0.16  Score=47.00  Aligned_cols=20  Identities=65%  Similarity=1.126  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCcchhhccccC
Q 024658          113 DDDDDDDEDPDEEEEEEDDE  132 (264)
Q Consensus       113 d~~~dd~e~e~~~~~ee~~e  132 (264)
                      ++|++|++.+|.+++.+|.|
T Consensus       314 ~~~~~~~~~~~~~~~~~~~~  333 (335)
T 4fp9_B          314 DDDEDDDEAEDNDEDEDDDE  333 (335)
T ss_dssp             --------------------
T ss_pred             Cccccccccccccccccccc
Confidence            33333333444333444433

>2yrg_A Tripartite motif-containing protein 5; B-box domain, ring finger protein 88, structural genomics, NPPSFA; NMR {Homo sapiens}

Probab=84.44  E-value=0.48  Score=33.02  Aligned_cols=37  Identities=11%  Similarity=-0.058  Sum_probs=27.4

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|+.|. .+..+||..|...||..|...+.-..|..+|
T Consensus        16 ~C~~H~-e~L~lfC~~d~~~iC~~C~~s~eH~~H~~~~   52 (59)
T 2yrg_A           16 HCARHG-EKLLLFCQEDGKVICWLCERSQEHRGHHTFP   52 (59)
T ss_dssp             BCTTTC-CBCCEEETTTCSEECHHHHTSTTTTTCCEEE
T ss_pred             cChhhC-ceeeeecCCCCcEEecccCCCCcCCCCcEee
Confidence            477776 5688999999999999998744334554444

>2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1

Probab=83.33  E-value=0.49  Score=33.80  Aligned_cols=37  Identities=8%  Similarity=0.038  Sum_probs=28.0

Q ss_pred             cccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           47 HVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        47 ~~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      ..|+.|. .+..+||..|...||..|.. +.-..|.-+|
T Consensus        19 ~~C~~H~-e~l~lfC~~d~~~iC~~C~~-~~H~~H~~~~   55 (72)
T 2csv_A           19 RKCPVHG-KTMELFCQTDQTCICYLCMF-QEHKNHSTVT   55 (72)
T ss_dssp             CBCTTTC-CBCCEEESSSCCEECHHHHH-TTTSSSCEEE
T ss_pred             CcCcccC-CceEEEeCCCCeEEccccCC-CCCCCCCEec
Confidence            3688884 77999999999999999987 4224454444

>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1

Probab=80.45  E-value=5  Score=31.60  Aligned_cols=37  Identities=16%  Similarity=0.260  Sum_probs=29.1

Q ss_pred             CcccccccccccccCCC----CceecccCCCCcccCchhhh
Q 024658           38 AKHLRCLLCHVCQSLTP----WKASGPKLGPTVSVCDACVA   74 (264)
Q Consensus        38 ~rH~RvpLC~~C~~~p~----~ka~~~C~~d~~~LC~~Cd~   74 (264)
                      .+|.-.++|++|...-.    -.+.+.|..|+.+||..|.-
T Consensus        11 ~~~~~~qiCqiCGD~VG~~~~Ge~FVAC~eC~FPvCrpCyE   51 (93)
T 1weo_A           11 LKNLDGQFCEICGDQIGLTVEGDLFVACNECGFPACRPCYE   51 (93)
T ss_dssp             CSCCSSCBCSSSCCBCCBCSSSSBCCSCSSSCCCCCHHHHH
T ss_pred             ccccCCCccccccCccccCCCCCEEEeeeccCChhhHHHHH
Confidence            45666789999975432    22788999999999999987

>2ffw_A Midline-1; B-BOX, ring finger, zinc-finger, ligase; NMR {Homo sapiens}

Probab=80.38  E-value=0.67  Score=34.21  Aligned_cols=40  Identities=23%  Similarity=0.415  Sum_probs=33.4

Q ss_pred             CCCCCCCC----CceEEecCCCcccccccCcccccccccCCccc
Q 024658            2 RKCELCEC----PARMYCESDQASLCWDCDEKVHCANFLVAKHL   41 (264)
Q Consensus         2 ~~Cd~C~~----pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~   41 (264)
                      ..|++|..    +|+.+|-...+.||..|=...|...+.+++|.
T Consensus        31 v~C~~C~~~~~~~A~ksCl~C~~s~C~~hl~~~H~~~~~~~~H~   74 (78)
T 2ffw_A           31 VLCQFCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHR   74 (78)
T ss_dssp             CBCSSCCSSSCCBCCEEETTTTEEECHHHHHHHSCCCSSSCSCC
T ss_pred             ccCCcCCCCCCCCCeeEccCccchhhhhhhHhhcCCCCCCCCCc
Confidence            47999974    59999999999999999777787776777875

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Length	Definition	E-value
Query	264
d1qkla_	127	a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId:	2e-04
d1qkla_	127	a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId:	0.002
d1qkla_	127	a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId:	0.002
d1qkla_	127	a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId:	0.004

>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127

class: All alpha proteins
fold: RPB6/omega subunit-like
superfamily: RPB6/omega subunit-like
family: RPB6
domain: RPB6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.9 bits (88), Expect = 2e-04
 Identities = 8/31 (25%), Positives = 22/31 (70%)

Query: 104 DDDDDYEDEDDDDDDDEDPDEEEEEEDDENQ 134
           D++D+++ +D DD ++++  ++ E  ++E Q
Sbjct: 3   DNEDNFDGDDFDDVEEDEGLDDLENAEEEGQ 33

>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127

class: All alpha proteins
fold: RPB6/omega subunit-like
superfamily: RPB6/omega subunit-like
family: RPB6
domain: RPB6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 35.2 bits (81), Expect = 0.002
 Identities = 12/33 (36%), Positives = 18/33 (54%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
           D  D+ D  + +D ++D+  D  E  EEE  EN
Sbjct: 3   DNEDNFDGDDFDDVEEDEGLDDLENAEEEGQEN 35

>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127

class: All alpha proteins
fold: RPB6/omega subunit-like
superfamily: RPB6/omega subunit-like
family: RPB6
domain: RPB6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.8 bits (80), Expect = 0.002
 Identities = 10/37 (27%), Positives = 22/37 (59%)

Query: 101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVP 137
           +E + D D  D+ ++D+  +D +  EEE  +  +++P
Sbjct: 4   NEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILP 40

>d1qkla_ a.143.1.2 (A:) RPB6 {Human (Homo sapiens) [TaxId: 9606]} Length = 127

class: All alpha proteins
fold: RPB6/omega subunit-like
superfamily: RPB6/omega subunit-like
family: RPB6
domain: RPB6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.4 bits (79), Expect = 0.004
 Identities = 10/36 (27%), Positives = 23/36 (63%)

Query: 98  SGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN 133
           S +++  D DD++D ++D+  D+  + EEE +++  
Sbjct: 2   SDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVE 37

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	264
d1ywna1	299	Vascular endothelial growth factor receptor 2 (kdr	95.89
d1gz8a_	298	Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T	95.7
d1ckia_	299	Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax	95.59
d1u5ra_	309	Serine/threonine protein kinase TAO2 {Rat (Rattus	95.57
d1uwha_	276	B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}	95.56
d1yhwa1	293	pak1 {Human (Homo sapiens) [TaxId: 9606]}	95.56
d1q5ka_	350	Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho	95.56
d1opja_	287	Abelsone tyrosine kinase (abl) {Mouse (Mus musculu	95.55
d1nvra_	271	Cell cycle checkpoint kinase chk1 {Human (Homo sap	95.55
d1blxa_	305	Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T	95.53
d1ob3a_	286	Cyclin-dependent PK, CDK2 {(Plasmodium falciparum)	95.51
d2j4za1	263	Aurora-related kinase 1 (aurora-2) {Human (Homo sa	95.49
d1rjba_	325	Fl cytokine receptor {Human (Homo sapiens) [TaxId:	95.42
d1ua2a_	299	Cell division protein kinase 7, CDK7 {Human (Homo	95.39
d2jfla1	288	STE20-like serine/threonine-protein kinase, SLK {H	95.34
d3bqca1	328	Protein kinase CK2, alpha subunit {Rattus norvegic	95.3
d1xwsa_	273	Proto-oncogene serine/threonine-protein kinase Pim	95.28
d1pmea_	345	MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606	95.25
d2dq5a1	47	Midline-1 {Human (Homo sapiens) [TaxId: 9606]}	95.17
d1t4ha_	270	Protein kinase wnk1 {Human (Homo sapiens) [TaxId:	95.17
d1unla_	292	Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T	95.17
d1rdqe_	350	cAMP-dependent PK, catalytic subunit {Mouse (Mus m	95.15
d1s9ja_	322	Dual specificity mitogen-activated protein kinase	95.14
d1o6ya_	277	Mycobacterial protein kinase PknB, catalytic domai	95.14
d1cm8a_	346	MAP kinase p38-gamma {Human (Homo sapiens) [TaxId:	95.13
d1jpaa_	299	ephb2 receptor tyrosine kinase {Mouse (Mus musculu	95.08
d2gfsa1	348	MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]	95.01
d1mqba_	283	epha2 receptor tyrosine kinase {Human (Homo sapien	95.01
d1koba_	352	Twitchin, kinase domain {California sea hare (Aply	95.0
d1o6la_	337	Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9	94.93
d1qpca_	272	Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax	94.88
d1fota_	316	cAMP-dependent PK, catalytic subunit {Baker's yeas	94.76
d1csna_	293	Casein kinase-1, CK1 {Fission yeast (Schizosacchar	94.71
d1zara2	191	Rio2 serine protein kinase C-terminal domain {Arch	94.64
d1tkia_	321	Titin, kinase domain {Human (Homo sapiens) [TaxId:	94.64
d1xbba_	277	Tyrosine-protein kinase SYK {Human (Homo sapiens)	94.63
d1xkka_	317	EGF receptor tyrosine kinase, Erbb-1 {Human (Homo	94.62
d1koaa2	350	Twitchin, kinase domain {Caenorhabditis elegans, p	94.61
d2ozaa1	335	MAP kinase activated protein kinase 2, mapkap2 {Hu	94.57
d1u46a_	273	Activated CDC42 kinase 1, ACK1 {Human (Homo sapien	94.55
d1omwa3	364	G-protein coupled receptor kinase 2 {Cow (Bos taur	94.49
d1a06a_	307	Calmodulin-dependent protein kinase {Rat (Rattus n	94.49
d1uu3a_	288	3-phosphoinositide dependent protein kinase-1 Pdk1	94.46
d1mp8a_	273	Focal adhesion kinase 1 (fak) {Human (Homo sapiens	94.43
d2d8ua1	51	Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax	94.42
d3blha1	318	Cell division protein kinase 9, CDK9 {Human (Homo	94.41
d2djaa1	71	Midline-2 {Human (Homo sapiens) [TaxId: 9606]}	94.41
d1fmka3	285	c-src tyrosine kinase {Human (Homo sapiens) [TaxId	94.38
d1t46a_	311	c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]	94.34
d1u59a_	285	Tyrosine-protein kinase ZAP-70 {Human (Homo sapien	94.31
d1jksa_	293	Death-associated protein kinase, Dap {Human (Homo	94.29
d1fgka_	299	Fibroblast growth factor receptor 1 {Human (Homo s	94.28
d1sm2a_	263	Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie	94.21
d1frea_	39	Nuclear factor XNF7 {African clawed frog (Xenopus	94.15
d1r0pa_	311	Hepatocyte growth factor receptor, c-MET {Human (H	94.11
d2java1	269	Serine/threonine-protein kinase Nek2 {Human (Homo	93.88
d1phka_	277	gamma-subunit of glycogen phosphorylase kinase (Ph	93.87
d1xjda_	320	Protein kinase C, theta type {Human (Homo sapiens)	93.78
d1lufa_	301	Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax	93.55
d2b1pa1	355	c-jun N-terminal kinase (jnk3s) {Human (Homo sapie	93.26
d1p4oa_	308	Insulin-like growth factor 1 receptor {Human (Homo	92.7
d1fvra_	309	Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}	92.58
d2dida1	40	Tripartite motif-containing protein 39 {Human (Hom	92.54
d1k2pa_	258	Bruton's tyrosine kinase (Btk) {Human (Homo sapien	92.45
d1q8ya_	362	Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T	92.06
d1vzoa_	322	Ribosomal protein S6 kinase alpha 5, Msk1 {Human (	91.92
d1byga_	262	Carboxyl-terminal src kinase (csk) {Human (Homo sa	91.59
d1vjya_	303	Type I TGF-beta receptor R4 {Human (Homo sapiens)	87.05
d2csva1	59	Tripartite motif-containing protein 29 {Human (Hom	85.4

>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Vascular endothelial growth factor receptor 2 (kdr)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.89  E-value=0.0012  Score=55.32  Aligned_cols=30  Identities=17%  Similarity=0.129  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|++||++.|+|||+|++|||
T Consensus       137 ~~~~~qi~~gl~ylH~~~ivHrDlKp~NIL  166 (299)
T d1ywna1         137 ICYSFQVAKGMEFLASRKCIHRDLAARNIL  166 (299)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHhCCCcCCcCCcccee
Confidence            345678999999999999999999999995

>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.70  E-value=0.0015  Score=54.92  Aligned_cols=29  Identities=7%  Similarity=0.015  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|||+|+.|||
T Consensus       106 ~~~~qil~~L~yLH~~~IiHrDiKpeNIl  134 (298)
T d1gz8a_         106 SYLFQLLQGLAFCHSHRVLHRDLKPQNLL  134 (298)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhcCCEEccccCchhee
Confidence            44578999999999999999999999997

>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Casein kinase-1, CK1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=95.59  E-value=0.0017  Score=54.22  Aligned_cols=30  Identities=7%  Similarity=0.137  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|||.|++|||
T Consensus       106 ~~~~~qi~~~l~~lH~~~iiHrDiKp~NIl  135 (299)
T d1ckia_         106 LLLADQMISRIEYIHSKNFIHRDVKPDNFL  135 (299)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHHCCeeeccCCHhhcc
Confidence            345578999999999999999999999995

>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine protein kinase TAO2
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=95.57  E-value=0.0018  Score=55.66  Aligned_cols=29  Identities=17%  Similarity=0.212  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       119 ~i~~qi~~aL~yLH~~~iiHrDiKp~NIL  147 (309)
T d1u5ra_         119 AVTHGALQGLAYLHSHNMIHRDVKAGNIL  147 (309)
T ss_dssp             HHHHHHHHHHHHHHHTTCBCCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCEeccCCCcceEE
Confidence            44589999999999999999999999997

>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.56  E-value=0.0019  Score=54.42  Aligned_cols=30  Identities=7%  Similarity=0.105  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|||.|++|||
T Consensus       107 ~~i~~qi~~gl~yLH~~~ivHrDlKp~NiL  136 (276)
T d1uwha_         107 IDIARQTAQGMDYLHAKSIIHRDLKSNNIF  136 (276)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhcCCEeccccCHHHEE
Confidence            345679999999999999999999999997

>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.56  E-value=0.0016  Score=55.59  Aligned_cols=29  Identities=10%  Similarity=0.117  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||+|++|||
T Consensus       120 ~i~~qi~~aL~yLH~~~iiHrDiKp~NIL  148 (293)
T d1yhwa1         120 AVCRECLQALEFLHSNQVIHRDIKSDNIL  148 (293)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCcccCCcHHHeE
Confidence            44579999999999999999999999997

>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Glycogen synthase kinase-3 beta (Gsk3b)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.56  E-value=0.0018  Score=55.76  Aligned_cols=28  Identities=7%  Similarity=0.029  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|||+|+.|||
T Consensus       127 i~~qil~aL~yLH~~~IiHrDiKp~NIL  154 (350)
T d1q5ka_         127 YMYQLFRSLAYIHSFGICHRDIKPQNLL  154 (350)
T ss_dssp             HHHHHHHHHHHHHTTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhcCCcccCCCcceEE
Confidence            3579999999999999999999999996

>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Abelsone tyrosine kinase (abl)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.55  E-value=0.0019  Score=54.57  Aligned_cols=27  Identities=22%  Similarity=0.213  Sum_probs=25.6

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|++||++.|+|||.|++|||
T Consensus       121 ~~qi~~gL~yLH~~~iiHrDlKp~NIL  147 (287)
T d1opja_         121 ATQISSAMEYLEKKNFIHRDLAARNCL  147 (287)
T ss_dssp             HHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHCCcccCccccCeEE
Confidence            468999999999999999999999998

>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.55  E-value=0.0017  Score=54.82  Aligned_cols=30  Identities=7%  Similarity=0.017  Sum_probs=27.2

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|++||++.|+|||+|+.|||
T Consensus       106 ~~i~~qi~~al~ylH~~~IiHrDiKp~NIL  135 (271)
T d1nvra_         106 QRFFHQLMAGVVYLHGIGITHRDIKPENLL  135 (271)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHHcCCccCcccHHHEE
Confidence            345689999999999999999999999997

>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK6
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.53  E-value=0.0019  Score=53.75  Aligned_cols=28  Identities=11%  Similarity=0.093  Sum_probs=26.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       121 ~~~qi~~aL~yLH~~~ivHrDiKp~NIL  148 (305)
T d1blxa_         121 MMFQLLRGLDFLHSHRVVHRDLKPQNIL  148 (305)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhCCEEecCCCccEEE
Confidence            4578999999999999999999999997

>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK2
species: (Plasmodium falciparum) [TaxId: 5833]

Probab=95.51  E-value=0.0019  Score=53.45  Aligned_cols=28  Identities=0%  Similarity=0.011  Sum_probs=26.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|||+|++|||
T Consensus       105 i~~qi~~~L~~LH~~~IvHrDiKp~NIl  132 (286)
T d1ob3a_         105 FLLQLLNGIAYCHDRRVLHRDLKPQNLL  132 (286)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHhccCcEEecCCCCceee
Confidence            4578999999999999999999999997

>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.49  E-value=0.002  Score=54.04  Aligned_cols=29  Identities=7%  Similarity=0.076  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.|++|||
T Consensus       110 ~i~~qi~~al~~lH~~~ivHrDiKp~Nil  138 (263)
T d2j4za1         110 TYITELANALSYCHSKRVIHRDIKPENLL  138 (263)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCeeeeeeccccce
Confidence            34579999999999999999999999996

>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fl cytokine receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.42  E-value=0.0019  Score=55.25  Aligned_cols=30  Identities=10%  Similarity=0.079  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|++||++.|+|||+|++|||
T Consensus       167 ~~i~~qi~~gl~yLH~~~IiHRDlKp~Nil  196 (325)
T d1rjba_         167 LCFAYQVAKGMEFLEFKSCVHRDLAARNVL  196 (325)
T ss_dssp             HHHHHHHHHHHHHHHHTTEEETTCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHhCCeeeccCchhccc
Confidence            345679999999999999999999999997

>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell division protein kinase 7, CDK7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.39  E-value=0.0022  Score=53.56  Aligned_cols=30  Identities=7%  Similarity=0.014  Sum_probs=27.2

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|++||++.|+|||+|+.|||
T Consensus       103 ~~~~~qil~aL~~lH~~~iiHrDiKp~NIl  132 (299)
T d1ua2a_         103 KAYMLMTLQGLEYLHQHWILHRDLKPNNLL  132 (299)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHhhccceecccCCcceEE
Confidence            345579999999999999999999999997

>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: STE20-like serine/threonine-protein kinase, SLK
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.34  E-value=0.0022  Score=54.47  Aligned_cols=29  Identities=14%  Similarity=0.164  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       114 ~i~~qi~~gL~ylH~~~ivHrDiKp~NIl  142 (288)
T d2jfla1         114 VVCKQTLDALNYLHDNKIIHRDLKAGNIL  142 (288)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCEEEeecChhhee
Confidence            34579999999999999999999999997

>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase CK2, alpha subunit
species: Rattus norvegicus [TaxId: 10116]

Probab=95.30  E-value=0.0023  Score=54.06  Aligned_cols=29  Identities=7%  Similarity=0.009  Sum_probs=26.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||+|+.|||
T Consensus       133 ~i~~qil~aL~~LH~~gIvHrDiKp~NIL  161 (328)
T d3bqca1         133 FYMYEILKALDYCHSMGIMHRDVKPHNVM  161 (328)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhhcccccccccccceE
Confidence            44589999999999999999999999997

>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Proto-oncogene serine/threonine-protein kinase Pim-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.28  E-value=0.0025  Score=53.11  Aligned_cols=29  Identities=14%  Similarity=0.060  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       114 ~~~~qi~~al~~lH~~~iiHrDiKp~NIl  142 (273)
T d1xwsa_         114 SFFWQVLEAVRHCHNCGVLHRDIKDENIL  142 (273)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCccccCcccceE
Confidence            34579999999999999999999999997

>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase Erk2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.25  E-value=0.0025  Score=54.70  Aligned_cols=29  Identities=7%  Similarity=0.072  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||+|+.|||
T Consensus       113 ~i~~qil~al~yLH~~~iiHRDIKp~NIL  141 (345)
T d1pmea_         113 YFLYQILRGLKYIHSANVLHRDLKPSNLL  141 (345)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCcCCCCCcceEE
Confidence            34589999999999999999999999997

>d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: B-box zinc-binding domain
superfamily: B-box zinc-binding domain
family: B-box zinc-binding domain
domain: Midline-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.17  E-value=0.0059  Score=40.10  Aligned_cols=38  Identities=13%  Similarity=0.144  Sum_probs=29.4

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|+.|+.....+||..|..++|..|...+.=.+|.-.+
T Consensus         7 ~C~~H~~e~l~~yC~~C~~~iC~~C~~~~~H~~H~~~~   44 (47)
T d2dq5a1           7 MCLEHEDEKVNMYCVTDDQLICALCKLVGRHRDHQVAA   44 (47)
T ss_dssp             BCSSCTTSBEEEEETTTTEEEEHHHHHTSSTTSSCCCC
T ss_pred             cchhhCCCcceEEcCCCCccCCccCcCcCCcCCCeEee
Confidence            36899888899999999999999998754334454333

>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase wnk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.17  E-value=0.0033  Score=52.80  Aligned_cols=29  Identities=21%  Similarity=0.218  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.  |+|||+|++|||
T Consensus       116 ~~~~qi~~gl~yLH~~~~~IiHrDiKp~NIL  146 (270)
T d1t4ha_         116 SWCRQILKGLQFLHTRTPPIIHRDLKCDNIF  146 (270)
T ss_dssp             HHHHHHHHHHHHHHTSSSCCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHCCCCEEeCCcChhhce
Confidence            34579999999999988  999999999996

>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cyclin-dependent PK, CDK5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.17  E-value=0.0027  Score=52.04  Aligned_cols=29  Identities=7%  Similarity=0.005  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||.+.|+|||+|+.|||
T Consensus       105 ~~~~q~~~aL~~lH~~~IvHrDiKP~NIl  133 (292)
T d1unla_         105 SFLFQLLKGLGFCHSRNVLHRDLKPQNLL  133 (292)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHhhcCCEeeecccCcccc
Confidence            34578999999999999999999999996

>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.15  E-value=0.0026  Score=55.46  Aligned_cols=29  Identities=7%  Similarity=0.053  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       145 ~i~~qi~~aL~yLH~~~iiHRDIKP~NIL  173 (350)
T d1rdqe_         145 FYAAQIVLTFEYLHSLDLIYRDLKPENLL  173 (350)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCEecCcCCHHHcc
Confidence            34588999999999999999999999997

>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Dual specificity mitogen-activated protein kinase kinase 1, Mek1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.14  E-value=0.0026  Score=54.33  Aligned_cols=29  Identities=21%  Similarity=0.253  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++ .|+|||+|++|||
T Consensus       108 ~~~~qil~aL~yLH~~~~IiHRDiKP~NIL  137 (322)
T d1s9ja_         108 KVSIAVIKGLTYLREKHKIMHRDVKPSNIL  137 (322)
T ss_dssp             HHHHHHHHHHHHHHHHHCCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHhCCEEccccCHHHee
Confidence            3457999999999986 7999999999998

>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Mycobacterial protein kinase PknB, catalytic domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=95.14  E-value=0.0028  Score=52.53  Aligned_cols=29  Identities=10%  Similarity=0.014  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       115 ~i~~qi~~al~~lH~~~iiHrDiKP~NIl  143 (277)
T d1o6ya_         115 EVIADACQALNFSHQNGIIHRDVKPANIM  143 (277)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCccCccccCcccc
Confidence            44589999999999999999999999996

>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase p38-gamma
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.13  E-value=0.0027  Score=54.09  Aligned_cols=29  Identities=7%  Similarity=0.096  Sum_probs=26.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||+|+.|||
T Consensus       125 ~~~~qi~~aL~~LH~~~IiHrDiKp~NIL  153 (346)
T d1cm8a_         125 FLVYQMLKGLRYIHAAGIIHRDLKPGNLA  153 (346)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCCcccccCcchhh
Confidence            44588999999999999999999999997

>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.08  E-value=0.0032  Score=53.46  Aligned_cols=30  Identities=20%  Similarity=0.184  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|||.|++|||
T Consensus       131 ~~i~~qia~gl~yLH~~~iiHrDlKp~NIL  160 (299)
T d1jpaa_         131 VGMLRGIAAGMKYLADMNYVHRDLAARNIL  160 (299)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhhCCCccCccccceEE
Confidence            345579999999999999999999999997

>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase p38
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.01  E-value=0.0035  Score=53.01  Aligned_cols=30  Identities=7%  Similarity=0.091  Sum_probs=27.2

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       124 ~~i~~qil~aL~~LH~~giiHrDiKp~NIL  153 (348)
T d2gfsa1         124 QFLIYQILRGLKYIHSADIIHRDLKPSNLA  153 (348)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHhCCCcccccCCcccc
Confidence            344689999999999999999999999997

>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: epha2 receptor tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.01  E-value=0.0036  Score=52.35  Aligned_cols=29  Identities=21%  Similarity=0.170  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.|+.|||
T Consensus       114 ~i~~~i~~gl~~lH~~~iiHrDlKp~NIL  142 (283)
T d1mqba_         114 GMLRGIAAGMKYLANMNYVHRDLAARNIL  142 (283)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHhhhhccccccccCccccceEE
Confidence            44578999999999999999999999997

>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Twitchin, kinase domain
species: California sea hare (Aplysia californica), twk43 [TaxId: 6500]

Probab=95.00  E-value=0.0031  Score=55.16  Aligned_cols=31  Identities=6%  Similarity=0.127  Sum_probs=27.7

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...-..+|+.+|++||++.|+|||+|++|||
T Consensus       129 ~~~i~~qi~~aL~ylH~~~iiHRDiKp~NIL  159 (352)
T d1koba_         129 VINYMRQACEGLKHMHEHSIVHLDIKPENIM  159 (352)
T ss_dssp             HHHHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHHHCCeeeccccccccc
Confidence            3345689999999999999999999999998

>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Pkb kinase (Akt-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.93  E-value=0.0037  Score=54.46  Aligned_cols=27  Identities=15%  Similarity=0.203  Sum_probs=25.6

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       111 ~~qil~al~ylH~~~iiHRDlKP~NIL  137 (337)
T d1o6la_         111 GAEIVSALEYLHSRDVVYRDIKLENLM  137 (337)
T ss_dssp             HHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHhhhhhhhhhcCccccccCHHHeE
Confidence            478999999999999999999999997

>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Lymphocyte kinase (lck)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.88  E-value=0.0038  Score=52.03  Aligned_cols=29  Identities=14%  Similarity=0.143  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       113 ~i~~qi~~gl~~lH~~~ivHrDiKp~NIl  141 (272)
T d1qpca_         113 DMAAQIAEGMAFIEERNYIHRDLRAANIL  141 (272)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCcccCccchhhee
Confidence            44678999999999999999999999995

>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.76  E-value=0.0043  Score=53.24  Aligned_cols=27  Identities=11%  Similarity=0.122  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|++|||
T Consensus       110 ~~qi~~al~~lH~~~iiHrDiKp~NIL  136 (316)
T d1fota_         110 AAEVCLALEYLHSKDIIYRDLKPENIL  136 (316)
T ss_dssp             HHHHHHHHHHHHTTTEECCCCCGGGEE
T ss_pred             HHHHHHhhhhhccCcEEccccCchhee
Confidence            468999999999999999999999996

>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Casein kinase-1, CK1
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=94.71  E-value=0.0047  Score=51.83  Aligned_cols=28  Identities=0%  Similarity=0.181  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|++|||
T Consensus       106 i~~q~~~~l~~lH~~giiHrDiKp~Nil  133 (293)
T d1csna_         106 AAKQMLARVQSIHEKSLVYRDIKPDNFL  133 (293)
T ss_dssp             HHHHHHHHHHHHHTTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHCCceeccCCcccee
Confidence            4578889999999999999999999997

>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: RIO1-like kinases
domain: Rio2 serine protein kinase C-terminal domain
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=94.64  E-value=0.004  Score=48.74  Aligned_cols=29  Identities=3%  Similarity=0.035  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .--.+|+..|.+||++.|+|+|.|+.|||
T Consensus       107 ~i~~ql~~~l~~lH~~giiHrDiKP~NIL  135 (191)
T d1zara2         107 EVLDMILEEVAKFYHRGIVHGDLSQYNVL  135 (191)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSTTSEE
T ss_pred             HHHHHHHHHHHHHhhCCEEEccCChhhee
Confidence            44578999999999999999999999997

>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Titin, kinase domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.64  E-value=0.0046  Score=53.03  Aligned_cols=29  Identities=14%  Similarity=0.101  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||+|+.|||
T Consensus       106 ~i~~qi~~al~yLH~~~iiHrDlKp~NIl  134 (321)
T d1tkia_         106 SYVHQVCEALQFLHSHNIGHFDIRPENII  134 (321)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHcCCCccccccccee
Confidence            44579999999999999999999999997

>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase SYK
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.63  E-value=0.0045  Score=51.90  Aligned_cols=30  Identities=10%  Similarity=0.158  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|||.|++|||
T Consensus       110 ~~i~~qi~~gl~ylH~~~iiHrDlKp~Nil  139 (277)
T d1xbba_         110 IELVHQVSMGMKYLEESNFVHRDLAARNVL  139 (277)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHhhHHhCCcccCCCcchhhc
Confidence            345579999999999999999999999997

>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: EGF receptor tyrosine kinase, Erbb-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.62  E-value=0.0049  Score=52.30  Aligned_cols=28  Identities=14%  Similarity=0.202  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       116 i~~qi~~gl~yLH~~~iiHrDlKp~NIl  143 (317)
T d1xkka_         116 WCVQIAKGMNYLEDRRLVHRDLAARNVL  143 (317)
T ss_dssp             HHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHcCcccCcchhhcce
Confidence            3469999999999999999999999995

>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Twitchin, kinase domain
species: Caenorhabditis elegans, pjk4 [TaxId: 6239]

Probab=94.61  E-value=0.0045  Score=54.07  Aligned_cols=29  Identities=7%  Similarity=0.040  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||+|+.|||
T Consensus       128 ~i~~qi~~aL~ylH~~~iiHrDiKp~NIl  156 (350)
T d1koaa2         128 EYMRQVCKGLCHMHENNYVHLDLKPENIM  156 (350)
T ss_dssp             HHHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhcCCeeeeechhHee
Confidence            34579999999999999999999999996

>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: MAP kinase activated protein kinase 2, mapkap2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.57  E-value=0.0047  Score=53.42  Aligned_cols=32  Identities=6%  Similarity=0.091  Sum_probs=28.1

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...-..+|+.+|++||++.|+|||+|+.|||
T Consensus       112 ~~~~i~~qi~~al~ylH~~~iiHRDiKp~NIl  143 (335)
T d2ozaa1         112 EASEIMKSIGEAIQYLHSINIAHRDVKPENLL  143 (335)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHHHHcCCccccccccccc
Confidence            33445689999999999999999999999997

>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Activated CDC42 kinase 1, ACK1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.55  E-value=0.0051  Score=51.47  Aligned_cols=29  Identities=10%  Similarity=0.139  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||+|++|||
T Consensus       115 ~~~~qi~~gl~ylH~~~iiHrDikp~NIl  143 (273)
T d1u46a_         115 RYAVQVAEGMGYLESKRFIHRDLAARNLL  143 (273)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhhCCEeeeeecHHHhc
Confidence            44579999999999999999999999997

>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: G-protein coupled receptor kinase 2
species: Cow (Bos taurus) [TaxId: 9913]

Probab=94.49  E-value=0.005  Score=53.94  Aligned_cols=28  Identities=21%  Similarity=0.209  Sum_probs=26.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|++|||
T Consensus       112 ~~~qi~~aL~ylH~~~iiHrDlKP~NIL  139 (364)
T d1omwa3         112 YAAEIILGLEHMHNRFVVYRDLKPANIL  139 (364)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHCCccceeeccceeE
Confidence            3478999999999999999999999997

>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=94.49  E-value=0.0055  Score=52.34  Aligned_cols=30  Identities=3%  Similarity=0.077  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       110 ~~~~~qi~~al~ylH~~~iiHrDiKp~Nil  139 (307)
T d1a06a_         110 SRLIFQVLDAVKYLHDLGIVHRDLKPENLL  139 (307)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhhhceeeeEEeccccee
Confidence            344689999999999999999999999997

>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: 3-phosphoinositide dependent protein kinase-1 Pdk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.46  E-value=0.0054  Score=52.02  Aligned_cols=29  Identities=17%  Similarity=0.192  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|+.|||
T Consensus       112 ~~~~qi~~al~ylH~~~iiHrDiKp~NIl  140 (288)
T d1uu3a_         112 FYTAEIVSALEYLHGKGIIHRDLKPENIL  140 (288)
T ss_dssp             HHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHhhccccEEcCcCCccccc
Confidence            34578999999999999999999999995

>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Focal adhesion kinase 1 (fak)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.43  E-value=0.0061  Score=50.37  Aligned_cols=30  Identities=13%  Similarity=0.164  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|||+|+.||+
T Consensus       111 ~~~~~qi~~gl~ylH~~~iiHrDlKp~NIl  140 (273)
T d1mp8a_         111 ILYAYQLSTALAYLESKRFVHRDIAARNVL  140 (273)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHhhhhcccCeeccccchhhee
Confidence            344579999999999999999999999996

>d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: B-box zinc-binding domain
superfamily: B-box zinc-binding domain
family: B-box zinc-binding domain
domain: Ubiquitin ligase trim63
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.42  E-value=0.011  Score=39.26  Aligned_cols=29  Identities=21%  Similarity=0.273  Sum_probs=25.8

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAA   76 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~   76 (264)
                      .|+.|+..+..+||..|..++|..|...+
T Consensus         3 ~C~~H~~e~l~~yC~~c~~~iC~~C~~~~   31 (51)
T d2d8ua1           3 MCKEHEDEKINIYCLTCEVPTCSMCKVFG   31 (51)
T ss_dssp             CCSSCTTCCCCSEESSSCCCCCSHHHHSS
T ss_pred             CCcccCcCcceEEcCCCCceECccccCcC
Confidence            57889888899999999999999998754

>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell division protein kinase 9, CDK9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.41  E-value=0.0054  Score=51.31  Aligned_cols=28  Identities=11%  Similarity=0.147  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       122 i~~qil~~l~~lH~~~ivHrDlKp~NIL  149 (318)
T d3blha1         122 VMQMLLNGLYYIHRNKILHRDMKAANVL  149 (318)
T ss_dssp             HHHHHHHHHHHHHHTTEECCCCCGGGEE
T ss_pred             HHHHHHHHHHHhccCCEEecCcCchhee
Confidence            3578999999999999999999999996

>d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: B-box zinc-binding domain
superfamily: B-box zinc-binding domain
family: B-box zinc-binding domain
domain: Midline-2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.41  E-value=0.014  Score=40.38  Aligned_cols=47  Identities=17%  Similarity=0.220  Sum_probs=33.1

Q ss_pred             cCCcccccccccccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           36 LVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        36 La~rH~RvpLC~~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      +...+.|...   |+.|+.....+||..|..++|..|...+.-.+|.-.+
T Consensus         4 ~~~~~~r~~~---C~~H~~e~l~~fC~~C~~~iC~~C~~~~~Hk~H~~~~   50 (71)
T d2djaa1           4 VPDTHLRGIT---CLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVAS   50 (71)
T ss_dssp             CCCCCSSCCC---CSSCSSSCCCEEETTTTEEECHHHHHTSTTTTCCBCC
T ss_pred             CCccccCCCc---CcccCCccceeEcCCCCceeccccccCCCCCCCcCcC
Confidence            3444556554   5888877899999999999999998743223454433

>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-src tyrosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.38  E-value=0.0057  Score=51.80  Aligned_cols=37  Identities=19%  Similarity=0.264  Sum_probs=30.8

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH----hhhhcc
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT----GICRLS  258 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~----~ic~l~  258 (264)
                      ...-..+|+.+|++||++.|+|||.|++|||    |.+||+
T Consensus       115 ~~~i~~~i~~gl~~LH~~~ivH~DlKp~NIll~~~~~~kl~  155 (285)
T d1fmka3         115 LVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVA  155 (285)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCSCCSGGGEEECGGGCEEEC
T ss_pred             HHHHHHHHHHHHHHHhhhheecccccceEEEECCCCcEEEc
Confidence            3445678999999999999999999999997    556654

>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-KIT receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.34  E-value=0.0065  Score=51.39  Aligned_cols=29  Identities=21%  Similarity=0.102  Sum_probs=27.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|||.|+.|||
T Consensus       149 ~~~~qi~~gl~~LH~~~ivHrDLKp~NIl  177 (311)
T d1t46a_         149 SFSYQVAKGMAFLASKNCIHRDLAARNIL  177 (311)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeeccccccccc
Confidence            45689999999999999999999999997

>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase ZAP-70
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.31  E-value=0.0058  Score=51.62  Aligned_cols=31  Identities=10%  Similarity=0.112  Sum_probs=27.5

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...-..+|+.+|.+||++.|+|||.|++|||
T Consensus       111 ~~~i~~qi~~gL~ylH~~~iiHrDlKp~Nil  141 (285)
T d1u59a_         111 VAELLHQVSMGMKYLEEKNFVHRDLAARNVL  141 (285)
T ss_dssp             HHHHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHHhCCeecCcCchhhee
Confidence            3445689999999999999999999999996

>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Death-associated protein kinase, Dap
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.29  E-value=0.0062  Score=50.96  Aligned_cols=30  Identities=10%  Similarity=0.040  Sum_probs=27.2

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|++||++.|+|||+|+.|||
T Consensus       116 ~~~~~qi~~al~yLH~~~ivHrDiKp~Nil  145 (293)
T d1jksa_         116 TEFLKQILNGVYYLHSLQIAHFDLKPENIM  145 (293)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECCCCSGGGEE
T ss_pred             HHHHHHHHHHHHhhhhcceeecccccceEE
Confidence            344689999999999999999999999997

>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Fibroblast growth factor receptor 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.28  E-value=0.0068  Score=50.96  Aligned_cols=31  Identities=16%  Similarity=0.115  Sum_probs=27.8

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|||+|+.|||
T Consensus       137 ~~~~~~qi~~al~ylH~~~ivHrDiKp~NiL  167 (299)
T d1fgka_         137 LVSCAYQVARGMEYLASKKCIHRDLAARNVL  167 (299)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHhhhCCEEeeeeccccee
Confidence            3456679999999999999999999999997

>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.21  E-value=0.0072  Score=49.89  Aligned_cols=29  Identities=10%  Similarity=0.053  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.|+.|||
T Consensus       105 ~i~~qia~gl~~lH~~~iiHrDlKp~Nil  133 (263)
T d1sm2a_         105 GMCLDVCEGMAYLEEACVIHRDLAARNCL  133 (263)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCTTCSGGGEE
T ss_pred             HHHHHHHHHHHhhhccceeecccchhhee
Confidence            34589999999999999999999999996

>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]}

class: Small proteins
fold: B-box zinc-binding domain
superfamily: B-box zinc-binding domain
family: B-box zinc-binding domain
domain: Nuclear factor XNF7
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=94.15  E-value=0.018  Score=36.60  Aligned_cols=38  Identities=8%  Similarity=0.010  Sum_probs=28.4

Q ss_pred             cccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           47 HVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        47 ~~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      +.|+.|. ....+||..|..+||..|...+.=.+|.-+|
T Consensus         1 e~C~~H~-e~l~lfC~~d~~~iC~~C~~~~~H~~H~v~p   38 (39)
T d1frea_           1 EKCSEHD-ERLKLYCKDDGTLSCVICRDSLKHASHNFLP   38 (39)
T ss_dssp             CCCCSSC-SSCCCCCCSSSSSSCCTTSSCSSCTTCCCCC
T ss_pred             CCCcccC-cceeEEcccCCcEeeccCcCCCCcCCCcEee
Confidence            3688885 6799999999999999998744223454444

>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Hepatocyte growth factor receptor, c-MET
species: Human (Homo sapiens) [TaxId: 9606]

Probab=94.11  E-value=0.0062  Score=51.97  Aligned_cols=35  Identities=9%  Similarity=0.070  Sum_probs=29.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH----hhhhcc
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT----GICRLS  258 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~----~ic~l~  258 (264)
                      ....+|..+|.+||++.|+|||.|++|||    +.+||+
T Consensus       134 ~i~~qia~gL~~lH~~~iiHrDLK~~NILl~~~~~~kL~  172 (311)
T d1r0pa_         134 GFGLQVAKGMKFLASKKFVHRDLAARNCMLDEKFTVKVA  172 (311)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEEECTTCCEEEC
T ss_pred             HHHHHHHHhhhhhcccCcccCCccHHhEeECCCCCEEEe
Confidence            45678999999999999999999999998    455543

>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine-protein kinase Nek2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.88  E-value=0.0065  Score=50.80  Aligned_cols=29  Identities=10%  Similarity=0.117  Sum_probs=20.4

Q ss_pred             chhHHHHHHhhhhcccc-----ccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQT-----MTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~-----i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.     |+|||+|++|||
T Consensus       113 ~i~~qi~~al~ylH~~~~~~~~IiHrDiKp~NIl  146 (269)
T d2java1         113 RVMTQLTLALKECHRRSDGGHTVLHRDLKPANVF  146 (269)
T ss_dssp             HHHHHHHHHHHHHHHHCC---------CCGGGEE
T ss_pred             HHHHHHHHHHHHHHHhcCCCCCEEeCcCchhhcC
Confidence            34578999999999865     999999999996

>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: gamma-subunit of glycogen phosphorylase kinase (Phk)
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

Probab=93.87  E-value=0.0081  Score=50.50  Aligned_cols=32  Identities=9%  Similarity=0.141  Sum_probs=28.0

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...-..+|+.+|++||++.|+|||.++.|||
T Consensus       111 ~~~~~~~qi~~al~~lH~~~ivHrDlkp~Nil  142 (277)
T d1phka_         111 ETRKIMRALLEVICALHKLNIVHRDLKPENIL  142 (277)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHHHHHHcCCcccccccceEE
Confidence            33445678999999999999999999999996

>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase C, theta type
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.78  E-value=0.0093  Score=51.12  Aligned_cols=29  Identities=17%  Similarity=0.094  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.|+.|||
T Consensus       107 ~~~~qi~~al~ylH~~~iiHrDikp~NiL  135 (320)
T d1xjda_         107 FYAAEIILGLQFLHSKGIVYRDLKLDNIL  135 (320)
T ss_dssp             HHHHHHHHHHHHHHHTTCBCCCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHhCCeeeccCccccee
Confidence            34578999999999999999999999998

>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Musk tyrosine kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=93.55  E-value=0.011  Score=49.48  Aligned_cols=31  Identities=6%  Similarity=0.093  Sum_probs=27.5

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|..+|.+||++.|+|||.|+.|||
T Consensus       142 ~~~i~~qi~~gl~ylH~~~ivHrDlKp~NIL  172 (301)
T d1lufa_         142 QLCIARQVAAGMAYLSERKFVHRDLATRNCL  172 (301)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHhhhcccCCeEeeEEcccceE
Confidence            3445678999999999999999999999997

>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: c-jun N-terminal kinase (jnk3s)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.26  E-value=0.013  Score=50.19  Aligned_cols=29  Identities=7%  Similarity=0.129  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||.|+.|||
T Consensus       123 ~~~~qil~gl~~LH~~giiHrDlKP~Nil  151 (355)
T d2b1pa1         123 YLLYQMLCGIKHLHSAGIIHRDLKPSNIV  151 (355)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCCGGGEE
T ss_pred             HHHHHHHHHHHHhhhcccccccCCccccc
Confidence            34578999999999999999999999997

>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Insulin-like growth factor 1 receptor
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.70  E-value=0.018  Score=48.54  Aligned_cols=28  Identities=14%  Similarity=0.093  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|..+|.+||++.|+|||.|+.|||
T Consensus       138 i~~~ia~gl~~LH~~~ivHrDlk~~NiL  165 (308)
T d1p4oa_         138 MAGEIADGMAYLNANKFVHRDLAARNCM  165 (308)
T ss_dssp             HHHHHHHHHHHHHHTTCBCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhhCCeeeceEcCCcee
Confidence            3468899999999999999999999997

>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tie2 kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.58  E-value=0.017  Score=48.69  Aligned_cols=30  Identities=13%  Similarity=0.144  Sum_probs=27.3

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|++||.+.|+|||.|++|||
T Consensus       130 ~~~~~qia~gl~~lH~~~iiHrDlkp~NIL  159 (309)
T d1fvra_         130 LHFAADVARGMDYLSQKQFIHRDLAARNIL  159 (309)
T ss_dssp             HHHHHHHHHHHHHHHHTTEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhhhcCCccccccccceEE
Confidence            345689999999999999999999999996

>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: B-box zinc-binding domain
superfamily: B-box zinc-binding domain
family: B-box zinc-binding domain
domain: Tripartite motif-containing protein 39
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.54  E-value=0.028  Score=35.73  Aligned_cols=37  Identities=14%  Similarity=0.072  Sum_probs=27.7

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|+.|. ....+||..|..+||..|...+.=.+|.-+|
T Consensus         3 ~C~~H~-e~l~lfC~~d~~~iC~~C~~~~~H~~H~v~p   39 (40)
T d2dida1           3 LCPQHH-EALSLFCYEDQEAVCLICAISHTHRAHTVVP   39 (40)
T ss_dssp             BCTTTC-CBCCEEESSSCSEECHHHHTSSTTTTSCEEE
T ss_pred             cchhhC-ccceEEcccCCcEeeccCcCCCCcCCCcEec
Confidence            578884 7799999999999999998754223454444

>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Bruton's tyrosine kinase (Btk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.45  E-value=0.021  Score=47.32  Aligned_cols=28  Identities=11%  Similarity=0.105  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|||.++.|||
T Consensus       105 i~~qi~~gl~~LH~~~iiH~dlk~~Nil  132 (258)
T d1k2pa_         105 MCKDVCEAMEYLESKQFLHRDLAARNCL  132 (258)
T ss_dssp             HHHHHHHHHHHHHHTTBCCSCCSGGGEE
T ss_pred             HHHHHHHHHHHHhhcCcccccccceeEE
Confidence            4478999999999999999999999997

>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Sky1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=92.06  E-value=0.022  Score=47.76  Aligned_cols=29  Identities=7%  Similarity=0.052  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+ ..|+|||.|++|||
T Consensus       129 ~i~~qil~al~~lh~~~~IvHrDlKp~NIl  158 (362)
T d1q8ya_         129 QISKQLLLGLDYMHRRCGIIHTDIKPENVL  158 (362)
T ss_dssp             HHHHHHHHHHHHHHHTTCEECSCCSGGGEE
T ss_pred             HHHHHHHHHHHHHhhhcCcccccCChhHee
Confidence            345789999999997 77999999999998

>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Ribosomal protein S6 kinase alpha 5, Msk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=91.92  E-value=0.024  Score=48.36  Aligned_cols=28  Identities=14%  Similarity=0.076  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.|+.|||
T Consensus       134 ~~~Qi~~al~~lH~~~ivHrDiKp~Nil  161 (322)
T d1vzoa_         134 YVGEIVLALEHLHKLGIIYRDIKLENIL  161 (322)
T ss_dssp             HHHHHHHHHHHHHHTTCCCCCCCGGGEE
T ss_pred             HHHHHHHHHHHhhcCCEEeccCCcccee
Confidence            3468999999999999999999999996

>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Carboxyl-terminal src kinase (csk)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=91.59  E-value=0.029  Score=46.55  Aligned_cols=29  Identities=14%  Similarity=0.147  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|..+|.+||++.|+|||.++.|||
T Consensus       107 ~i~~~i~~al~ylH~~~ivH~dlkp~Nil  135 (262)
T d1byga_         107 KFSLDVCEAMEYLEGNNFVHRDLAARNVL  135 (262)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCSCCSGGGEE
T ss_pred             HHHHHHHhhccccccCceeccccchHhhe
Confidence            44578999999999999999999999996

>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Type I TGF-beta receptor R4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=87.05  E-value=0.098  Score=43.85  Aligned_cols=30  Identities=13%  Similarity=0.139  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhcc--------ccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQN--------QTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~--------~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+        +.|+|||.|+.|||
T Consensus       103 ~~~~~~ia~gl~~lH~~~~~~~~~~~IvHrDlKp~NIL  140 (303)
T d1vjya_         103 IKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNIL  140 (303)
T ss_dssp             HHHHHHHHHHHHHHHCCBCSTTCBCEEECSCCCGGGEE
T ss_pred             HHHHHHHHHHHHHHHHhhhhhccCCCeeccccCccceE
Confidence            4567889999999996        69999999999996

>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: B-box zinc-binding domain
superfamily: B-box zinc-binding domain
family: B-box zinc-binding domain
domain: Tripartite motif-containing protein 29
species: Human (Homo sapiens) [TaxId: 9606]

Probab=85.40  E-value=0.15  Score=34.24  Aligned_cols=27  Identities=11%  Similarity=0.118  Sum_probs=23.5

Q ss_pred             cccccCCCCceecccCCCCcccCchhhh
Q 024658           47 HVCQSLTPWKASGPKLGPTVSVCDACVA   74 (264)
Q Consensus        47 ~~C~~~p~~ka~~~C~~d~~~LC~~Cd~   74 (264)
                      ..|+.|. ....+||..|...+|..|..
T Consensus        12 ~~C~~H~-e~l~lyC~~c~~~iC~~C~~   38 (59)
T d2csva1          12 RKCPVHG-KTMELFCQTDQTCICYLCMF   38 (59)
T ss_dssp             CBCTTTC-CBCCEEESSSCCEECHHHHH
T ss_pred             CchhhhC-CccceECCCCCceECcccCc
Confidence            3688884 67999999999999999965