Citrus Sinensis ID: 024945

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MNFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
ccHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHcccccEEEEEccccccccEEEEEEEEccEEEcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccc
cHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEEEccEEEcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEcccccEEEEEccEEEEEEcccccc
MNFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYalpvyntkqsgeshaptfVSTVEvggevfsgqgakskKQAEMSAAKVAYMRlkepnpsqgpalvspdiqaqadysssslqsnvtaDLHHNIQTagrlvfnpnsmpkVQAEEIRELTTVNtevagydlsqfpqpefssssdlsassgvekgmpssslplectvdprvdpiaqsvradgrtckiirvrpnrpnmkfpegssvlhrdnqwvawtdgsqsn
MNFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVfsgqgakskkqAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAgrlvfnpnSMPKVQAEEIRELTTVNTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMPSSSLPLECTVDPRVDpiaqsvradgrtckiirvrpnrpnmkfpegssvlhrdnqwvawtdgsqsn
MNFLLVViyllsyshilliniFFQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLsqfpqpefssssdlsassGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
**FLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNT**********FVSTV******************************************************************HNIQTAGRLVF***************LTTVNTEVAG*************************************************RADGRTCKIIRV******************DNQWVAW*******
MNFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGE*************EMSAAKVAYM************************************************************************************************************************************IRVRPNRPNMKFPEGSSVLHRDNQWVAWTDG****
MNFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFS**************AKVAYMRLKE********LVSPDIQA**********SNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLSQFP***********************SLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
MNFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEP************************************************************************************************************************DGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDG****
iHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPNSMPKVQAEEIRELTTVNTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPNRPNMKFPEGSSVLHRDNQWVAWTDGSQSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query260 2.2.26 [Sep-21-2011]
Q8H1D4355 Double-stranded RNA-bindi no no 0.842 0.616 0.317 1e-20
B7E321404 Double-stranded RNA-bindi yes no 0.284 0.183 0.493 1e-13
Q9SKN2 434 Double-stranded RNA-bindi no no 0.315 0.188 0.476 2e-13
Q0DKP4 593 Double-stranded RNA-bindi yes no 0.276 0.121 0.465 3e-13
Q9LJF5359 Double-stranded RNA-bindi no no 0.276 0.200 0.479 5e-13
Q9AV50 514 Double-stranded RNA-bindi no no 0.280 0.142 0.479 5e-13
Q8GY79393 Double-stranded RNA-bindi no no 0.276 0.183 0.465 2e-12
Q5N8Z0441 Double-stranded RNA-bindi no no 0.253 0.149 0.5 2e-11
Q0IV63 473 Double-stranded RNA-bindi no no 0.292 0.160 0.428 8e-09
Q0IQN6424 Double-stranded RNA-bindi no no 0.292 0.179 0.428 8e-09
>sp|Q8H1D4|DRB4_ARATH Double-stranded RNA-binding protein 4 OS=Arabidopsis thaliana GN=DBR4 PE=1 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 136/277 (49%), Gaps = 58/277 (20%)

Query: 28  VLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSA 87
           V YKN+LQE+AQKE+  LP Y T  SG SHAPTF STVE  G+VFSG+ AK+KK AEMSA
Sbjct: 81  VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSA 140

Query: 88  AKVAYMRLKEPNPSQ--GPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPN 145
           AKVA+M +K  N +Q   P L S   + Q D +S+   S    ++H   Q + ++V  P+
Sbjct: 141 AKVAFMSIKNGNSNQTGSPTLPS---ERQEDVNSNVKSS--PQEIHS--QPSSKVVMTPD 193

Query: 146 SMP---KVQAEEIRELTTV---NTEVAGYDLSQFPQPEFSSSSDLSASSGVEKGMPSSSL 199
           +     KV  +E  +L      N +     L++   P    +     + G++  + SSSL
Sbjct: 194 TPSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGTLSALTTDGMKMNIASSSL 253

Query: 200 PLE------CTVD-PRVDPIAQSVRA-----------DG---RTCKI------------- 225
           P+        T++ P  + I +++ A           DG    +C +             
Sbjct: 254 PIPHNPTNVITLNAPAANGIKRNIAACSSWMPQNPTNDGSETSSCVVDESEKKKLIMGTG 313

Query: 226 ---------IRVRPNRPNMKFPEGSSVLHRDNQWVAW 253
                    +  RP  P +  P+ + +L RD++++A+
Sbjct: 314 HLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAY 350
Double-stranded RNA-binding protein involved in RNA-mediated post-transcriptional gene silencing (PTGS). Functions in the trans-acting small interfering RNAs (ta-siRNAs) biogenesis by binding and assisting DICER-LIKE 4 (DCL4). Required for DCL4 activity. Required for the 21 nucleotide ta-siRNAs production of the TAS3 transcript in leaves but not in flowers. Plays an important role in silencing RNA of both DNA and RNA viruses. Involved with argonaute 7 (AGO7) and RDR6 in turnip crinkle virus (TCV) silencing. May not be directly involved in viral siRNA production. May stabilize the 21 nucleotide viral siRNAs and deliver them to the RISC complex. Targeted by the viral silencing suppressor (VSR) transactivator/viroplasmin (TAV) protein of the cauliflower mosaic virus (CaMV) that inactivates DRB4 function in RNA silencing. Probably not involved in the guide strand selection from RNA duplexes. Involved in leaf morphology through its function in ta-siRNA-mediated silencing.
Arabidopsis thaliana (taxid: 3702)
>sp|B7E321|DRB5_ORYSJ Double-stranded RNA-binding protein 5 OS=Oryza sativa subsp. japonica GN=DRB5 PE=2 SV=1 Back     alignment and function description
>sp|Q9SKN2|DRB2_ARATH Double-stranded RNA-binding protein 2 OS=Arabidopsis thaliana GN=DRB2 PE=1 SV=1 Back     alignment and function description
>sp|Q0DKP4|DRB2_ORYSJ Double-stranded RNA-binding protein 2 OS=Oryza sativa subsp. japonica GN=DRB2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LJF5|DRB3_ARATH Double-stranded RNA-binding protein 3 OS=Arabidopsis thaliana GN=DRB3 PE=2 SV=1 Back     alignment and function description
>sp|Q9AV50|DRB6_ORYSJ Double-stranded RNA-binding protein 6 OS=Oryza sativa subsp. japonica GN=DRB6 PE=2 SV=1 Back     alignment and function description
>sp|Q8GY79|DRB5_ARATH Double-stranded RNA-binding protein 5 OS=Arabidopsis thaliana GN=DRB5 PE=1 SV=1 Back     alignment and function description
>sp|Q5N8Z0|DRB1_ORYSJ Double-stranded RNA-binding protein 1 OS=Oryza sativa subsp. japonica GN=DRB1 PE=2 SV=1 Back     alignment and function description
>sp|Q0IV63|DRB7_ORYSJ Double-stranded RNA-binding protein 7 OS=Oryza sativa subsp. japonica GN=DRB7 PE=2 SV=1 Back     alignment and function description
>sp|Q0IQN6|DRB8_ORYSJ Double-stranded RNA-binding protein 8 OS=Oryza sativa subsp. japonica GN=DRB8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
224150739330 predicted protein [Populus trichocarpa] 0.815 0.642 0.362 2e-24
224125924240 predicted protein [Populus trichocarpa] 0.3 0.325 0.632 3e-21
296085908 494 unnamed protein product [Vitis vinifera] 0.480 0.253 0.511 4e-21
359481028 495 PREDICTED: uncharacterized protein LOC10 0.469 0.246 0.516 2e-20
255569490280 double-stranded RNA binding protein, put 0.788 0.732 0.315 1e-19
147856819292 hypothetical protein VITISV_028064 [Viti 0.280 0.25 0.648 3e-19
238480134329 double-stranded-RNA-binding protein 4 [A 0.842 0.665 0.338 4e-19
7362760345 putative protein [Arabidopsis thaliana] 0.842 0.634 0.317 7e-19
22331912355 double-stranded-RNA-binding protein 4 [A 0.842 0.616 0.317 7e-19
18389232355 unknown protein [Arabidopsis thaliana] 0.842 0.616 0.317 1e-18
>gi|224150739|ref|XP_002337003.1| predicted protein [Populus trichocarpa] gi|222837556|gb|EEE75921.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 134/262 (51%), Gaps = 50/262 (19%)

Query: 24  QDDSVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQA 83
           ++D   YK++LQELAQ+E   LP Y T +SGE+H PTFVS VE+ GE+F+GQGAK+KKQA
Sbjct: 77  EEDGFGYKSLLQELAQREGCGLPTYWTDKSGEAHVPTFVSKVEIEGEIFTGQGAKTKKQA 136

Query: 84  EMSAAKVAYMRLKEPNPSQGPALVSPDIQAQA----------------------DYSSSS 121
           EMSAAK+AY  L++   SQ P  +S   Q Q                        +S S+
Sbjct: 137 EMSAAKIAYTALQQRYSSQSPGFLSTSSQFQEAPRSSPLSPARQSQEAVQSETPQFSVSN 196

Query: 122 LQSNVTADLHHNIQTAGRLVFNPNSMPKV-----QAEEIRELTTV---NTEVA--GYDLS 171
           L++ +TA L  NIQ            PK+     QAEE R  + V   N  +A  G D S
Sbjct: 197 LRAGLTAYLQQNIQ------------PKLPVSNEQAEEYRANSVVSNHNPSIASPGQD-S 243

Query: 172 QFPQPEFSSSSDLSASSGVEKGMPSSSLPLECTVDPRVDPIAQSVRADGRTCKIIRVRPN 231
                  + S   + SS  +  + SSSLP +    P     + S+    R  +++ + P+
Sbjct: 244 CSAMASITPSPAAAISSSPKHDLTSSSLPSD---SPTNLATSSSIEFMVRGIRVL-MHPS 299

Query: 232 RPNMKFPEGSSVLH-RDNQWVA 252
              M +P GS+VL   D++W A
Sbjct: 300 GTKMTYPAGSTVLPISDDKWAA 321

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125924|ref|XP_002319709.1| predicted protein [Populus trichocarpa] gi|222858085|gb|EEE95632.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296085908|emb|CBI31232.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359481028|ref|XP_002270719.2| PREDICTED: uncharacterized protein LOC100243264 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255569490|ref|XP_002525712.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223535012|gb|EEF36695.1| double-stranded RNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147856819|emb|CAN79168.1| hypothetical protein VITISV_028064 [Vitis vinifera] Back     alignment and taxonomy information
>gi|238480134|ref|NP_001154686.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|197267565|dbj|BAG69145.1| dsRNA-binding protein [Arabidopsis thaliana] gi|332646874|gb|AEE80395.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7362760|emb|CAB83130.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22331912|ref|NP_191839.2| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|42572769|ref|NP_974480.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|75244610|sp|Q8H1D4.1|DRB4_ARATH RecName: Full=Double-stranded RNA-binding protein 4; AltName: Full=dsRNA-binding protein 4; Short=AtDRB4 gi|23297784|gb|AAN13025.1| unknown protein [Arabidopsis thaliana] gi|332646872|gb|AEE80393.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|332646873|gb|AEE80394.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18389232|gb|AAL67059.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
TAIR|locus:2081620355 DRB4 "double-stranded-RNA-bind 0.65 0.476 0.388 1.2e-26
TAIR|locus:2163016393 DRB5 "dsRNA-binding protein 5" 0.280 0.185 0.465 3.8e-14
TAIR|locus:2057491 434 DRB2 "dsRNA-binding protein 2" 0.330 0.198 0.430 3.5e-13
TAIR|locus:2829928359 DRB3 "dsRNA-binding protein 3" 0.280 0.203 0.479 3.6e-13
UNIPROTKB|Q0IQN6424 DRB8 "Double-stranded RNA-bind 0.284 0.174 0.441 5.1e-08
UNIPROTKB|C9JUP4141 ADARB1 "Double-stranded RNA-sp 0.238 0.439 0.437 5e-06
TAIR|locus:2024407419 HYL1 "HYPONASTIC LEAVES 1" [Ar 0.261 0.162 0.405 6.1e-06
UNIPROTKB|F1SG34 565 F1SG34 "Uncharacterized protei 0.35 0.161 0.361 7.3e-06
ZFIN|ZDB-GENE-000627-2 720 adarb1a "adenosine deaminase, 0.346 0.125 0.354 7.9e-06
UNIPROTKB|E2R5U0 701 ADARB1 "Uncharacterized protei 0.411 0.152 0.330 9.9e-06
TAIR|locus:2081620 DRB4 "double-stranded-RNA-binding protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 264 (98.0 bits), Expect = 1.2e-26, Sum P(2) = 1.2e-26
 Identities = 70/180 (38%), Positives = 97/180 (53%)

Query:    28 VLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSA 87
             V YKN+LQE+AQKE+  LP Y T  SG SHAPTF STVE  G+VFSG+ AK+KK AEMSA
Sbjct:    81 VAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSA 140

Query:    88 AKVAYMRLKEPNPSQGPALVSPDIQAQADYSSSSLQSNVTADLHHNIQTAGRLVFNPNSM 147
             AKVA+M +K  N +Q  +   P  + Q D +S+   S    ++H   Q + ++V  P++ 
Sbjct:   141 AKVAFMSIKNGNSNQTGSPTLPS-ERQEDVNSNVKSS--PQEIHS--QPSSKVVMTPDTP 195

Query:   148 PK---VQAEEIRELTTV---NTEVAGYDLXXXXXXXXXXXXXXXXXXGVEKGMPSSSLPL 201
              K   V  +E  +L      N +     L                  G++  + SSSLP+
Sbjct:   196 SKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGTLSALTTDGMKMNIASSSLPI 255
GO:0003723 "RNA binding" evidence=IEA
GO:0003725 "double-stranded RNA binding" evidence=IEA;ISS;IDA
GO:0005622 "intracellular" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA;IMP
GO:0060145 "viral gene silencing in virus induced gene silencing" evidence=IMP
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA;IMP
GO:0070919 "production of siRNA involved in chromatin silencing by small RNA" evidence=IMP
GO:0051607 "defense response to virus" evidence=RCA
TAIR|locus:2163016 DRB5 "dsRNA-binding protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057491 DRB2 "dsRNA-binding protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2829928 DRB3 "dsRNA-binding protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IQN6 DRB8 "Double-stranded RNA-binding protein 8" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|C9JUP4 ADARB1 "Double-stranded RNA-specific editase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2024407 HYL1 "HYPONASTIC LEAVES 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SG34 F1SG34 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000627-2 adarb1a "adenosine deaminase, RNA-specific, B1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5U0 ADARB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
cd0004868 cd00048, DSRM, Double-stranded RNA binding motif 1e-19
TIGR02191220 TIGR02191, RNaseIII, ribonuclease III, bacterial 2e-17
PRK00102229 PRK00102, rnc, ribonuclease III; Reviewed 2e-17
smart0035867 smart00358, DSRM, Double-stranded RNA binding moti 1e-16
pfam0003566 pfam00035, dsrm, Double-stranded RNA binding motif 2e-16
COG0571235 COG0571, Rnc, dsRNA-specific ribonuclease [Transcr 4e-14
PRK12371235 PRK12371, PRK12371, ribonuclease III; Reviewed 2e-05
TIGR04238201 TIGR04238, seadorna_dsRNA, seadornavirus double-st 2e-04
PHA03103183 PHA03103, PHA03103, double-strand RNA-binding prot 2e-04
>gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif Back     alignment and domain information 
 Score = 80.0 bits (198), Expect = 1e-19
 Identities = 30/68 (44%), Positives = 40/68 (58%), Gaps = 3/68 (4%)

Query: 30 YKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGG-EVFSGQGAKSKKQAEMSA 87
           K++LQELAQK    LP Y   ++ G  HAP F   V VGG     G+G  SKK+A+ +A
Sbjct: 2  PKSLLQELAQKRGKPLPEYELVEEEGPDHAPRFTVEVTVGGKITGEGEG-SSKKEAKQNA 60

Query: 88 AKVAYMRL 95
          A+ A  +L
Sbjct: 61 AEAALRKL 68

Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III, RNases H1, and dsRNA dependent adenosine deaminases. Length = 68
>gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial Back     alignment and domain information
>gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed Back     alignment and domain information
>gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information
>gnl|CDD|171444 PRK12371, PRK12371, ribonuclease III; Reviewed Back     alignment and domain information
>gnl|CDD|234517 TIGR04238, seadorna_dsRNA, seadornavirus double-stranded RNA-binding protein Back     alignment and domain information
>gnl|CDD|222987 PHA03103, PHA03103, double-strand RNA-binding protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 260
COG0571235 Rnc dsRNA-specific ribonuclease [Transcription] 99.76
PRK12371235 ribonuclease III; Reviewed 99.76
PRK14718467 ribonuclease III; Provisional 99.72
PHA03103183 double-strand RNA-binding protein; Provisional 99.71
cd0004868 DSRM Double-stranded RNA binding motif. Binding is 99.7
PHA02701183 ORF020 dsRNA-binding PKR inhibitor; Provisional 99.7
PRK12372413 ribonuclease III; Reviewed 99.69
smart0035867 DSRM Double-stranded RNA binding motif. 99.67
PRK00102229 rnc ribonuclease III; Reviewed 99.66
PF0003567 dsrm: Double-stranded RNA binding motif; InterPro: 99.64
TIGR02191220 RNaseIII ribonuclease III, bacterial. This family 99.64
PF1470980 DND1_DSRM: double strand RNA binding domain from D 99.47
KOG3732339 consensus Staufen and related double-stranded-RNA- 99.34
KOG1817533 consensus Ribonuclease [RNA processing and modific 99.14
KOG3732339 consensus Staufen and related double-stranded-RNA- 99.06
KOG2777 542 consensus tRNA-specific adenosine deaminase 1 [RNA 98.43
KOG3769333 consensus Ribonuclease III domain proteins [Transl 98.31
KOG4334650 consensus Uncharacterized conserved protein, conta 98.09
KOG2777 542 consensus tRNA-specific adenosine deaminase 1 [RNA 96.65
PF0336890 Dicer_dimer: Dicer dimerisation domain; InterPro: 96.2
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 95.49
PF14954252 LIX1: Limb expression 1 94.72
KOG2334477 consensus tRNA-dihydrouridine synthase [Translatio 93.71
KOG3792 816 consensus Transcription factor NFAT, subunit NF90 82.88
>COG0571 Rnc dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information 
Probab=99.76  E-value=4.4e-18  Score=153.92  Aligned_cols=98  Identities=31%  Similarity=0.328  Sum_probs=92.3

Q ss_pred             chhhhHHHHHHhhHHhhhccccCCCCCChHHHHHHHHHHcCCCCCcEEE-eeeCCCCCCcEEEEEEECCEEeecccCCCH
Q 024945            2 NFLLVVIYLLSYSHILLINIFFQDDSVLYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSK   80 (260)
Q Consensus         2 ~~~~~~~~vl~~~~~li~~~~~~~~~~n~KS~LQElcQK~~~~lP~Y~v-~~sGP~H~~~Ftv~V~I~g~~~g~G~GsSK   80 (260)
                      ++-.||.+|++|+.+.++++......+|||++||||||++++.+|.|.+ ..+||+|.+.|++.|.++|..++.|.|+||
T Consensus       135 g~~~~~~~i~~l~~~~~~~~~~~~~~~D~Kt~LQe~~q~~~~~~p~Y~~v~~~g~~h~~~F~v~v~v~~~~~g~G~G~sk  214 (235)
T COG0571         135 GLEAARKFILKLFLPRLEEIDAGDQFKDPKTRLQELLQAQGLVLPEYRLVKEEGPAHDKEFTVEVAVGGKELGTGKGRSK  214 (235)
T ss_pred             ChHHHHHHHHHHHHHHHhhccccccccChhHHHHHHHHhcCCCCCeEEEeeccCCCCCceEEEEEEECCeeEEEecccCH
Confidence            4668999999999999999999899999999999999999999999998 567999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhCCC
Q 024945           81 KQAEMSAAKVAYMRLKEPN   99 (260)
Q Consensus        81 KeAEq~AAk~AL~~L~~~~   99 (260)
                      |+|||.||+.||+.+....
T Consensus       215 k~AEq~AA~~al~~l~~~~  233 (235)
T COG0571         215 KEAEQAAAEQALKKLGVKE  233 (235)
T ss_pred             HHHHHHHHHHHHHHhcccc
Confidence            9999999999999998654

>PRK12371 ribonuclease III; Reviewed Back     alignment and domain information
>PRK14718 ribonuclease III; Provisional Back     alignment and domain information
>PHA03103 double-strand RNA-binding protein; Provisional Back     alignment and domain information
>cd00048 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional Back     alignment and domain information
>PRK12372 ribonuclease III; Reviewed Back     alignment and domain information
>smart00358 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PRK00102 rnc ribonuclease III; Reviewed Back     alignment and domain information
>PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] Back     alignment and domain information
>TIGR02191 RNaseIII ribonuclease III, bacterial Back     alignment and domain information
>PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 Back     alignment and domain information
>KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] Back     alignment and domain information
>KOG1817 consensus Ribonuclease [RNA processing and modification] Back     alignment and domain information
>KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] Back     alignment and domain information
>KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] Back     alignment and domain information
>KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] Back     alignment and domain information
>KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] Back     alignment and domain information
>PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF14954 LIX1: Limb expression 1 Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
2l2m_A77 Solution Structure Of The Second Dsrbd Of Hyl1 Leng 4e-08
3adj_A76 Structure Of Arabidopsis Hyl1 And Its Molecular Imp 6e-08
2l3j_A236 The Solution Structure Of The Adar2 Dsrbm-Rna Compl 2e-05
2l3c_A74 Solution Structure Of Adar2 Dsrbm1 Bound To Lsl Rna 9e-05
2b7t_A73 Structure Of Adar2 Dsrbm1 Length = 73 1e-04
2l2n_A103 Backbone 1h, 13c, And 15n Chemical Shift Assignment 4e-04
3adg_A73 Structure Of Arabidopsis Hyl1 And Its Molecular Imp 5e-04
>pdb|2L2M|A Chain A, Solution Structure Of The Second Dsrbd Of Hyl1 Length = 77 Back     alignment and structure 
Iteration: 1

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
Query: 29 LYKNVLQELAQKEAYALPVYNTKQ-SGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSA 87
          L KN+LQE AQK  YA+P+Y  ++         F  TVE+GG  ++G   ++KK AE+SA
Sbjct: 8  LCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAEISA 67
Query: 88 AKVAYMRLK 96
           + A + ++
Sbjct: 68 GRTALLAIQ 76
>pdb|3ADJ|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 76 Back     alignment and structure
>pdb|2L3J|A Chain A, The Solution Structure Of The Adar2 Dsrbm-Rna Complex Reveals A Sequence-Specific Read Out Of The Minor Groove Length = 236 Back     alignment and structure
>pdb|2L3C|A Chain A, Solution Structure Of Adar2 Dsrbm1 Bound To Lsl Rna Length = 74 Back     alignment and structure
>pdb|2B7T|A Chain A, Structure Of Adar2 Dsrbm1 Length = 73 Back     alignment and structure
>pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 Back     alignment and structure
>pdb|3ADG|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 4e-29
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 7e-25
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 4e-24
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 9e-21
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 3e-18
2a11_A242 Ribonuclease III, RNAse III; nuclease domain, stru 1e-19
1x49_A97 Interferon-induced, double-stranded RNA- activated 2e-19
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 4e-19
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 5e-19
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 2e-18
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 2e-18
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 3e-18
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 7e-18
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 8e-18
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 2e-17
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 2e-17
2dix_A84 Interferon-inducible double stranded RNA- dependen 4e-17
1whq_A99 RNA helicase A; double-stranded RNA binding domain 1e-16
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 2e-16
3p1x_A75 Interleukin enhancer-binding factor 3; structural 2e-16
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 4e-16
2b7v_A71 Double-stranded RNA-specific editase 1; RNA editin 2e-15
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 6e-15
2ljh_A114 Double-stranded RNA-specific editase ADAR; DSRBD, 6e-15
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 7e-15
2l33_A91 Interleukin enhancer-binding factor 3; structural 1e-14
3c4b_A265 Endoribonuclease dicer; RNAse, dsRNA binding prote 2e-14
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 4e-14
3rv0_A341 K. polysporus DCR1; RNAse III enzyme, RNA binding 2e-13
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 3e-12
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 2e-06
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 1e-10
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 3e-10
1x48_A88 Interferon-induced, double-stranded RNA- activated 3e-08
2qvw_A756 GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral 3e-06
1t4o_A117 Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro 1e-05
1t4n_A94 Ribonuclease III; DSRBD, RNA-binding, hydrolase; N 8e-05
1uil_A113 Double-stranded RNA-binding motif; structural geno 1e-04
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 Back     alignment and structure
 Score =  104 bits (261), Expect = 4e-29
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 26 DSVLYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAE 84
             L KN+LQE AQK  YA+P+Y   K         F  TVE+GG  ++G   ++KK AE
Sbjct: 2  SHGLCKNLLQEYAQKMNYAIPLYQCQKVETLGRVTQFTCTVEIGGIKYTGAATRTKKDAE 61

Query: 85 MSAAKVAYMRLKEPN 99
          +SA + A + ++   
Sbjct: 62 ISAGRTALLAIQSDT 76
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 Back     alignment and structure
>2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 Back     alignment and structure
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 Back     alignment and structure
>2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 Back     alignment and structure
>3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 Back     alignment and structure
>1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 88 Back     alignment and structure
>2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 Back     alignment and structure
>1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Length = 117 Back     alignment and structure
>1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Length = 94 Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 99.85
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 99.85
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 99.84
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 99.84
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 99.83
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 99.83
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 99.83
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 99.82
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 99.82
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 99.82
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 99.82
2dix_A84 Interferon-inducible double stranded RNA- dependen 99.81
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 99.8
1x49_A97 Interferon-induced, double-stranded RNA- activated 99.8
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 99.79
1whq_A99 RNA helicase A; double-stranded RNA binding domain 99.79
1x48_A88 Interferon-induced, double-stranded RNA- activated 99.78
1t4n_A94 Ribonuclease III; DSRBD, RNA-binding, hydrolase; N 99.77
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 99.77
1uil_A113 Double-stranded RNA-binding motif; structural geno 99.77
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 99.77
2ljh_A114 Double-stranded RNA-specific editase ADAR; DSRBD, 99.76
1t4o_A117 Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro 99.76
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 99.76
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 99.74
2l33_A91 Interleukin enhancer-binding factor 3; structural 99.74
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 99.73
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 99.73
2a11_A242 Ribonuclease III, RNAse III; nuclease domain, stru 99.7
2b7v_A71 Double-stranded RNA-specific editase 1; RNA editin 99.7
3p1x_A75 Interleukin enhancer-binding factor 3; structural 99.63
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 99.56
3rv0_A341 K. polysporus DCR1; RNAse III enzyme, RNA binding 99.49
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 99.47
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 99.46
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 99.39
3c4b_A265 Endoribonuclease dicer; RNAse, dsRNA binding prote 99.2
2kou_A102 Dicer-like protein 4; ATP-binding, endonuclease, h 95.12
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 93.67
2qvw_A756 GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral 90.66
2db2_A119 KIAA0890 protein; DSRM domain, structural genomics 87.77
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 81.32
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Back     alignment and structure
Probab=99.85  E-value=3.3e-21  Score=142.94  Aligned_cols=70  Identities=40%  Similarity=0.475  Sum_probs=66.1

Q ss_pred             CCChHHHHHHHHHHcCCCCCcEEEeeeCCCCCCcEEEEEEECCEEeecccC-CCHHHHHHHHHHHHHHHhh
Q 024945           27 SVLYKNVLQELAQKEAYALPVYNTKQSGESHAPTFVSTVEVGGEVFSGQGA-KSKKQAEMSAAKVAYMRLK   96 (260)
Q Consensus        27 ~~n~KS~LQElcQK~~~~lP~Y~v~~sGP~H~~~Ftv~V~I~g~~~g~G~G-sSKKeAEq~AAk~AL~~L~   96 (260)
                      ..|||+.||||||++++.+|.|++..+||+|.+.|++.|.|+|..++.|.| +|||+|||.||+.||+.|.
T Consensus         2 ~~d~Kt~LqE~~q~~~~~~p~Y~~~~~Gp~h~~~F~~~v~v~g~~~~~G~G~~sKK~Aeq~AA~~al~~L~   72 (73)
T 3adg_A            2 SHVFKSRLQEYAQKYKLPTPVYEIVKEGPSHKSLFQSTVILDGVRYNSLPGFFNRKAAEQSAAEVALRELA   72 (73)
T ss_dssp             CCSHHHHHHHHHHHTTCCCCEEEEEEESSTTSCEEEEEEEETTEEEECCSCBSSHHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHcCCCCCEEEEEeECCCCCCeEEEEEEECCEEEEeeeccCCHHHHHHHHHHHHHHHhh
Confidence            369999999999999999999998556999999999999999999999999 9999999999999999885
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Back     alignment and structure
>1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Back     alignment and structure
>2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Back     alignment and structure
>2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Back     alignment and structure
>2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Back     alignment and structure
>2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 260
d1o0wa269 d.50.1.1 (A:168-236) RNase III, C-terminal domain 2e-17
d2nuga268 d.50.1.1 (A:151-218) RNase III, C-terminal domain 1e-15
d2dmya184 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin 1e-15
d1x48a176 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p 2e-15
d1qu6a190 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p 3e-14
d2b7va171 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R 5e-13
d1whna_128 d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, 7e-13
d1x49a185 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p 2e-12
d1x47a185 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie 2e-12
d1di2a_69 d.50.1.1 (A:) Double-stranded RNA-binding protein 2e-11
d2b7ta173 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R 3e-11
d1qu6a289 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase 5e-10
d1uila_113 d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { 6e-10
d1ekza_76 d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros 2e-09
d1t4oa_81 d.50.1.1 (A:) RNase III, C-terminal domain {Baker' 5e-09
d1whqa_99 d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { 1e-08
d2cpna176 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu 4e-08
d2dixa173 d.50.1.1 (A:7-79) Interferon-inducible double stra 2e-07
d1uhza_89 d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul 5e-06
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: dsRBD-like
superfamily: dsRNA-binding domain-like
family: Double-stranded RNA-binding domain (dsRBD)
domain: RNase III, C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

 Score = 72.2 bits (177), Expect = 2e-17
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 30 YKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAA 88
          YK  LQE+ Q E    P Y   +         FV  V V G+  +    ++KK+AE  AA
Sbjct: 2  YKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAA 61

Query: 89 KVAYMRL 95
          ++AY +L
Sbjct: 62 RIAYEKL 68
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 Back     information, alignment and structure
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 Back     information, alignment and structure
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 Back     information, alignment and structure
>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
d1o0wa269 RNase III, C-terminal domain {Thermotoga maritima 99.85
d1qu6a190 dsRNA-dependent protein kinase pkr {Human (Homo sa 99.82
d2dixa173 Interferon-inducible double stranded RNA-dependent 99.82
d2nuga268 RNase III, C-terminal domain {Aquifex aeolicus [Ta 99.81
d1x49a185 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 99.81
d2cpna176 TAR RNA-binding protein 2 {Human (Homo sapiens) [T 99.81
d1di2a_69 Double-stranded RNA-binding protein A, second dsRB 99.8
d1x48a176 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 99.8
d1whqa_99 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 99.79
d1uhza_89 staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 99.79
d1qu6a289 dsRNA-dependent protein kinase pkr {Human (Homo sa 99.78
d1x47a185 Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1ekza_76 Staufen, domain III {Fruit fly (Drosophila melanog 99.76
d1uila_113 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 99.73
d1whna_128 tRNA-dihydrouridine synthase 2-like, Dus2l (231001 99.72
d2b7va171 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 99.66
d1t4oa_81 RNase III, C-terminal domain {Baker's yeast (Sacch 99.64
d2dmya184 Spermatid perinuclear RNA-binding protein {Human ( 99.58
d2b7ta173 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 99.52
d1x47a185 Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} 87.69
d1whqa_99 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 81.05
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: dsRBD-like
superfamily: dsRNA-binding domain-like
family: Double-stranded RNA-binding domain (dsRBD)
domain: RNase III, C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=99.85  E-value=7.5e-22  Score=142.80  Aligned_cols=67  Identities=34%  Similarity=0.489  Sum_probs=64.6

Q ss_pred             ChHHHHHHHHHHcCCCCCcEEE-eeeCCCCCCcEEEEEEECCEEeecccCCCHHHHHHHHHHHHHHHh
Q 024945           29 LYKNVLQELAQKEAYALPVYNT-KQSGESHAPTFVSTVEVGGEVFSGQGAKSKKQAEMSAAKVAYMRL   95 (260)
Q Consensus        29 n~KS~LQElcQK~~~~lP~Y~v-~~sGP~H~~~Ftv~V~I~g~~~g~G~GsSKKeAEq~AAk~AL~~L   95 (260)
                      |||++||||||++++.+|.|++ ..+||+|.+.|++.|.|+|..++.|.|+|||+|||.||+.||+.|
T Consensus         1 d~Ks~LqE~~Qk~~~~~P~Y~~~~~~g~~h~~~F~~~v~v~~~~~~~g~g~sKK~Aeq~AA~~aL~~L   68 (69)
T d1o0wa2           1 DYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKTIATGKGRTKKEAEKEAARIAYEKL   68 (69)
T ss_dssp             CHHHHHHHHHHHHHSSCCEEEEEEEECCTTSCEEEEEEEETTEEEEEEEESSHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHHHHHHcCCCCCEEEEEEeeCCCCCceEEEEEEECCEEEEEEEeCCHHHHHHHHHHHHHHHh
Confidence            7999999999999999999998 678999999999999999999999999999999999999999987
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure