Citrus Sinensis ID: 024872

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-

MIFAARYSHERLNGPAHFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELNLGKGPEPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQKWPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIPEALLQACTPDTLTHLLM

ccEEHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHcccccHHHHHHcccccEEEcccccccccccccccccccccccccccHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcccccccccHHHHHccccccHHHccccccHHHHHHHHc

ccHHHHHHHHHHccccEEEEEcccEHEEcccHHHHHHHHHHHHHHHHHcccHHHHHHHccccEEEEccccHHcHHHHccccccccccccccccHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccccccHHHHcccHHHHHHHHHcccHHHHHHHHc

mifaarysherlngpahfhyvapsfwawkggEARLKNLAAFVDHILCILPNEEAICRLNGLaatfvghpvvedclelnlgkgpepcelkmegnsedfknkysvpsgatvisllpgsrlqEVARMLPIFAKTVELLKDSFPELITVIHvapnrhveNYITGLiqkwpvpsilvpggssnlkydaFSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKakipyislpnilldspiipeallqactpdtlthllm

******YSHERLNGPAHFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELNLGK*********************VPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQKWPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIPEALLQACTPDTLT****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		261	2.2.26 [Sep-21-2011]
F4IF99		460	Probable lipid-A-disaccha	yes	no	0.969	0.55	0.677	6e-98
B6IST7		401	Lipid-A-disaccharide synt	yes	no	0.839	0.546	0.430	4e-45
Q5FUA3		415	Lipid-A-disaccharide synt	yes	no	0.862	0.542	0.352	5e-38
Q0BS63		393	Lipid-A-disaccharide synt	yes	no	0.869	0.577	0.331	6e-33
Q5QYW1		379	Lipid-A-disaccharide synt	yes	no	0.877	0.604	0.334	3e-32
Q3JR42		388	Lipid-A-disaccharide synt	yes	no	0.865	0.582	0.329	2e-31
A3NWL7		388	Lipid-A-disaccharide synt	yes	no	0.865	0.582	0.329	3e-31
A1V555		388	Lipid-A-disaccharide synt	yes	no	0.865	0.582	0.329	3e-31
Q62JD7		388	Lipid-A-disaccharide synt	yes	no	0.865	0.582	0.329	3e-31
A2SB86		388	Lipid-A-disaccharide synt	yes	no	0.865	0.582	0.329	3e-31

>sp\|F4IF99\|LPXB_ARATH Probable lipid-A-disaccharide synthase, mitochondrial OS=Arabidopsis thaliana GN=LPXB PE=2 SV=1	Back alignment and function desciption

 Score =  357 bits (915), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 174/257 (67%), Positives = 206/257 (80%), Gaps = 4/257 (1%)

Query: 5   ARYSHERL-NGPAHFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAA 63
           ARY  +RL N   HFHYVAPSFWAWKGGE+RL  L+ FVDH+ CILPNEE +CR +G+ A
Sbjct: 146 ARYKQQRLENCSVHFHYVAPSFWAWKGGESRLGGLSEFVDHLFCILPNEERVCREHGVEA 205

Query: 64  TFVGHPVVEDCLELNLGKGPEPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVAR 123
           TFVGHPV+ED  E +L +  +P ELK+EG S    +++S+PS +TVIS+LPGSRLQEV R
Sbjct: 206 TFVGHPVLEDASEFDLVRRCKPQELKLEGLS---FSEHSIPSDSTVISVLPGSRLQEVER 262

Query: 124 MLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQKWPVPSILVPGGSSNLKYDA 183
           MLPIF+K ++LLKD FP+L+T+IHVA N  V++YI     +WPVP+ILVP GS+ LKYDA
Sbjct: 263 MLPIFSKAMKLLKDPFPKLVTLIHVASNNQVDHYIGESFSEWPVPAILVPSGSTQLKYDA 322

Query: 184 FSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPII 243
           F AS+ ALCTSGTVAVELQLA LP +VAYRAHFLTE  IRYKAKIPYISLPNILLDSPII
Sbjct: 323 FGASQAALCTSGTVAVELQLAHLPSLVAYRAHFLTELLIRYKAKIPYISLPNILLDSPII 382

Query: 244 PEALLQACTPDTLTHLL 260
           PEAL QAC P  L  +L
Sbjct: 383 PEALFQACNPSNLASIL 399

Condensation of UDP-2,3-diacylglucosamine and 2,3-diacylglucosamine-1-phosphate to form lipid A disaccharide, a precursor of lipid A, a phosphorylated glycolipid that in bacteria anchors the lipopolysaccharide to the outer membrane of the cell. Lipid A-like molecules in plants may serve as structural components of the outer membranes of mitochondria and/or chloroplasts, or may be involved in signal transduction or plant defense responses.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 8EC: 2

>sp\|B6IST7\|LPXB_RHOCS Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|Q5FUA3\|LPXB_GLUOX Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|Q0BS63\|LPXB_GRABC Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|Q5QYW1\|LPXB_IDILO Lipid-A-disaccharide synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|Q3JR42\|LPXB_BURP1 Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 1710b) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|A3NWL7\|LPXB_BURP0 Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 1106a) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|A1V555\|LPXB_BURMS Lipid-A-disaccharide synthase OS=Burkholderia mallei (strain SAVP1) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|Q62JD7\|LPXB_BURMA Lipid-A-disaccharide synthase OS=Burkholderia mallei (strain ATCC 23344) GN=lpxB PE=3 SV=1	Back alignment and function description

>sp\|A2SB86\|LPXB_BURM9 Lipid-A-disaccharide synthase OS=Burkholderia mallei (strain NCTC 10229) GN=lpxB PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		261
255576125		469	Lipid-A-disaccharide synthase, putative	0.984	0.547	0.762	1e-113
356499725		481	PREDICTED: lipid-A-disaccharide synthase	0.954	0.517	0.726	1e-107
449503752		522	PREDICTED: lipid-A-disaccharide synthase	0.980	0.490	0.695	1e-106
449450962		459	PREDICTED: lipid-A-disaccharide synthase	0.980	0.557	0.699	1e-106
359485531		460	PREDICTED: lipid-A-disaccharide synthase	0.984	0.558	0.727	1e-105
297739234		432	unnamed protein product [Vitis vinifera]	0.984	0.594	0.727	1e-105
334184140		460	transferase [Arabidopsis thaliana] gi\|33	0.969	0.55	0.677	4e-96
297835758		454	hypothetical protein ARALYDRAFT_480096 [	0.950	0.546	0.677	2e-95
242058707		445	hypothetical protein SORBIDRAFT_03g03478	0.954	0.559	0.582	2e-81
226509561		509	uncharacterized protein LOC100272521 [Ze	0.954	0.489	0.570	2e-78

>gi\|255576125\|ref\|XP_002528957.1\| Lipid-A-disaccharide synthase, putative [Ricinus communis] gi\|223531603\|gb\|EEF33431.1\| Lipid-A-disaccharide synthase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/257 (76%), Positives = 215/257 (83%)

Query: 5   ARYSHERLNGPAHFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAAT 64
           ARYS +RLN P HFHYVAPSFWAWKGGE RLKNLA FVDH+ CILPNEEA+CRLNGL AT
Sbjct: 152 ARYSQQRLNSPVHFHYVAPSFWAWKGGEERLKNLANFVDHVFCILPNEEAVCRLNGLTAT 211

Query: 65  FVGHPVVEDCLELNLGKGPEPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARM 124
           FVGHPV+ED LE NLGK     E KME NSEDF++K++VPSGATVISLLPGSRLQEV RM
Sbjct: 212 FVGHPVLEDLLEFNLGKQNSAHEWKMERNSEDFRSKHAVPSGATVISLLPGSRLQEVTRM 271

Query: 125 LPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQKWPVPSILVPGGSSNLKYDAF 184
           L I+A T+E LK S  EL  VIHVAPN HVENYI   ++KWPVPSIL+PG   ++KYDA 
Sbjct: 272 LSIYANTMEQLKSSTHELTAVIHVAPNLHVENYIRDSVRKWPVPSILIPGAIRHMKYDAL 331

Query: 185 SASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIP 244
           SAS +ALCTSGTVA+ELQLARLPCVVAYRAH LTEW IRYKAKIPYISLPNIL+DS IIP
Sbjct: 332 SASSIALCTSGTVALELQLARLPCVVAYRAHLLTEWIIRYKAKIPYISLPNILMDSAIIP 391

Query: 245 EALLQACTPDTLTHLLM 261
           EAL QACTP  L  LL+
Sbjct: 392 EALFQACTPRNLASLLL 408

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356499725\|ref\|XP_003518687.1\| PREDICTED: lipid-A-disaccharide synthase-like [Glycine max]	Back alignment and taxonomy information

>gi\|449503752\|ref\|XP_004162159.1\| PREDICTED: lipid-A-disaccharide synthase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449450962\|ref\|XP_004143231.1\| PREDICTED: lipid-A-disaccharide synthase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|359485531\|ref\|XP_003633287.1\| PREDICTED: lipid-A-disaccharide synthase-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297739234\|emb\|CBI28885.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|334184140\|ref\|NP_178535.3\| transferase [Arabidopsis thaliana] gi\|330250753\|gb\|AEC05847.1\| transferase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297835758\|ref\|XP_002885761.1\| hypothetical protein ARALYDRAFT_480096 [Arabidopsis lyrata subsp. lyrata] gi\|297331601\|gb\|EFH62020.1\| hypothetical protein ARALYDRAFT_480096 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|242058707\|ref\|XP_002458499.1\| hypothetical protein SORBIDRAFT_03g034785 [Sorghum bicolor] gi\|241930474\|gb\|EES03619.1\| hypothetical protein SORBIDRAFT_03g034785 [Sorghum bicolor]	Back alignment and taxonomy information

>gi\|226509561\|ref\|NP_001140462.1\| uncharacterized protein LOC100272521 [Zea mays] gi\|194699616\|gb\|ACF83892.1\| unknown [Zea mays] gi\|414880547\|tpg\|DAA57678.1\| TPA: hypothetical protein ZEAMMB73_897367 [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		261
TIGR_CMR\|SPO_1675		401	SPO_1675 "lipid-A-disaccharide	0.842	0.548	0.327	1e-29
UNIPROTKB\|P10441		382	lpxB [Escherichia coli K-12 (t	0.597	0.408	0.339	1.9e-17
UNIPROTKB\|Q9KPW5		379	lpxB "Lipid-A-disaccharide syn	0.555	0.382	0.313	4.3e-12
TIGR_CMR\|VC_2247		379	VC_2247 "lipid-A-disaccharide	0.555	0.382	0.313	4.3e-12
TIGR_CMR\|SO_1642		385	SO_1642 "lipid A disaccharide	0.639	0.433	0.270	2.1e-11
TIGR_CMR\|CJE_0336		364	CJE_0336 "lipid-A-disaccharide	0.567	0.406	0.275	7e-11
TIGR_CMR\|CBU_0620		376	CBU_0620 "lipid A disaccharide	0.570	0.396	0.254	1.7e-10
TIGR_CMR\|GSU_2261		384	GSU_2261 "lipid A disaccharide	0.471	0.320	0.251	1.8e-09
TIGR_CMR\|CPS_1568		393	CPS_1568 "lipid-A-disaccharide	0.455	0.302	0.296	1.9e-09

TIGR_CMR\|SPO_1675 SPO_1675 "lipid-A-disaccharide synthase" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

 Score = 329 (120.9 bits), Expect = 1.0e-29, P = 1.0e-29
 Identities = 80/244 (32%), Positives = 125/244 (51%)

Query:    19 HYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELN 78
             HYVAPS WAW+ G A    +A  +DH+L +LP E       G+   FVGHPVV +     
Sbjct:   130 HYVAPSVWAWRPGRA--DKMAKVIDHVLALLPFEPPYMERAGMECDFVGHPVVTE----- 182

Query:    79 LGKGPEPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDS 138
                 PE     +       + +  +   A V+  LPGSR  EV R+ P+F   +      
Sbjct:   183 ----PEATGADIAA----LRTELGL-GAAPVLLALPGSRRGEVERLAPVFGAALRRFLPE 233

Query:   139 FPELITVIHVAPNRHVENYITGLIQKWPVPSILV------PGGSSNLKYDAFSASRVALC 192
              P++  V+ V P  HV + +   + +WP   +LV      P  ++  K  AF+A+ +AL 
Sbjct:   234 HPDMRVVVPVVP--HVADQVAQQVAEWPGAPVLVDPRGLAPAQAAMRKRAAFAAADLALA 291

Query:   193 TSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIPEALLQACT 252
              SGTV++EL  A  P V+AY+ ++LT+        I  ++L N++ ++ ++PE L  ACT
Sbjct:   292 ASGTVSLELAAAGTPMVIAYKVNWLTQKIAERMVTIDTVTLVNLVSETRVVPECLGPACT 351

Query:   253 PDTL 256
             P+ +
Sbjct:   352 PENI 355

GO:0008915 "lipid-A-disaccharide synthase activity" evidence=ISS

GO:0009245 "lipid A biosynthetic process" evidence=ISS

UNIPROTKB\|P10441 lpxB [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KPW5 lpxB "Lipid-A-disaccharide synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_2247 VC_2247 "lipid-A-disaccharide synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_1642 SO_1642 "lipid A disaccharide synthase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|CJE_0336 CJE_0336 "lipid-A-disaccharide synthetase" [Campylobacter jejuni RM1221 (taxid:195099)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0620 CBU_0620 "lipid A disaccharide synthase" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_2261 GSU_2261 "lipid A disaccharide synthase (lpxB)" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_1568 CPS_1568 "lipid-A-disaccharide synthase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.4.1	0.691
4th Layer	2.4.1.182	0.737

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00025975001	SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (465 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00006926001	SubName- Full=Chromosome chr10 scaffold_179, whole genome shotgun sequence; (223 aa)	•	•	•	•	•	0.982
	GSVIVG00016586001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (330 aa)	•	•	•		•	0.981
	GSVIVG00030589001	SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (315 aa)	•	•			•	0.963
	GSVIVG00021705001	SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (441 aa)	•	•			•	0.950
	GSVIVG00009555001	SubName- Full=Chromosome chr12 scaffold_238, whole genome shotgun sequence; (211 aa)	•		•		•	0.942
	GSVIVG00002084001	SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (290 aa)	•	•			•	0.921
	GSVIVG00027306001	SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (329 aa)	•	•		•	•	0.902
	GSVIVG00016085001	SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (471 aa)	•				•	0.836
	GSVIVG00011907001	SubName- Full=Chromosome undetermined scaffold_349, whole genome shotgun sequence; (287 aa)	•				•	0.819
	GSVIVG00028572001	SubName- Full=Chromosome chr7 scaffold_44, whole genome shotgun sequence; (340 aa)	•	•			•	0.783

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		261
COG0763		381	COG0763, LpxB, Lipid A disaccharide synthetase [Ce	3e-63
PRK00025		380	PRK00025, lpxB, lipid-A-disaccharide synthase; Rev	2e-62
pfam02684		373	pfam02684, LpxB, Lipid-A-disaccharide synthetase	7e-45
TIGR00215		385	TIGR00215, lpxB, lipid-A-disaccharide synthase	8e-36
PRK01021		608	PRK01021, lpxB, lipid-A-disaccharide synthase; Rev	5e-18
PRK14089		347	PRK14089, PRK14089, ipid-A-disaccharide synthase;	4e-16

>gnl\|CDD\|223834 COG0763, LpxB, Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

 Score =  202 bits (516), Expect = 3e-63
 Identities = 85/246 (34%), Positives = 125/246 (50%), Gaps = 23/246 (9%)

Query: 18  FHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLEL 77
            HYV+PS WAW+    R   +A +VDH+L ILP E A     GL  T+VGHP+ +     
Sbjct: 115 IHYVSPSVWAWR--PKRAVKIAKYVDHLLAILPFEPAFYDKFGLPCTYVGHPLAD----- 167

Query: 78  NLGKGPEPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKD 137
                    E+ +  + E  + K  + +    ++LLPGSR  E+ R+LP F +  + LK 
Sbjct: 168 ---------EIPLLPDREAAREKLGIDADEKTLALLPGSRRSEIRRLLPPFVQAAQELKA 218

Query: 138 SFPELITVIHVAPNRHVENYITGLIQKWPV--PSILVPGGSSNLKYDAFSASRVALCTSG 195
            +P+L  V+ +         I     KW V   S+++       K  AF+A+  AL  SG
Sbjct: 219 RYPDLKFVLPLVN--AKYRRIIEEALKWEVAGLSLILI---DGEKRKAFAAADAALAASG 273

Query: 196 TVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPIIPEALLQACTPDT 255
           T  +E  LA  P VVAY+   +T +  +   K+PY+SLPNIL    I+PE + + CTP+ 
Sbjct: 274 TATLEAALAGTPMVVAYKVKPITYFIAKRLVKLPYVSLPNILAGREIVPELIQEDCTPEN 333

Query: 256 LTHLLM 261
           L   L 
Sbjct: 334 LARALE 339

Length = 381

>gnl\|CDD\|234580 PRK00025, lpxB, lipid-A-disaccharide synthase; Reviewed	Back alignment and domain information

>gnl\|CDD\|217184 pfam02684, LpxB, Lipid-A-disaccharide synthetase	Back alignment and domain information

>gnl\|CDD\|129319 TIGR00215, lpxB, lipid-A-disaccharide synthase	Back alignment and domain information

>gnl\|CDD\|167141 PRK01021, lpxB, lipid-A-disaccharide synthase; Reviewed	Back alignment and domain information

>gnl\|CDD\|237606 PRK14089, PRK14089, ipid-A-disaccharide synthase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		261
PF02684		373	LpxB: Lipid-A-disaccharide synthetase; InterPro: I	100.0
COG0763		381	LpxB Lipid A disaccharide synthetase [Cell envelop	100.0
PRK01021		608	lpxB lipid-A-disaccharide synthase; Reviewed	100.0
PRK14089		347	ipid-A-disaccharide synthase; Provisional	100.0
TIGR00215		385	lpxB lipid-A-disaccharide synthase. Lipid-A precur	100.0
PRK00025		380	lpxB lipid-A-disaccharide synthase; Reviewed	100.0
TIGR03492		396	conserved hypothetical protein. This protein famil	99.96
PRK12446		352	undecaprenyldiphospho-muramoylpentapeptide beta-N-	99.89
COG0707		357	MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami	99.89
PRK13608		391	diacylglycerol glucosyltransferase; Provisional	99.82
PRK13609		380	diacylglycerol glucosyltransferase; Provisional	99.81
PLN02605		382	monogalactosyldiacylglycerol synthase	99.77
cd03786		363	GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th	99.72
TIGR01133		348	murG undecaprenyldiphospho-muramoylpentapeptide be	99.71
TIGR00236		365	wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras	99.69
PRK00726		357	murG undecaprenyldiphospho-muramoylpentapeptide be	99.67
cd03785		350	GT1_MurG MurG is an N-acetylglucosaminyltransferas	99.62
PRK15484		380	lipopolysaccharide 1,2-N-acetylglucosaminetransfer	99.48
TIGR03449		405	mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino	99.44
cd03819		355	GT1_WavL_like This family is most closely related	99.42
TIGR02149		388	glgA_Coryne glycogen synthase, Corynebacterium fam	99.41
TIGR03088		374	stp2 sugar transferase, PEP-CTERM/EpsH1 system ass	99.37
cd03812		358	GT1_CapH_like This family is most closely related	99.37
PRK10307		412	putative glycosyl transferase; Provisional	99.37
PLN02501		794	digalactosyldiacylglycerol synthase	99.36
TIGR02095		473	glgA glycogen/starch synthases, ADP-glucose type.	99.35
cd04962		371	GT1_like_5 This family is most closely related to	99.35
cd05844		367	GT1_like_7 Glycosyltransferases catalyze the trans	99.35
PRK00654		466	glgA glycogen synthase; Provisional	99.33
PRK05749		425	3-deoxy-D-manno-octulosonic-acid transferase; Revi	99.33
PLN02871		465	UDP-sulfoquinovose:DAG sulfoquinovosyltransferase	99.32
cd03807		365	GT1_WbnK_like This family is most closely related	99.31
cd03817		374	GT1_UGDG_like This family is most closely related	99.3
cd03813		475	GT1_like_3 This family is most closely related to	99.3
cd03821		375	GT1_Bme6_like This family is most closely related	99.29
cd03798		377	GT1_wlbH_like This family is most closely related	99.29
PLN02275		371	transferase, transferring glycosyl groups	99.28
cd03792		372	GT1_Trehalose_phosphorylase Trehalose phosphorylas	99.28
PRK14098		489	glycogen synthase; Provisional	99.26
cd03811		353	GT1_WabH_like This family is most closely related	99.25
cd04951		360	GT1_WbdM_like This family is most closely related	99.25
PLN02316		1036	synthase/transferase	99.25
cd03814		364	GT1_like_2 This family is most closely related to	99.24
PRK15427		406	colanic acid biosynthesis glycosyltransferase WcaL	99.23
PF04101		167	Glyco_tran_28_C: Glycosyltransferase family 28 C-t	99.22
PRK14099		485	glycogen synthase; Provisional	99.22
cd03800		398	GT1_Sucrose_synthase This family is most closely r	99.22
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.22
TIGR03590		279	PseG pseudaminic acid biosynthesis-associated prot	99.21
cd03816		415	GT1_ALG1_like This family is most closely related	99.21
TIGR03568		365	NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase,	99.21
cd03822		366	GT1_ecORF704_like This family is most closely rela	99.2
cd03796		398	GT1_PIG-A_like This family is most closely related	99.2
COG0381		383	WecB UDP-N-acetylglucosamine 2-epimerase [Cell env	99.18
COG4370		412	Uncharacterized protein conserved in bacteria [Fun	99.17
cd03801		374	GT1_YqgM_like This family is most closely related	99.17
cd03825		365	GT1_wcfI_like This family is most closely related	99.17
PHA01630		331	putative group 1 glycosyl transferase	99.17
PRK15490		578	Vi polysaccharide biosynthesis protein TviE; Provi	99.16
PF02350		346	Epimerase_2: UDP-N-acetylglucosamine 2-epimerase;	99.15
cd03818		396	GT1_ExpC_like This family is most closely related	99.14
cd03791		476	GT1_Glycogen_synthase_DULL1_like This family is mo	99.14
cd03823		359	GT1_ExpE7_like This family is most closely related	99.13
cd03805		392	GT1_ALG2_like This family is most closely related	99.13
PLN02846		462	digalactosyldiacylglycerol synthase	99.12
cd03820		348	GT1_amsD_like This family is most closely related	99.11
cd03799		355	GT1_amsK_like This is a family of GT1 glycosyltran	99.11
cd03794		394	GT1_wbuB_like This family is most closely related	99.08
cd03808		359	GT1_cap1E_like This family is most closely related	99.06
PLN02939		977	transferase, transferring glycosyl groups	99.05
cd04955		363	GT1_like_6 This family is most closely related to	99.02
PHA01633		335	putative glycosyl transferase group 1	99.01
PRK09922		359	UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D	99.0
TIGR02472		439	sucr_P_syn_N sucrose-phosphate synthase, putative,	99.0
TIGR02918		500	accessory Sec system glycosylation protein GtfA. M	99.0
cd03795		357	GT1_like_4 This family is most closely related to	98.99
TIGR02470		784	sucr_synth sucrose synthase. This model represents	98.98
PLN00142		815	sucrose synthase	98.95
TIGR02468		1050	sucrsPsyn_pln sucrose phosphate synthase/possible	98.95
TIGR03087		397	stp1 sugar transferase, PEP-CTERM/EpsH1 system ass	98.93
PF00534		172	Glycos_transf_1: Glycosyl transferases group 1; In	98.92
cd03809		365	GT1_mtfB_like This family is most closely related	98.9
PF04007		335	DUF354: Protein of unknown function (DUF354); Inte	98.87
cd03806		419	GT1_ALG11_like This family is most closely related	98.86
cd04946		407	GT1_AmsK_like This family is most closely related	98.85
cd04949		372	GT1_gtfA_like This family is most closely related	98.81
PLN02949		463	transferase, transferring glycosyl groups	98.78
cd04950		373	GT1_like_1 Glycosyltransferases catalyze the trans	98.73
cd03804		351	GT1_wbaZ_like This family is most closely related	98.72
cd03802		335	GT1_AviGT4_like This family is most closely relate	98.71
TIGR00661		321	MJ1255 conserved hypothetical protein. This model	98.65
PF13528		318	Glyco_trans_1_3: Glycosyl transferase family 1	98.59
TIGR01426		392	MGT glycosyltransferase, MGT family. This model de	98.58
cd03788		460	GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a	98.57
PRK10125		405	putative glycosyl transferase; Provisional	98.53
COG1817		346	Uncharacterized protein conserved in archaea [Func	98.4
COG4671		400	Predicted glycosyl transferase [General function p	98.4
TIGR02400		456	trehalose_OtsA alpha,alpha-trehalose-phosphate syn	98.39
cd03793		590	GT1_Glycogen_synthase_GSY2_like Glycogen synthase,	98.36
cd01635		229	Glycosyltransferase_GTB_type Glycosyltransferases	98.29
cd03784		401	GT1_Gtf_like This family includes the Gtfs, a grou	98.25
KOG1111		426	consensus N-acetylglucosaminyltransferase complex,	98.24
COG3660		329	Predicted nucleoside-diphosphate-sugar epimerase [	98.21
COG3980		318	spsG Spore coat polysaccharide biosynthesis protei	98.18
PF13844		468	Glyco_transf_41: Glycosyl transferase family 41; P	98.15
PF13692		135	Glyco_trans_1_4: Glycosyl transferases group 1; PD	98.13
COG0297		487	GlgA Glycogen synthase [Carbohydrate transport and	98.11
cd03789		279	GT1_LPS_heptosyltransferase Lipopolysaccharide hep	98.1
COG1519		419	KdtA 3-deoxy-D-manno-octulosonic-acid transferase	98.07
PF04464		369	Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate	97.95
TIGR02398		487	gluc_glyc_Psyn glucosylglycerol-phosphate synthase	97.85
PLN03063		797	alpha,alpha-trehalose-phosphate synthase (UDP-form	97.83
TIGR03609		298	S_layer_CsaB polysaccharide pyruvyl transferase Cs	97.75
TIGR02195		334	heptsyl_trn_II lipopolysaccharide heptosyltransfer	97.54
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	97.53
COG0859		334	RfaF ADP-heptose:LPS heptosyltransferase [Cell env	97.49
PF01075		247	Glyco_transf_9: Glycosyltransferase family 9 (hept	97.44
COG1819		406	Glycosyl transferases, related to UDP-glucuronosyl	97.34
PF06258		311	Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP	97.32
PRK09814		333	beta-1,6-galactofuranosyltransferase; Provisional	97.32
COG0438		381	RfaG Glycosyltransferase [Cell envelope biogenesis	97.32
KOG3349		170	consensus Predicted glycosyltransferase [General f	97.3
PF05159		269	Capsule_synth: Capsule polysaccharide biosynthesis	97.27
PRK10916		348	ADP-heptose:LPS heptosyltransferase II; Provisiona	97.2
COG3914		620	Spy Predicted O-linked N-acetylglucosamine transfe	97.1
TIGR02193		319	heptsyl_trn_I lipopolysaccharide heptosyltransfera	97.03
TIGR02201		344	heptsyl_trn_III lipopolysaccharide heptosyltransfe	96.83
PRK10422		352	lipopolysaccharide core biosynthesis protein; Prov	96.76
PHA03392		507	egt ecdysteroid UDP-glucosyltransferase; Provision	96.74
TIGR02094		601	more_P_ylases alpha-glucan phosphorylases. This fa	96.6
KOG0853		495	consensus Glycosyltransferase [Cell wall/membrane/	96.58
PRK10964		322	ADP-heptose:LPS heptosyl transferase I; Provisiona	96.35
PRK02797		322	4-alpha-L-fucosyltransferase; Provisional	96.34
PF04230		286	PS_pyruv_trans: Polysaccharide pyruvyl transferase	96.2
TIGR02919		438	accessory Sec system glycosyltransferase GtfB. Mem	96.19
PRK10017		426	colanic acid biosynthesis protein; Provisional	96.07
PF07429		360	Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc	95.9
TIGR03713		519	acc_sec_asp1 accessory Sec system protein Asp1. Th	95.78
PLN03064		934	alpha,alpha-trehalose-phosphate synthase (UDP-form	95.2
TIGR00725		159	conserved hypothetical protein, DprA/Smf-related,	94.87
TIGR00730		178	conserved hypothetical protein, DprA/Smf-related,	94.76
COG1887		388	TagB Putative glycosyl/glycerophosphate transferas	94.7
cd04299		778	GT1_Glycogen_Phosphorylase_like This family is mos	94.23
PLN02210		456	UDP-glucosyl transferase	93.66
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	92.64
PF00201		500	UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera	92.62
PF10087		97	DUF2325: Uncharacterized protein conserved in bact	92.09
PLN02448		459	UDP-glycosyltransferase family protein	92.06
PLN03007		482	UDP-glucosyltransferase family protein	92.02
PLN02167		475	UDP-glycosyltransferase family protein	91.95
TIGR00511		301	ribulose_e2b2 ribose-1,5-bisphosphate isomerase, e	91.74
PLN02863		477	UDP-glucoronosyl/UDP-glucosyl transferase family p	91.54
PF01008		282	IF-2B: Initiation factor 2 subunit family; InterPr	90.94
PRK08535		310	translation initiation factor IF-2B subunit delta;	90.57
KOG1467		556	consensus Translation initiation factor 2B, delta	90.46
PRK10117		474	trehalose-6-phosphate synthase; Provisional	89.98
PF05693		633	Glycogen_syn: Glycogen synthase; InterPro: IPR0086	89.91
PRK08335		275	translation initiation factor IF-2B subunit alpha;	89.25
PLN02554		481	UDP-glycosyltransferase family protein	89.1
COG5017		161	Uncharacterized conserved protein [Function unknow	88.68
PLN02152		455	indole-3-acetate beta-glucosyltransferase	87.82
COG1184		301	GCD2 Translation initiation factor 2B subunit, eIF	87.01
PLN00414		446	glycosyltransferase family protein	86.82
PLN00164		480	glucosyltransferase; Provisional	86.52
PLN03004		451	UDP-glycosyltransferase	86.38
PF04413		186	Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid	85.59
PLN02207		468	UDP-glycosyltransferase	85.42
PLN02173		449	UDP-glucosyl transferase family protein	85.3
PLN02534		491	UDP-glycosyltransferase	85.29
PF10093		374	DUF2331: Uncharacterized protein conserved in bact	85.2
PLN02410		451	UDP-glucoronosyl/UDP-glucosyl transferase family p	85.2
PF06925		169	MGDG_synth: Monogalactosyldiacylglycerol (MGDG) sy	85.02
PLN02562		448	UDP-glycosyltransferase	84.61
COG1519		419	KdtA 3-deoxy-D-manno-octulosonic-acid transferase	84.34
TIGR00524		303	eIF-2B_rel eIF-2B alpha/beta/delta-related unchara	83.96
COG2327		385	WcaK Polysaccharide pyruvyl transferase family pro	83.67
cd05565		99	PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en	83.62
PLN02555		480	limonoid glucosyltransferase	82.75
PF10686		71	DUF2493: Protein of unknown function (DUF2493); In	80.5

>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

Probab=100.00  E-value=3.6e-60  Score=431.96  Aligned_cols=235  Identities=35%  Similarity=0.646  Sum_probs=205.5

Q ss_pred             cchhhhcCCCCe-EEEEeCCccccccCCcchHHHHHhchhhheecCcchHHHHHHcCCCeEEEcCCCccchhhhcCCCCC
Q 024872            5 ARYSHERLNGPA-HFHYVAPSFWAWKGGEARLKNLAAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELNLGKGP   83 (261)
Q Consensus         5 ~~~~~~~~~ip~-~~~yv~p~~waw~~g~~r~~~l~~~~d~v~~~~p~e~~~~~~~g~~~~~vG~P~~d~~~~~~~~~~~   83 (261)
                      |+++|++ |+|+ ++|||+||+|||++|  |++++++++|+++|+||||.++|+++|++++|||||+.|.+..       
T Consensus        99 ak~lk~~-~~~~~viyYI~PqvWAWr~~--R~~~i~~~~D~ll~ifPFE~~~y~~~g~~~~~VGHPl~d~~~~-------  168 (373)
T PF02684_consen   99 AKKLKKR-GIPIKVIYYISPQVWAWRPG--RAKKIKKYVDHLLVIFPFEPEFYKKHGVPVTYVGHPLLDEVKP-------  168 (373)
T ss_pred             HHHHHHh-CCCceEEEEECCceeeeCcc--HHHHHHHHHhheeECCcccHHHHhccCCCeEEECCcchhhhcc-------
Confidence            5778888 8882 379999999999987  9999999999999999999999999999999999999997653       


Q ss_pred             CCcccccCCCcHHHHhhcCCCCCCcEEEEEcCCcHHHHHhhHHHHHHHHHHHhhhCCCeEEEEEeCCCcchHHHHHHHHh
Q 024872           84 EPCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQ  163 (261)
Q Consensus        84 ~~~~~~~~~~~~~~r~~l~l~~~~~vIlll~GSR~~ei~~~~~~ll~a~~~l~~~~~~~~~vi~~~~~~~~~~~l~~~~~  163 (261)
                             ..++...++++ +++++++|+++||||.+|+++++|.|+++++++.+++|+++|++++.++. ..+.+++...
T Consensus       169 -------~~~~~~~~~~~-l~~~~~iIaLLPGSR~~EI~rllP~~l~aa~~l~~~~p~l~fvvp~a~~~-~~~~i~~~~~  239 (373)
T PF02684_consen  169 -------EPDRAEAREKL-LDPDKPIIALLPGSRKSEIKRLLPIFLEAAKLLKKQRPDLQFVVPVAPEV-HEELIEEILA  239 (373)
T ss_pred             -------CCCHHHHHHhc-CCCCCcEEEEeCCCCHHHHHHHHHHHHHHHHHHHHhCCCeEEEEecCCHH-HHHHHHHHHH
Confidence                   12356667777 99999999999999999999999999999999999999999999998743 3344555554


Q ss_pred             cCCCCEEEecCCCcchHHHHHHHcceeEEechHHHHHHHHcCCCEEEEEcCChHHHHHHHhcccCCccchhhhhcCCCCc
Q 024872          164 KWPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAVELQLARLPCVVAYRAHFLTEWFIRYKAKIPYISLPNILLDSPII  243 (261)
Q Consensus       164 ~~~~~v~v~~g~~~~~~~~~~~~aDl~i~~SGt~tlEa~~~G~P~Vv~~~~~~~~~~ia~~~~~~~~~~l~Nil~~~~i~  243 (261)
                      ....++.+...  .++.+++|++||++++.|||+|||++++|+|||++|+++++|||++|+++|++|+|||||++|++++
T Consensus       240 ~~~~~~~~~~~--~~~~~~~m~~ad~al~~SGTaTLE~Al~g~P~Vv~Yk~~~lt~~iak~lvk~~~isL~Niia~~~v~  317 (373)
T PF02684_consen  240 EYPPDVSIVII--EGESYDAMAAADAALAASGTATLEAALLGVPMVVAYKVSPLTYFIAKRLVKVKYISLPNIIAGREVV  317 (373)
T ss_pred             hhCCCCeEEEc--CCchHHHHHhCcchhhcCCHHHHHHHHhCCCEEEEEcCcHHHHHHHHHhhcCCEeechhhhcCCCcc
Confidence            44333332211  2378999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCHHHHHHHh
Q 024872          244 PEALLQACTPDTLTHLL  260 (261)
Q Consensus       244 pE~lq~~~~~~~i~~~~  260 (261)
                      |||||++||+++|+.++
T Consensus       318 PEliQ~~~~~~~i~~~~  334 (373)
T PF02684_consen  318 PELIQEDATPENIAAEL  334 (373)
T ss_pred             hhhhcccCCHHHHHHHH
Confidence            99999999999999876

These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (2.4.1.- from EC) and related proteins into distinct sequence based families has been described []. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'. These enzymes belong to the glycosyltransferase family 19 GT19 from CAZY. Lipid-A-disaccharide synthetase 2.4.1.182 from EC is involved with acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase 2.3.1.129 from EC and tetraacyldisaccharide 4'-kinase 2.7.1.130 from EC in the biosynthesis of the phosphorylated glycolipid, lipid A, in the outer membrane of Escherichia coli and other bacteria. These enzymes catalyse the first disaccharide step in the synthesis of lipid-A-disaccharide.; GO: 0008915 lipid-A-disaccharide synthase activity, 0009245 lipid A biosynthetic process

>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed	Back alignment and domain information

>PRK14089 ipid-A-disaccharide synthase; Provisional	Back alignment and domain information

>TIGR00215 lpxB lipid-A-disaccharide synthase	Back alignment and domain information

>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed	Back alignment and domain information

>TIGR03492 conserved hypothetical protein	Back alignment and domain information

>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed	Back alignment and domain information

>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK13608 diacylglycerol glucosyltransferase; Provisional	Back alignment and domain information

>PRK13609 diacylglycerol glucosyltransferase; Provisional	Back alignment and domain information

>PLN02605 monogalactosyldiacylglycerol synthase	Back alignment and domain information

>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc)	Back alignment and domain information

>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	Back alignment and domain information

>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase	Back alignment and domain information

>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional	Back alignment and domain information

>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis	Back alignment and domain information

>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional	Back alignment and domain information

>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase	Back alignment and domain information

>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family	Back alignment and domain information

>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK10307 putative glycosyl transferase; Provisional	Back alignment and domain information

>PLN02501 digalactosyldiacylglycerol synthase	Back alignment and domain information

>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type	Back alignment and domain information

>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>PRK00654 glgA glycogen synthase; Provisional	Back alignment and domain information

>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed	Back alignment and domain information

>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase	Back alignment and domain information

>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PLN02275 transferase, transferring glycosyl groups	Back alignment and domain information

>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose	Back alignment and domain information

>PRK14098 glycogen synthase; Provisional	Back alignment and domain information

>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli	Back alignment and domain information

>PLN02316 synthase/transferase	Back alignment and domain information

>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional	Back alignment and domain information

>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>PRK14099 glycogen synthase; Provisional	Back alignment and domain information

>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG	Back alignment and domain information

>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing	Back alignment and domain information

>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG4370 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known	Back alignment and domain information

>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PHA01630 putative group 1 glycosyl transferase	Back alignment and domain information

>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5	Back alignment and domain information

>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PLN02846 digalactosyldiacylglycerol synthase	Back alignment and domain information

>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria	Back alignment and domain information

>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PHA01633 putative glycosyl transferase group 1	Back alignment and domain information

>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional	Back alignment and domain information

>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain	Back alignment and domain information

>TIGR02918 accessory Sec system glycosylation protein GtfA	Back alignment and domain information

>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR02470 sucr_synth sucrose synthase	Back alignment and domain information

>PLN00142 sucrose synthase	Back alignment and domain information

>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant	Back alignment and domain information

>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated	Back alignment and domain information

>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length	Back alignment and domain information

>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding	Back alignment and domain information

>PLN02949 transferase, transferring glycosyl groups	Back alignment and domain information

>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases	Back alignment and domain information

>TIGR00661 MJ1255 conserved hypothetical protein	Back alignment and domain information

>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1	Back alignment and domain information

>TIGR01426 MGT glycosyltransferase, MGT family	Back alignment and domain information

>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor	Back alignment and domain information

>PRK10125 putative glycosyl transferase; Provisional	Back alignment and domain information

>COG1817 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>COG4671 Predicted glycosyl transferase [General function prediction only]	Back alignment and domain information

>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis	Back alignment and domain information

>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds	Back alignment and domain information

>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin	Back alignment and domain information

>KOG1111 consensus N-acetylglucosaminyltransferase complex, subunit PIG-A/SPT14, required for phosphatidylinositol biosynthesis/Sulfolipid synthase [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Lipid transport and metabolism]	Back alignment and domain information

>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A	Back alignment and domain information

>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A	Back alignment and domain information

>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03789 GT1_LPS_heptosyltransferase Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS)	Back alignment and domain information

>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria	Back alignment and domain information

>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase	Back alignment and domain information

>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB	Back alignment and domain information

>TIGR02195 heptsyl_trn_II lipopolysaccharide heptosyltransferase II	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>COG0859 RfaF ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF01075 Glyco_transf_9: Glycosyltransferase family 9 (heptosyltransferase); InterPro: IPR002201 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases	Back alignment and domain information

>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms]	Back alignment and domain information

>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins	Back alignment and domain information

>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional	Back alignment and domain information

>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG3349 consensus Predicted glycosyltransferase [General function prediction only]	Back alignment and domain information

>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT	Back alignment and domain information

>PRK10916 ADP-heptose:LPS heptosyltransferase II; Provisional	Back alignment and domain information

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I	Back alignment and domain information

>TIGR02201 heptsyl_trn_III lipopolysaccharide heptosyltransferase III, putative	Back alignment and domain information

>PRK10422 lipopolysaccharide core biosynthesis protein; Provisional	Back alignment and domain information

>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional	Back alignment and domain information

>TIGR02094 more_P_ylases alpha-glucan phosphorylases	Back alignment and domain information

>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>PRK10964 ADP-heptose:LPS heptosyl transferase I; Provisional	Back alignment and domain information

>PRK02797 4-alpha-L-fucosyltransferase; Provisional	Back alignment and domain information

>PF04230 PS_pyruv_trans: Polysaccharide pyruvyl transferase; InterPro: IPR007345 Pyruvyl-transferases are involved in peptidoglycan-associated polymer biosynthesis	Back alignment and domain information

>TIGR02919 accessory Sec system glycosyltransferase GtfB	Back alignment and domain information

>PRK10017 colanic acid biosynthesis protein; Provisional	Back alignment and domain information

>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long)	Back alignment and domain information

>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1	Back alignment and domain information

>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>TIGR00725 conserved hypothetical protein, DprA/Smf-related, family 1	Back alignment and domain information

>TIGR00730 conserved hypothetical protein, DprA/Smf-related, family 2	Back alignment and domain information

>COG1887 TagB Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences	Back alignment and domain information

>PLN02210 UDP-glucosyl transferase	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule	Back alignment and domain information

>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PLN02448 UDP-glycosyltransferase family protein	Back alignment and domain information

>PLN03007 UDP-glucosyltransferase family protein	Back alignment and domain information

>PLN02167 UDP-glycosyltransferase family protein	Back alignment and domain information

>TIGR00511 ribulose_e2b2 ribose-1,5-bisphosphate isomerase, e2b2 family	Back alignment and domain information

>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein	Back alignment and domain information

>PF01008 IF-2B: Initiation factor 2 subunit family; InterPro: IPR000649 Initiation factor 2 binds to Met-tRNA, GTP and the small ribosomal subunit	Back alignment and domain information

>PRK08535 translation initiation factor IF-2B subunit delta; Provisional	Back alignment and domain information

>KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK10117 trehalose-6-phosphate synthase; Provisional	Back alignment and domain information

>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3	Back alignment and domain information

>PRK08335 translation initiation factor IF-2B subunit alpha; Validated	Back alignment and domain information

>PLN02554 UDP-glycosyltransferase family protein	Back alignment and domain information

>COG5017 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN02152 indole-3-acetate beta-glucosyltransferase	Back alignment and domain information

>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN00414 glycosyltransferase family protein	Back alignment and domain information

>PLN00164 glucosyltransferase; Provisional	Back alignment and domain information

>PLN03004 UDP-glycosyltransferase	Back alignment and domain information

>PF04413 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); InterPro: IPR007507 This is a domain found in proteins that transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides	Back alignment and domain information

>PLN02207 UDP-glycosyltransferase	Back alignment and domain information

>PLN02173 UDP-glucosyl transferase family protein	Back alignment and domain information

>PLN02534 UDP-glycosyltransferase	Back alignment and domain information

>PF10093 DUF2331: Uncharacterized protein conserved in bacteria (DUF2331); InterPro: IPR016633 This entry describes a conserved hypothetical protein that typically is encoded next to the gene efp for translation elongation factor P	Back alignment and domain information

>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein	Back alignment and domain information

>PF06925 MGDG_synth: Monogalactosyldiacylglycerol (MGDG) synthase; InterPro: IPR009695 This entry represents a conserved region of approximately 180 residues found towirds the N terminus of a number of plant and bacterial diacylglycerol glucosyltransferases, such as monogalactosyldiacylglycerol synthase []	Back alignment and domain information

>PLN02562 UDP-glycosyltransferase	Back alignment and domain information

>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR00524 eIF-2B_rel eIF-2B alpha/beta/delta-related uncharacterized proteins	Back alignment and domain information

>COG2327 WcaK Polysaccharide pyruvyl transferase family protein [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria	Back alignment and domain information

>PLN02555 limonoid glucosyltransferase	Back alignment and domain information

>PF10686 DUF2493: Protein of unknown function (DUF2493); InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		261
3dzc_A		396	UDP-N-acetylglucosamine 2-epimerase; structural ge	99.84
3s2u_A		365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape	99.84
3ot5_A		403	UDP-N-acetylglucosamine 2-epimerase; structural ge	99.83
4hwg_A		385	UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc	99.75
1vgv_A		384	UDP-N-acetylglucosamine 2-epimerase; structural ge	99.74
1v4v_A		376	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t	99.71
3beo_A		375	UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a	99.69
1f0k_A		364	MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe	99.55
3ia7_A		402	CALG4; glycosysltransferase, calicheamicin, enediy	99.55
3fro_A		439	GLGA glycogen synthase; glycosyltransferase family	99.54
3c48_A		438	Predicted glycosyltransferases; retaining glycosyl	99.54
3okp_A		394	GDP-mannose-dependent alpha-(1-6)-phosphatidylino	99.53
3rsc_A		415	CALG2; TDP, enediyne, structural genomics, PSI-2,	99.52
2qzs_A		485	Glycogen synthase; glycosyl-transferase, GT-B fold	99.46
3oy2_A		413	Glycosyltransferase B736L; rossmann fold, GDP-mann	99.46
2jjm_A		394	Glycosyl transferase, group 1 family protein; anth	99.45
1rzu_A		485	Glycogen synthase 1; glycosyl-transferase, GT-B fo	99.43
3otg_A		412	CALG1; calicheamicin, TDP, structural genomics, PS	99.43
2iw1_A		374	Lipopolysaccharide core biosynthesis protein RFAG;	99.37
2x6q_A		416	Trehalose-synthase TRET; biosynthetic protein; 2.2	99.35
3tsa_A		391	SPNG, NDP-rhamnosyltransferase; glycosyltransferas	99.34
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.32
2r60_A		499	Glycosyl transferase, group 1; rossmann-fold; 1.80	99.29
2gek_A		406	Phosphatidylinositol mannosyltransferase (PIMA); G	99.27
2bfw_A		200	GLGA glycogen synthase; glycosyltransferase family	99.22
3vue_A		536	GBSS-I, granule-bound starch synthase 1, chloropla	99.19
2iyf_A		430	OLED, oleandomycin glycosyltransferase; antibiotic	99.18
3s28_A		816	Sucrose synthase 1; glycosyltransferase, sucrose m	99.1
2xci_A		374	KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci	99.09
2jzc_A		224	UDP-N-acetylglucosamine transferase subunit ALG13;	99.03
3hbm_A		282	UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je	98.97
3h4t_A		404	Glycosyltransferase GTFA, glycosyltransferase; van	98.93
2iuy_A		342	Avigt4, glycosyltransferase; antibiotics, family G	98.9
3qhp_A		166	Type 1 capsular polysaccharide biosynthesis prote	98.89
2f9f_A		177	First mannosyl transferase (WBAZ-1); alpha-beta pr	98.87
2hy7_A		406	Glucuronosyltransferase GUMK; glycosyltransferases	98.86
3oti_A		398	CALG3; calicheamicin, TDP, structural genomics, PS	98.84
4fzr_A		398	SSFS6; structural genomics, PSI-biology, protein s	98.81
2x0d_A		413	WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge	98.81
1psw_A		348	ADP-heptose LPS heptosyltransferase II; structural	98.77
2p6p_A		384	Glycosyl transferase; X-RAY-diffraction,urdamycina	98.74
2o6l_A		170	UDP-glucuronosyltransferase 2B7; drug metabolism,	98.7
3tov_A		349	Glycosyl transferase family 9; structural genomics	98.69
2iya_A		424	OLEI, oleandomycin glycosyltransferase; carbohydra	98.65
1uqt_A		482	Alpha, alpha-trehalose-phosphate synthase; glycosy	98.6
2yjn_A		441	ERYCIII, glycosyltransferase; transferase, cytochr	98.54
1rrv_A		416	Glycosyltransferase GTFD; GT-B, glycosyltransferas	98.49
1iir_A		415	Glycosyltransferase GTFB; rossmann fold; 1.80A {Am	98.42
2gt1_A		326	Lipopolysaccharide heptosyltransferase-1; GT-B fol	98.36
2c1x_A		456	UDP-glucose flavonoid 3-O glycosyltransferase; WIN	98.31
3nb0_A		725	Glycogen [starch] synthase isoform 2; glycogen syn	98.24
3t5t_A		496	Putative glycosyltransferase; GTB fold, pseudoglyc	98.2
4amg_A		400	Snogd; transferase, polyketide biosynthesis, GT1 f	98.16
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	97.93
3hbf_A		454	Flavonoid 3-O-glucosyltransferase; glycosyltransfe	97.85
2acv_A		463	Triterpene UDP-glucosyl transferase UGT71G1; glyco	97.81
3q3e_A		631	HMW1C-like glycosyltransferase; N-glycosylation; 2	97.8
3rhz_A		339	GTF3, nucleotide sugar synthetase-like protein; gl	97.8
2pq6_A		482	UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl	97.39
2vch_A		480	Hydroquinone glucosyltransferase; glycosyltransfer	97.17
3l7i_A		729	Teichoic acid biosynthesis protein F; GT-B fold, m	97.08
3sbx_A		189	Putative uncharacterized protein; structural genom	95.36
3qua_A		199	Putative uncharacterized protein; structural genom	95.2
2c4m_A		796	Glycogen phosphorylase; allosteric control, phosph	94.0
1ydh_A		216	AT5G11950; structural genomics, protein structure	93.79
2gj4_A		824	Glycogen phosphorylase, muscle form; transferase;	93.59
1l5w_A		796	Maltodextrin phosphorylase; enzymatic catalysis, s	93.43
2a33_A		215	Hypothetical protein; structural genomics, protein	89.53
3ecs_A		315	Translation initiation factor EIF-2B subunit alpha	88.33
2q5c_A		196	NTRC family transcriptional regulator; structural	86.6
1wek_A		217	Hypothetical protein TT1465; rossman fold, structu	81.78

>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae}	Back alignment and structure

Probab=99.84  E-value=3.6e-21  Score=176.95  Aligned_cols=202  Identities=13%  Similarity=0.054  Sum_probs=136.9

Q ss_pred             cchhhhcCCCCeEEEEeCCc-ccccc-CCcchHHH-H-HhchhhheecCcchHHHHHHcCCC---eEEEcCCCccchhhh
Q 024872            5 ARYSHERLNGPAHFHYVAPS-FWAWK-GGEARLKN-L-AAFVDHILCILPNEEAICRLNGLA---ATFVGHPVVEDCLEL   77 (261)
Q Consensus         5 ~~~~~~~~~ip~~~~yv~p~-~waw~-~g~~r~~~-l-~~~~d~v~~~~p~e~~~~~~~g~~---~~~vG~P~~d~~~~~   77 (261)
                      +..|++ +|||+ +|+.++. .|+|. ++....++ + .+.+|.+++.++...+.|.+.|++   +.+||||+.|.+...
T Consensus       128 ~~aa~~-~~IPv-~h~~ag~rs~~~~~~~~~~~~r~~~~~~a~~~~~~se~~~~~l~~~G~~~~ki~vvGn~~~d~~~~~  205 (396)
T 3dzc_A          128 SLAAYY-QQIPV-GHVEAGLRTGNIYSPWPEEGNRKLTAALTQYHFAPTDTSRANLLQENYNAENIFVTGNTVIDALLAV  205 (396)
T ss_dssp             HHHHHT-TTCCE-EEETCCCCCSCTTSSTTHHHHHHHHHHTCSEEEESSHHHHHHHHHTTCCGGGEEECCCHHHHHHHHH
T ss_pred             HHHHHH-hCCCE-EEEECCccccccccCCcHHHHHHHHHHhcCEEECCCHHHHHHHHHcCCCcCcEEEECCcHHHHHHHh
Confidence            344444 49998 5776542 47763 22224544 3 678999999999988999888986   889999998865421


Q ss_pred             cCCCCCCCcccccCCCcHHHHhhcC-CCCCCcEEEEEcCCcHHHHHhhHHHHHHHHHHHhhhCCCeEEEEEeCCCcchHH
Q 024872           78 NLGKGPEPCELKMEGNSEDFKNKYS-VPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVEN  156 (261)
Q Consensus        78 ~~~~~~~~~~~~~~~~~~~~r~~l~-l~~~~~vIlll~GSR~~ei~~~~~~ll~a~~~l~~~~~~~~~vi~~~~~~~~~~  156 (261)
                      ...      .......++++++++| +++++++++++ |+|..+..+.++.+++|++++.+++|++++++++|++...++
T Consensus       206 ~~~------~~~~~~~~~~~r~~lg~l~~~~~~vlv~-~hR~~~~~~~~~~ll~A~~~l~~~~~~~~~v~~~g~~~~~~~  278 (396)
T 3dzc_A          206 REK------IHTDMDLQATLESQFPMLDASKKLILVT-GHRRESFGGGFERICQALITTAEQHPECQILYPVHLNPNVRE  278 (396)
T ss_dssp             HHH------HHHCHHHHHHHHHTCTTCCTTSEEEEEE-CSCBCCCTTHHHHHHHHHHHHHHHCTTEEEEEECCBCHHHHH
T ss_pred             hhh------cccchhhHHHHHHHhCccCCCCCEEEEE-ECCcccchhHHHHHHHHHHHHHHhCCCceEEEEeCCChHHHH
Confidence            000      0000000256778899 57777877766 555322223356899999999888899999998876544445


Q ss_pred             HHHHHHhcCCCCEEEecCCCcchHHHHHHHcceeEEechHHHHHHHHcCCCEEEEEcCCh
Q 024872          157 YITGLIQKWPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAVELQLARLPCVVAYRAHF  216 (261)
Q Consensus       157 ~l~~~~~~~~~~v~v~~g~~~~~~~~~~~~aDl~i~~SGt~tlEa~~~G~P~Vv~~~~~~  216 (261)
                      .+++.+... .++.+++.....++..+|++||++|+.||++++||+++|+|+|++...+.
T Consensus       279 ~l~~~~~~~-~~v~~~~~lg~~~~~~l~~~ad~vv~~SGg~~~EA~a~G~PvV~~~~~~~  337 (396)
T 3dzc_A          279 PVNKLLKGV-SNIVLIEPQQYLPFVYLMDRAHIILTDSGGIQEEAPSLGKPVLVMRETTE  337 (396)
T ss_dssp             HHHHHTTTC-TTEEEECCCCHHHHHHHHHHCSEEEESCSGGGTTGGGGTCCEEECCSSCS
T ss_pred             HHHHHHcCC-CCEEEeCCCCHHHHHHHHHhcCEEEECCccHHHHHHHcCCCEEEccCCCc
Confidence            555543322 25776643213589999999999999999888899999999998644443

PyMOL of 3dzc

>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes}	Back alignment and structure

>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii}	Back alignment and structure

>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A*	Back alignment and structure

>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3	Back alignment and structure

>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A	Back alignment and structure

>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A*	Back alignment and structure

>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora}	Back alignment and structure

>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A*	Back alignment and structure

>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A*	Back alignment and structure

>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A*	Back alignment and structure

>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A*	Back alignment and structure

>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A	Back alignment and structure

>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A*	Back alignment and structure

>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A*	Back alignment and structure

>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A	Back alignment and structure

>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A*	Back alignment and structure

>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A*	Back alignment and structure

>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A*	Back alignment and structure

>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A*	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A*	Back alignment and structure

>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A*	Back alignment and structure

>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8	Back alignment and structure

>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A*	Back alignment and structure

>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A*	Back alignment and structure

>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A*	Back alignment and structure

>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A	Back alignment and structure

>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A*	Back alignment and structure

>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A*	Back alignment and structure

>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A*	Back alignment and structure

>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori}	Back alignment and structure

>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8	Back alignment and structure

>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A*	Back alignment and structure

>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A*	Back alignment and structure

>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A*	Back alignment and structure

>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A*	Back alignment and structure

>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7	Back alignment and structure

>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae}	Back alignment and structure

>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens}	Back alignment and structure

>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula}	Back alignment and structure

>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus}	Back alignment and structure

>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A*	Back alignment and structure

>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea}	Back alignment and structure

>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5	Back alignment and structure

>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A*	Back alignment and structure

>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A*	Back alignment and structure

>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A*	Back alignment and structure

>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A*	Back alignment and structure

>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A*	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A*	Back alignment and structure

>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A*	Back alignment and structure

>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A	Back alignment and structure

>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A*	Back alignment and structure

>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10	Back alignment and structure

>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A*	Back alignment and structure

>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A*	Back alignment and structure

>3sbx_A Putative uncharacterized protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: AMP; 2.50A {Mycobacterium marinum M}	Back alignment and structure

>3qua_A Putative uncharacterized protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium smegmatis str}	Back alignment and structure

>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae}	Back alignment and structure

>1ydh_A AT5G11950; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG; 2.15A {Arabidopsis thaliana} SCOP: c.129.1.1 PDB: 2q4d_A	Back alignment and structure

>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ...	Back alignment and structure

>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A*	Back alignment and structure

>2a33_A Hypothetical protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT2G37210; 1.95A {Arabidopsis thaliana} SCOP: c.129.1.1 PDB: 2q4o_A	Back alignment and structure

>3ecs_A Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens}	Back alignment and structure

>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824}	Back alignment and structure

>1wek_A Hypothetical protein TT1465; rossman fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.20A {Thermus thermophilus} SCOP: c.129.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		261
d1f0ka_		351	Peptidoglycan biosynthesis glycosyltransferase Mur	99.33
d2iw1a1		370	Lipopolysaccharide core biosynthesis protein RfaG	99.19
d1v4va_		373	UDP-N-acetylglucosamine 2-epimerase {Thermus therm	99.18
d2bfwa1		196	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	99.16
d1o6ca_		377	UDP-N-acetylglucosamine 2-epimerase {Bacillus subt	99.07
d2bisa1		437	Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI	98.97
d1f6da_		376	UDP-N-acetylglucosamine 2-epimerase {Escherichia c	98.9
d1rzua_		477	Glycogen synthase 1, GlgA {Agrobacterium tumefacie	98.88
d2f9fa1		166	First mannosyl transferase WbaZ {Archaeoglobus ful	98.62
d1uqta_		456	Trehalose-6-phosphate synthase, OtsA {Escherichia	97.9
d1pswa_		348	ADP-heptose LPS heptosyltransferase II {Escherichi	97.57
d1iira_		401	UDP-glucosyltransferase GtfB {Amycolatopsis orient	97.39
d1rrva_		401	TDP-vancosaminyltransferase GftD {Amycolatopsis or	97.39
d1pn3a_		391	TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi	97.26
d2pq6a1		473	(Iso)flavonoid glycosyltransferase {Medicago trunc	96.79
d2c1xa1		450	UDP glucose:flavonoid 3-o-glucosyltransferase {Gra	96.55
d1t35a_		179	Hypothetical protein YvdD {Bacillus subtilis [TaxI	95.7
d2acva1		461	Triterpene UDP-glucosyl transferase UGT71G1 {Medic	95.19
d2q4oa1		183	Hypothetical protein At2g37210/T2N18.3 {Thale cres	94.33
d1rcua_		170	Hypothetical protein TM1055 {Thermotoga maritima [	94.28
d1ydhb_		181	Hypothetical protein At5g11950 {Thale cress (Arabi	93.72
d1weka_		208	Hypothetical protein TT1465 (TTHA1644) {Thermus th	91.34
d1vb5a_		274	Putative eIF-2B subunit 2-like protein PH0440 {Pyr	89.91
d2vcha1		471	Hydroquinone glucosyltransferase {Thale cress (Ara	89.19
d1luaa1		191	Methylene-tetrahydromethanopterin dehydrogenase {M	88.47
d1edoa_		244	beta-keto acyl carrier protein reductase {Oil seed	82.87
d1weha_		171	Hypothetical protein TT1887 (TTHA0294) {Thermus th	80.81

>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Peptidoglycan biosynthesis glycosyltransferase MurG
domain: Peptidoglycan biosynthesis glycosyltransferase MurG
species: Escherichia coli [TaxId: 562]

Probab=99.33  E-value=5.7e-12  Score=109.18  Aligned_cols=183  Identities=16%  Similarity=0.138  Sum_probs=107.2

Q ss_pred             chhhhcCCCCeEEEEeCCccccccCCcchHHHH-HhchhhheecCcchHHHHHHcCCCeEEEcCCCccchhhhcCCCCCC
Q 024872            6 RYSHERLNGPAHFHYVAPSFWAWKGGEARLKNL-AAFVDHILCILPNEEAICRLNGLAATFVGHPVVEDCLELNLGKGPE   84 (261)
Q Consensus         6 ~~~~~~~~ip~~~~yv~p~~waw~~g~~r~~~l-~~~~d~v~~~~p~e~~~~~~~g~~~~~vG~P~~d~~~~~~~~~~~~   84 (261)
                      ..++.. ++|++.+.  +..|   ++  ...++ ..+++.+...++..       ......+|+|....+...       
T Consensus       107 ~~a~~~-~ip~~~~~--~~~~---~~--~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~-------  164 (351)
T d1f0ka_         107 LAAWSL-GIPVVLHE--QNGI---AG--LTNKWLAKIATKVMQAFPGA-------FPNAEVVGNPVRTDVLAL-------  164 (351)
T ss_dssp             HHHHHT-TCCEEEEE--CSSS---CC--HHHHHHTTTCSEEEESSTTS-------SSSCEECCCCCCHHHHTS-------
T ss_pred             hhhhhc-ccceeecc--cccc---cc--hhHHHhhhhcceeecccccc-------ccceeEEcCCcccccccc-------
Confidence            344444 99996442  3433   44  55554 44556554443321       234678899988665421       


Q ss_pred             CcccccCCCcHHHHhhcCCCCCCcEEEEEcCCcHHHHHhhHHHHHHHHHHHhhhCCCeEEEEEeCCCcchHHHHHHHHhc
Q 024872           85 PCELKMEGNSEDFKNKYSVPSGATVISLLPGSRLQEVARMLPIFAKTVELLKDSFPELITVIHVAPNRHVENYITGLIQK  164 (261)
Q Consensus        85 ~~~~~~~~~~~~~r~~l~l~~~~~vIlll~GSR~~ei~~~~~~ll~a~~~l~~~~~~~~~vi~~~~~~~~~~~l~~~~~~  164 (261)
                                ...+.+.....+..++++++||.|+..  ....+.+.+..+..   ....++.++. .............
T Consensus       165 ----------~~~~~~~~~~~~~~~i~~~~gs~g~~~--~~~~~~~~~~~l~~---~~~~i~~~~~-~~~~~~~~~~~~~  228 (351)
T d1f0ka_         165 ----------PLPQQRLAGREGPVRVLVVGGSQGARI--LNQTMPQVAAKLGD---SVTIWHQSGK-GSQQSVEQAYAEA  228 (351)
T ss_dssp             ----------CCHHHHHTTCCSSEEEEEECTTTCCHH--HHHHHHHHHHHHGG---GEEEEEECCT-TCHHHHHHHHHHT
T ss_pred             ----------hhHHhhhhcccCCcccccccccchhhh--hHHHHHHhhhhhcc---cceeeeeccc-cchhhhhhhhccc
Confidence                      111233455667788999999998632  12345555666543   2344444443 3322222222333


Q ss_pred             CCCCEEEecCCCcchHHHHHHHcceeEEechHHHH-HHHHcCCCEEEEEcCChHHHH--HHHhcccC
Q 024872          165 WPVPSILVPGGSSNLKYDAFSASRVALCTSGTVAV-ELQLARLPCVVAYRAHFLTEW--FIRYKAKI  228 (261)
Q Consensus       165 ~~~~v~v~~g~~~~~~~~~~~~aDl~i~~SGt~tl-Ea~~~G~P~Vv~~~~~~~~~~--ia~~~~~~  228 (261)
                      ...++.+. +| .+++.++|+.||++||.+|++|+ |++++|+|+|++.-.+.-.++  -|+++.+.
T Consensus       229 ~~~~~~v~-~f-~~~~~~lm~~adl~It~~G~~T~~Eal~~g~P~I~iP~~~~~~~Q~~NA~~l~~~  293 (351)
T d1f0ka_         229 GQPQHKVT-EF-IDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQHKDRQQYWNALPLEKA  293 (351)
T ss_dssp             TCTTSEEE-SC-CSCHHHHHHHCSEEEECCCHHHHHHHHHHTCCEEECCCCCTTCHHHHHHHHHHHT
T ss_pred             ccccceee-ee-hhhHHHHHHhCchhhccccchHHHHHHHhCCceeeeecccCCchHHHHHHHHHHC
Confidence            33355555 44 57899999999999999998888 999999999976422222223  36766644

PyMOL of d1f0ka_

>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}	Back information, alignment and structure

>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]}	Back information, alignment and structure

>d1t35a_ c.129.1.1 (A:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]}	Back information, alignment and structure

>d2q4oa1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1rcua_ c.129.1.1 (A:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ydhb_ c.129.1.1 (B:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1weka_ c.129.1.1 (A:) Hypothetical protein TT1465 (TTHA1644) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vb5a_ c.124.1.5 (A:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1weha_ c.129.1.1 (A:) Hypothetical protein TT1887 (TTHA0294) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure