Citrus Sinensis ID: 024703

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MADDEFLEDEFDWNNLLTELTDPSTAEIFSNPSPDGSVSPWIGDIESMLMNDNDDNSELEPNQQSLDDFFADVFVDQPSPASGAEVIELPTDKDQNGADESGNASPAEENVLDEPEVNNSDKNYNDTDNDNADDPISKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQKGNAYGASLTKQESAVLLLGMIHELSFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGSFKI
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccEEEcccccccHHHHcccHHHHcccccccc
ccHHHHHHccccHHHHHHHcccccccHHccccccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHccccEEEEEEEEcccHHHHHHccEEEEEcccccccc
maddefledefdwnnllteltdpstaeifsnpspdgsvspwigDIESMLmndnddnselepnqqslddffadvfvdqpspasgaevielptdkdqngadesgnaspaeenvldepevnnsdknyndtdndnaddpiskKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQkgnaygasltKQESAVLLLGMIHelsfphilgswNVELFIIVELnspliqyqcgivfnalnfgsfki
MADDEFLEDEFDWNNLLTELTDPSTAEifsnpspdgsvSPWIGDIESMLMNDNDDNSELEPNQQSLDDFFADVFVDQPSPASGAEVIELPTDKDQNGADESgnaspaeenvldepevnnsdknyndtdndnaddpiskkrrrqlrnrdaavrsrerkkmyvkdlemksrYLESECRKLGRLLHCVLAENQSLRFSLQKGNAYGASLTKQESAVLLLGMIHELSFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGSFKI
MADDEFLEDEFDWNNLLTELTDPSTAEIFSNPSPDGSVSPWIGDIESMLMNDNDDNSELEPNQQSLDDFFADVFVDQPSPASGAEVIELPTDKDQNGADESGNASPAEENVLDEPEVnnsdknyndtdndnaddPISKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQKGNAYGASLTKQESAVLLLGMIHELSFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGSFKI
**********FDWNNLLT**************************************************FFADVF*******************************************************************************************MKSRYLESECRKLGRLLHCVLAENQSLRFSLQKGNAYGASLTKQESAVLLLGMIHELSFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGS***
****EFLEDEFDWNNLL**********************************************************************************************************************************************YVKDLEMKSRYLESECRKLGRLLHCVLAEN*********************************SFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGSFK*
MADDEFLEDEFDWNNLLTELTDPSTAEIFSNPSPDGSVSPWIGDIESMLMNDNDDNSELEPNQQSLDDFFADVFVDQPSPASGAEVIELPTDK****************NVLDEPEVNNSDKNYNDTDNDNADDPISKK***************ERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQKGNAYGASLTKQESAVLLLGMIHELSFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGSFKI
*ADDEFLEDEFDWNNLLTELTD*************GSVSPWIGDIESMLMNDN*********QQSLDDFFADVFVD********************************************************DDPISKK*R***RNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQKGNAYGASLTKQESAVLLLGMIHELSFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGSFKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADDEFLEDEFDWNNLLTELTDPSTAEIFSNPSPDGSVSPWIGDIESMLMNDNDDNSELEPNQQSLDDFFADVFVDQPSPASGAEVIELPTDKDQNGADESGNASPAEENVLDEPEVNNSDKNYNDTDNDNADDPISKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQKGNAYGASLTKQESAVLLLGMIHELSFPHILGSWNVELFIIVELNSPLIQYQCGIVFNALNFGSFKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query264 2.2.26 [Sep-21-2011]
Q9C7S0295 bZIP transcription factor yes no 0.704 0.630 0.475 4e-27
P14233242 TGACG-sequence-specific D N/A no 0.25 0.272 0.432 1e-05
Q554P0 787 Probable basic-leucine zi yes no 0.223 0.074 0.372 4e-05
Q9C5Q2262 ABSCISIC ACID-INSENSITIVE no no 0.189 0.190 0.4 0.0007
>sp|Q9C7S0|BZI60_ARATH bZIP transcription factor 60 OS=Arabidopsis thaliana GN=BZIP60 PE=2 SV=1 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 96/202 (47%), Positives = 133/202 (65%), Gaps = 16/202 (7%)

Query: 20  LTDPSTAEIFSNPSPDGSVSPWIGDIESMLMNDNDDNSE--LEPNQQSLDDFFADVFVDQ 77
           + D   AE F   SPD     WIG+IE+ LMND +   E  +E +QQS+ DF AD+ VD 
Sbjct: 25  VIDSLPAEDFLQSSPDS----WIGEIENQLMNDENHQEESFVELDQQSVSDFIADLLVDY 80

Query: 78  PSPASGAEVIELPTDK-----DQNGADESGNASPAEENVLDEPEVNNSDKNYNDTDNDNA 132
           P+  SG+  ++L  DK         AD+SG  +   + V+++   ++  + ++D D +  
Sbjct: 81  PTSDSGS--VDLAADKVLTVDSPAAADDSGKEN--SDLVVEKKSNDSGSEIHDDDDEEGD 136

Query: 133 DDPISKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSL 192
           DD ++KKRRR++RNRDAAVRSRERKK YV+DLE KS+YLE EC +LGR+L C +AENQSL
Sbjct: 137 DDAVAKKRRRRVRNRDAAVRSRERKKEYVQDLEKKSKYLERECLRLGRMLECFVAENQSL 196

Query: 193 RFSLQKGNAYGAS-LTKQESAV 213
           R+ LQKGN    + ++KQESAV
Sbjct: 197 RYCLQKGNGNNTTMMSKQESAV 218
Transcription factor involved in the endoplasmic reticulum (ER) stress response.
Arabidopsis thaliana (taxid: 3702)
>sp|P14233|TGA1B_TOBAC TGACG-sequence-specific DNA-binding protein TGA-1B (Fragment) OS=Nicotiana tabacum GN=TGA1B PE=2 SV=1 Back     alignment and function description
>sp|Q554P0|BZPJ_DICDI Probable basic-leucine zipper transcription factor J OS=Dictyostelium discoideum GN=bzpJ PE=3 SV=1 Back     alignment and function description
>sp|Q9C5Q2|AI5L3_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 3 OS=Arabidopsis thaliana GN=DPBF4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
255539350306 conserved hypothetical protein [Ricinus 0.75 0.647 0.528 2e-48
224086126306 predicted protein [Populus trichocarpa] 0.75 0.647 0.458 4e-42
359491877322 PREDICTED: bZIP transcription factor 60- 0.799 0.655 0.461 2e-39
449455736277 PREDICTED: bZIP transcription factor 60- 0.696 0.664 0.478 1e-36
60459369286 bZIP transcription factor protein [Capsi 0.640 0.590 0.484 3e-36
156712750299 basic region leucine zipper protein [Nic 0.734 0.648 0.449 3e-35
355320022296 basic-leucine zipper [Humulus lupulus] 0.742 0.662 0.479 3e-35
449485072351 PREDICTED: bZIP transcription factor 60- 0.678 0.509 0.475 2e-34
170773912289 bZIP transcription factor protein [Solan 0.606 0.553 0.478 2e-32
255638864248 unknown [Glycine max] 0.734 0.782 0.377 7e-31
>gi|255539350|ref|XP_002510740.1| conserved hypothetical protein [Ricinus communis] gi|223551441|gb|EEF52927.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/210 (52%), Positives = 149/210 (70%), Gaps = 12/210 (5%)

Query: 10  EFDWNNLLTE-----LTDPSTA-EIFSNPSPDGSVSPWIGDIESMLMNDNDDNSELEPNQ 63
           + DW+NL  +     +T+ S++ E FS+ SPD SVS WI  +E+MLM D+D  +  EP+Q
Sbjct: 18  QIDWDNLFDDNSPLLVTESSSSPENFSDSSPD-SVSLWIDQVENMLMKDDDVLASAEPSQ 76

Query: 64  QSLDDFFADVFVDQPSPASGAEVIELPTDKDQNGADESGNASPAEENVLDEPEVNNSDKN 123
              + F AD+ VD  SPA G+  ++L TDKD   + ++G    +E     E  ++N++  
Sbjct: 77  HFSEGFLADLLVD--SPADGS--VDLSTDKDSIVSPDNGFGGASETEKEGEKILSNNEAK 132

Query: 124 YNDTDNDNADDPISKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLH 183
             D D+++ DDP+SKKRRRQLRNRDAAVRSRERKK+YV+DLE+KSRYLE ECR+LGRLL 
Sbjct: 133 V-DNDSEDPDDPVSKKRRRQLRNRDAAVRSRERKKIYVRDLEIKSRYLEGECRRLGRLLQ 191

Query: 184 CVLAENQSLRFSLQKGNAYGASLTKQESAV 213
           C +AENQ+LR  LQKGNA+G +L KQESAV
Sbjct: 192 CFVAENQALRLGLQKGNAFGVTLAKQESAV 221

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224086126|ref|XP_002307824.1| predicted protein [Populus trichocarpa] gi|222857273|gb|EEE94820.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359491877|ref|XP_003634336.1| PREDICTED: bZIP transcription factor 60-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449455736|ref|XP_004145607.1| PREDICTED: bZIP transcription factor 60-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|60459369|gb|AAX20030.1| bZIP transcription factor protein [Capsicum annuum] Back     alignment and taxonomy information
>gi|156712750|dbj|BAF76429.1| basic region leucine zipper protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|355320022|emb|CBY88800.1| basic-leucine zipper [Humulus lupulus] Back     alignment and taxonomy information
>gi|449485072|ref|XP_004157063.1| PREDICTED: bZIP transcription factor 60-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|170773912|gb|ACB32232.1| bZIP transcription factor protein [Solanum chacoense] Back     alignment and taxonomy information
>gi|255638864|gb|ACU19735.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
TAIR|locus:2009874295 BZIP60 "AT1G42990" [Arabidopsi 0.768 0.688 0.455 5.5e-38
TAIR|locus:1005716533149 HYH "AT3G17609" [Arabidopsis t 0.412 0.731 0.286 2.2e-06
TAIR|locus:2148007168 HY5 "ELONGATED HYPOCOTYL 5" [A 0.253 0.398 0.405 8.5e-05
TAIR|locus:2102564 620 BZIP49 "AT3G56660" [Arabidopsi 0.708 0.301 0.262 0.00016
TAIR|locus:2058510 721 BZIP17 "AT2G40950" [Arabidopsi 0.234 0.085 0.460 0.00044
ZFIN|ZDB-GENE-061103-166 673 atf6b "activating transcriptio 0.310 0.121 0.292 0.00098
TAIR|locus:2009874 BZIP60 "AT1G42990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 407 (148.3 bits), Expect = 5.5e-38, P = 5.5e-38
 Identities = 102/224 (45%), Positives = 138/224 (61%)

Query:     1 MADDEFLEDEFDWNNLLTELTDPSTAEIFSNPSPDGSVSPWIGDIESMLMNDNDDNSE-- 58
             + D++F  D FD + ++  L  P  AE F   SPD     WIG+IE+ LMND +   E  
Sbjct:    11 LGDEDFFFD-FDPSIVIDSL--P--AEDFLQSSPDS----WIGEIENQLMNDENHQEESF 61

Query:    59 LEPNQQSLDDFFADVFVDQPSPASGAEVIELPTDK----DQNGA-DESGNASPAEENVLD 113
             +E +QQS+ DF AD+ VD P+  SG+  ++L  DK    D   A D+SG  +   + V++
Sbjct:    62 VELDQQSVSDFIADLLVDYPTSDSGS--VDLAADKVLTVDSPAAADDSGKEN--SDLVVE 117

Query:   114 EPEVXXXXXXXXXXXXXXXXXPISKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLES 173
             +                     ++KKRRR++RNRDAAVRSRERKK YV+DLE KS+YLE 
Sbjct:   118 KKSNDSGSEIHDDDDEEGDDDAVAKKRRRRVRNRDAAVRSRERKKEYVQDLEKKSKYLER 177

Query:   174 ECRKLGRLLHCVLAENQSLRFSLQKGNAYGASL-TKQESAVLLL 216
             EC +LGR+L C +AENQSLR+ LQKGN    ++ +KQESAVLLL
Sbjct:   178 ECLRLGRMLECFVAENQSLRYCLQKGNGNNTTMMSKQESAVLLL 221
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;IDA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=IEP;RCA;IMP
GO:0010200 "response to chitin" evidence=IEP;RCA
GO:0005789 "endoplasmic reticulum membrane" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0002679 "respiratory burst involved in defense response" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006984 "ER-nucleus signaling pathway" evidence=RCA
GO:0007154 "cell communication" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0010286 "heat acclimation" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:1005716533 HYH "AT3G17609" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148007 HY5 "ELONGATED HYPOCOTYL 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102564 BZIP49 "AT3G56660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058510 BZIP17 "AT2G40950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-166 atf6b "activating transcription factor 6 beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_V1707
hypothetical protein (306 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-09
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 3e-07
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 8e-07
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 3e-04
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 53.3 bits (129), Expect = 1e-09
 Identities = 25/56 (44%), Positives = 38/56 (67%)

Query: 138 KKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLR 193
           K+RRR+ RNR+AA RSRERKK  +++LE K   LE+E  +L + +  +  E + L+
Sbjct: 5   KRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLK 60

Length = 65
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 264
smart0033865 BRLZ basic region leucin zipper. 99.53
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.42
KOG3584348 consensus cAMP response element binding protein an 99.25
KOG0709472 consensus CREB/ATF family transcription factor [Tr 99.23
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.21
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.18
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 98.9
KOG0837279 consensus Transcriptional activator of the JUN fam 98.57
KOG4571294 consensus Activating transcription factor 4 [Trans 98.22
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.08
KOG3119269 consensus Basic region leucine zipper transcriptio 97.95
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.66
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.85
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 96.63
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 96.47
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 91.76
PRK13169110 DNA replication intiation control protein YabA; Re 90.72
PRK10884206 SH3 domain-containing protein; Provisional 89.41
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 88.6
PRK13922276 rod shape-determining protein MreC; Provisional 87.83
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 87.17
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 87.15
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 87.01
PRK0029568 hypothetical protein; Provisional 86.82
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 86.57
PRK0432574 hypothetical protein; Provisional 85.86
PRK13169110 DNA replication intiation control protein YabA; Re 85.64
PF15058200 Speriolin_N: Speriolin N terminus 85.62
PRK0073668 hypothetical protein; Provisional 85.59
PRK0211973 hypothetical protein; Provisional 85.59
PRK0279372 phi X174 lysis protein; Provisional 85.55
PRK0440675 hypothetical protein; Provisional 85.54
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 85.47
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 84.22
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 84.21
TIGR0244965 conserved hypothetical protein TIGR02449. Members 83.94
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 83.9
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 83.54
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 82.09
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 81.82
COG4467114 Regulator of replication initiation timing [Replic 80.78
COG307479 Uncharacterized protein conserved in bacteria [Fun 80.16
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.53  E-value=7.1e-14  Score=102.31  Aligned_cols=63  Identities=41%  Similarity=0.523  Sum_probs=59.7

Q ss_pred             hhHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 024703          135 PISKKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQ  197 (264)
Q Consensus       135 ~eeKR~rRllRNReSAqrSRqRKKeYVeeLE~KVk~LE~EN~~L~~ql~~L~~EN~~LRqqLq  197 (264)
                      ++.|+.+|+++||+||++||+||+.|+.+||.++..|+.+|..|..++..|..|+..|++++.
T Consensus         2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~~   64 (65)
T smart00338        2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSELE   64 (65)
T ss_pred             ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            345888999999999999999999999999999999999999999999999999999999874

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 7e-14
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 4e-11
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 4e-11
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 4e-11
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 3e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 3e-07
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 5e-07
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 7e-07
2wt7_B90 Transcription factor MAFB; transcription, transcri 8e-07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 9e-07
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 9e-06
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
 Score = 63.9 bits (156), Expect = 7e-14
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 138 KKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSL 196
           K+R+   RNR AA RSR+++K++V+ LE K+  L S   +L   +  +  E   L+  L
Sbjct: 1   KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLL 59
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.56
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.55
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.51
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.48
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.31
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.17
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.96
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.94
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.85
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 98.69
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.38
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.27
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 96.48
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 94.04
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 91.56
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 88.78
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 88.72
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 88.33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 87.92
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 87.73
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 87.69
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 87.14
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 86.98
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 86.77
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 86.77
3m48_A33 General control protein GCN4; leucine zipper, synt 85.22
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 84.8
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 84.54
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 84.33
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 84.11
1fmh_A33 General control protein GCN4; coiled coil, leucine 83.54
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 83.46
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 83.37
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 82.63
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 82.11
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 81.52
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 81.21
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 81.12
2hy6_A34 General control protein GCN4; protein design, para 80.98
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 80.93
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 80.49
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.56  E-value=1.6e-14  Score=104.56  Aligned_cols=60  Identities=35%  Similarity=0.395  Sum_probs=58.1

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 024703          138 KKRRRQLRNRDAAVRSRERKKMYVKDLEMKSRYLESECRKLGRLLHCVLAENQSLRFSLQ  197 (264)
Q Consensus       138 KR~rRllRNReSAqrSRqRKKeYVeeLE~KVk~LE~EN~~L~~ql~~L~~EN~~LRqqLq  197 (264)
                      ||++|++|||+||++||+|||+|+.+||.++..|+.+|..|..++..|..|+..|++.|.
T Consensus         1 kR~~r~erNr~AA~k~R~rKk~~~~~Le~~~~~L~~~n~~L~~~i~~L~~e~~~Lk~~ll   60 (61)
T 1t2k_D            1 KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLL   60 (61)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            578999999999999999999999999999999999999999999999999999999884
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 92.59
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 85.07
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=92.59  E-value=0.026  Score=41.12  Aligned_cols=24  Identities=33%  Similarity=0.364  Sum_probs=20.0

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHH
Q 024703          138 KKRRRQLRNRDAAVRSRERKKMYV  161 (264)
Q Consensus       138 KR~rRllRNReSAqrSRqRKKeYV  161 (264)
                      +-.||.=+||.||+.||+||-...
T Consensus        48 rDIRRRGKNKvAAqnCRKRKld~~   71 (74)
T d1sknp_          48 RKIRRRGKNKVAARTCRQRRTDRH   71 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHhcccHHHHHHHHHhhhhhh
Confidence            445788999999999999997644
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure