Citrus Sinensis ID: 024990

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MNKKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLTEILSCL
cccccccccccHHHHHHHHcccccEEEccEEEEEEEEEcccccEEEEcccccccccccEEEEcccccccHHHHHHccccccccccccHHHHHHHcccccccEEEEEEEccccccccccccEEEcccccEEEEEEccccccccccccEEEEEEcHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccEEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHccc
ccccEEcccccHHHHHHHHccccEEEEEEEEEEEEEEEcccccEEEEcccccccccccEEEEEccccccccHHHHcccccccHHcccHHHHHHHHcccccHHHHHEHHcccccccccccccEEcccccHHEEEEccccccccccccEEEEEccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccEEccccccEEEccHcccccHHHHHHHHHHHHHHHHHHHccc
mnkkyvgvpgmnSICKAlchqpgveskfgvgvgrfewledknlwsvsgldgqslgqfngvvasdknvvsprfrdvtgrpppldltfapdlavkleeipvnpcFALMLAfseplssipvkgfsfqdsevlswahcdsskpgrsanserWVLHSTADYARTVIaqtglqkpseATLKKVAEEMFQEFqgtglsiplpifrkahrwgsafpaasiaKEERCLWDVKRRLAICgdfcvspnvegAILSGLDAASKLTEILSCL
mnkkyvgvpGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGvvasdknvvsprfrdvtgrpppldLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHCdsskpgrsanseRWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLTEILSCL
MNKKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLTEILSCL
****YVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHC************RWVLHSTADYARTVIAQTGL*******LKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLT******
*NKKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLTEILSCL
MNKKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWA************SERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLTEILSCL
*NKKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLTEILSCL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAILSGLDAASKLTEILSCL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
224115286 372 predicted protein [Populus trichocarpa] 0.992 0.690 0.767 1e-115
147778135 369 hypothetical protein VITISV_000801 [Viti 1.0 0.701 0.749 1e-114
225462207 369 PREDICTED: uncharacterized protein LOC10 1.0 0.701 0.745 1e-113
449460040 369 PREDICTED: uncharacterized protein LOC10 1.0 0.701 0.729 1e-109
449502153 369 PREDICTED: uncharacterized protein LOC10 1.0 0.701 0.725 1e-108
356525815 369 PREDICTED: uncharacterized protein LOC10 0.996 0.699 0.693 1e-105
22330276 384 FAD/NAD(P)-binding oxidoreductase domain 0.992 0.669 0.704 1e-104
297847978 384 hypothetical protein ARALYDRAFT_474667 [ 0.992 0.669 0.704 1e-104
6056384 396 Hypothetical protein [Arabidopsis thalia 0.992 0.648 0.704 1e-104
297847968 400 predicted protein [Arabidopsis lyrata su 0.992 0.642 0.696 1e-101
>gi|224115286|ref|XP_002332207.1| predicted protein [Populus trichocarpa] gi|222875314|gb|EEF12445.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/262 (76%), Positives = 233/262 (88%), Gaps = 5/262 (1%)

Query: 2   NKKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVV 61
           NKKYVG+PGMNSICKALC++ GVESKFGV +GR E L+D+  WS++GLDGQ+LG+F+GVV
Sbjct: 112 NKKYVGIPGMNSICKALCNETGVESKFGVSIGRLECLDDEK-WSLTGLDGQNLGRFSGVV 170

Query: 62  ASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGF 121
            SDK + SPRF DVTGRPPPLDL+  P+LA+KL++IPV+PCFALMLAFSEPLSSI VKGF
Sbjct: 171 VSDKGIASPRFTDVTGRPPPLDLSLTPELALKLQDIPVSPCFALMLAFSEPLSSISVKGF 230

Query: 122 SFQDSEVLSWAHCDSSKPGRS----ANSERWVLHSTADYARTVIAQTGLQKPSEATLKKV 177
           SF++SE+LSW+HCDSSKPGRS    A+ ERWVLHSTA+YAR +IAQTGLQKPS ATL KV
Sbjct: 231 SFKNSEILSWSHCDSSKPGRSTARHASVERWVLHSTANYARGIIAQTGLQKPSSATLTKV 290

Query: 178 AEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPN 237
           AEE+FQEFQ  GL+IP P F KAHRWGSAFP ASIA+E++CLWD K+RLAICGDFCVSPN
Sbjct: 291 AEELFQEFQSIGLNIPRPFFMKAHRWGSAFPTASIAREQKCLWDRKKRLAICGDFCVSPN 350

Query: 238 VEGAILSGLDAASKLTEILSCL 259
           VEGAILSGL AASKLTE+LSCL
Sbjct: 351 VEGAILSGLAAASKLTEMLSCL 372

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147778135|emb|CAN76485.1| hypothetical protein VITISV_000801 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462207|ref|XP_002270560.1| PREDICTED: uncharacterized protein LOC100264528 [Vitis vinifera] gi|296082792|emb|CBI21797.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449460040|ref|XP_004147754.1| PREDICTED: uncharacterized protein LOC101216187 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449502153|ref|XP_004161558.1| PREDICTED: uncharacterized protein LOC101224633 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356525815|ref|XP_003531517.1| PREDICTED: uncharacterized protein LOC100816696 [Glycine max] Back     alignment and taxonomy information
>gi|22330276|ref|NP_175996.2| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|17978976|gb|AAL47449.1| T6H22.19/T6H22.19 [Arabidopsis thaliana] gi|22655396|gb|AAM98290.1| At1g55980/T6H22.19 [Arabidopsis thaliana] gi|222423033|dbj|BAH19499.1| AT1G56000 [Arabidopsis thaliana] gi|332195208|gb|AEE33329.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847978|ref|XP_002891870.1| hypothetical protein ARALYDRAFT_474667 [Arabidopsis lyrata subsp. lyrata] gi|297337712|gb|EFH68129.1| hypothetical protein ARALYDRAFT_474667 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|6056384|gb|AAF02848.1|AC009894_19 Hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297847968|ref|XP_002891865.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297337707|gb|EFH68124.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query259
TAIR|locus:2012030384 AT1G56000 [Arabidopsis thalian 0.992 0.669 0.704 5.8e-98
TAIR|locus:2012005466 AT1G55980 [Arabidopsis thalian 0.776 0.431 0.671 1.7e-73
UNIPROTKB|Q48MT7328 PSPPH_1014 "Uncharacterized pr 0.617 0.487 0.373 4.9e-21
UNIPROTKB|Q4K6B1328 PFL_5143 "FAD dependent oxidor 0.617 0.487 0.408 1e-20
TAIR|locus:2084903486 AT3G04650 [Arabidopsis thalian 0.899 0.479 0.281 5.8e-18
TAIR|locus:2012030 AT1G56000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 973 (347.6 bits), Expect = 5.8e-98, P = 5.8e-98
 Identities = 181/257 (70%), Positives = 213/257 (82%)

Query:     3 KKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVA 62
             KKYVGVPGMNSI KALC++ GV+S FG G+ + EWLE++  W ++   G++LG+F+GVVA
Sbjct:   128 KKYVGVPGMNSISKALCNESGVKSMFGTGIAKMEWLEEEIPWLLTDSKGENLGRFDGVVA 187

Query:    63 SDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFS 122
             SDKN+VSPRF  VTG PPPLDL+  P+LA KL+ IPV PCF+LMLAF EPLSSIPVKG S
Sbjct:   188 SDKNIVSPRFTQVTGLPPPLDLSLVPELATKLQNIPVLPCFSLMLAFKEPLSSIPVKGLS 247

Query:   123 FQDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMF 182
             F++SE+LSWAHC+S+KPGRS +SERW+LHST DYA +VIA+TGLQK S  TL K++EEMF
Sbjct:   248 FKNSEILSWAHCESTKPGRSTDSERWILHSTPDYANSVIAKTGLQKLSSETLNKISEEMF 307

Query:   183 QEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAI 242
             +EFQ +GL   LP F KAHRWGSAFPA SIA EERCLWD  R LAICGDFCVSPNVEGAI
Sbjct:   308 KEFQCSGLVSSLPFFMKAHRWGSAFPAKSIAVEERCLWDRNRNLAICGDFCVSPNVEGAI 367

Query:   243 LSGLDAASKLTEILSCL 259
             LSGL AASKL +  SCL
Sbjct:   368 LSGLAAASKLLQTSSCL 384
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2012005 AT1G55980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q48MT7 PSPPH_1014 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K6B1 PFL_5143 "FAD dependent oxidoreductase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
TAIR|locus:2084903 AT3G04650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 1e-32
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
 Score =  121 bits (305), Expect = 1e-32
 Identities = 72/256 (28%), Positives = 103/256 (40%), Gaps = 29/256 (11%)

Query: 5   YVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASD 64
           YVG PGM+++ K L     V       V         N W++   DG    QF+ VV   
Sbjct: 101 YVGEPGMSALAKFLATDLTV--VLETRVTEVAR--TDNDWTLHTDDGTRHTQFDDVV--- 153

Query: 65  KNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQ 124
              ++                    L   L ++   PC++ +L + +PL   P  G +F 
Sbjct: 154 ---LAIPAPQTATLLTTDADDLPAALRAALADVVYAPCWSAVLGYPQPLD-RPWPG-NFV 208

Query: 125 DSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEM--- 181
           D   L+W   D+SK G   + E WV+ ++ D++R  +     Q         V   +   
Sbjct: 209 DGHPLAWLARDASKKGHVPDGEIWVVQASPDWSREHLDHPAEQ---------VIVALRAA 259

Query: 182 FQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLW-DVKRRLAICGDFCVSPNVEG 240
            QE  G  L  P   +  AHRW  A P    A     L  D +  L  CGD+C    VEG
Sbjct: 260 AQELDGDRLPEPD--WSDAHRWRYAIPN--DAVAGPPLDADRELPLYACGDWCAGGRVEG 315

Query: 241 AILSGLDAASKLTEIL 256
           A+LSGL AA  +   L
Sbjct: 316 AVLSGLAAADHILNGL 331

Length = 331

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 259
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 100.0
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 99.96
PLN02576496 protoporphyrinogen oxidase 99.95
PRK12416463 protoporphyrinogen oxidase; Provisional 99.95
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.93
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.9
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.9
PLN02268435 probable polyamine oxidase 99.89
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.89
PLN02529 738 lysine-specific histone demethylase 1 99.88
PLN03000 881 amine oxidase 99.87
PRK07233434 hypothetical protein; Provisional 99.85
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.85
PLN02976 1713 amine oxidase 99.84
PLN02676487 polyamine oxidase 99.83
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.83
PLN02568539 polyamine oxidase 99.81
PLN02612567 phytoene desaturase 99.79
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 99.78
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.77
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.75
PLN02487569 zeta-carotene desaturase 99.72
PRK07208479 hypothetical protein; Provisional 99.71
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.49
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 99.49
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 99.35
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.32
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.22
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.14
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.22
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.88
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 97.79
PRK09126392 hypothetical protein; Provisional 97.58
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.52
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 97.49
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.4
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.36
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.33
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.2
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.14
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.1
PRK07190 487 hypothetical protein; Provisional 97.04
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.99
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.97
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.96
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.95
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.83
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 96.83
PRK08013400 oxidoreductase; Provisional 96.73
PRK10157428 putative oxidoreductase FixC; Provisional 96.68
COG3349485 Uncharacterized conserved protein [Function unknow 96.64
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 96.57
PRK07045388 putative monooxygenase; Reviewed 96.53
PRK06185407 hypothetical protein; Provisional 96.49
PRK06996398 hypothetical protein; Provisional 96.18
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.04
PRK06834 488 hypothetical protein; Provisional 96.0
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 95.91
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 95.86
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 95.79
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 95.78
PRK10015429 oxidoreductase; Provisional 95.52
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 95.48
COG2081408 Predicted flavoproteins [General function predicti 95.41
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 95.38
PRK06184 502 hypothetical protein; Provisional 95.24
PRK08244 493 hypothetical protein; Provisional 95.08
PRK06126 545 hypothetical protein; Provisional 94.99
PRK08132 547 FAD-dependent oxidoreductase; Provisional 94.94
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 94.84
PRK11259376 solA N-methyltryptophan oxidase; Provisional 94.64
PRK11445351 putative oxidoreductase; Provisional 94.26
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 94.16
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 94.05
PLN02463447 lycopene beta cyclase 93.95
PLN02172461 flavin-containing monooxygenase FMO GS-OX 93.65
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 93.62
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.25
PRK05868372 hypothetical protein; Validated 92.97
PRK13339497 malate:quinone oxidoreductase; Reviewed 92.82
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 92.26
COG0579429 Predicted dehydrogenase [General function predicti 92.23
PRK07236386 hypothetical protein; Provisional 92.02
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 91.88
PRK06847375 hypothetical protein; Provisional 91.55
PTZ00383497 malate:quinone oxidoreductase; Provisional 91.49
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 91.28
PRK07588391 hypothetical protein; Provisional 91.13
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 90.74
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 90.6
PRK11728393 hydroxyglutarate oxidase; Provisional 90.55
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 90.18
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 90.14
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 89.99
PRK08163396 salicylate hydroxylase; Provisional 89.67
PRK06753373 hypothetical protein; Provisional 89.45
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 89.36
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 89.34
PRK09897 534 hypothetical protein; Provisional 89.31
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 89.23
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 89.16
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 88.96
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 88.64
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 88.41
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 87.88
PLN02507499 glutathione reductase 87.47
PRK05257494 malate:quinone oxidoreductase; Validated 87.41
PRK06116450 glutathione reductase; Validated 87.38
TIGR00275400 flavoprotein, HI0933 family. The model when search 87.25
PRK08294 634 phenol 2-monooxygenase; Provisional 87.24
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 87.17
PRK07845466 flavoprotein disulfide reductase; Reviewed 87.02
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 86.86
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 85.71
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 85.5
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 85.5
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 85.08
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 84.6
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 84.43
PRK06475400 salicylate hydroxylase; Provisional 84.37
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 83.65
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 83.39
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 83.17
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 83.05
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 82.84
PRK07846451 mycothione reductase; Reviewed 82.66
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 82.37
PRK14727479 putative mercuric reductase; Provisional 82.37
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 82.32
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 81.82
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of 81.74
PRK14694468 putative mercuric reductase; Provisional 81.63
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 81.45
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 81.17
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 80.96
PLN02697529 lycopene epsilon cyclase 80.09
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-44  Score=293.60  Aligned_cols=229  Identities=30%  Similarity=0.522  Sum_probs=200.9

Q ss_pred             eecCCCchHHHHHHhcCCCCeeEcceEEEEEEeecCCCceEEEccCCCccccccEEEecCCCCCCcchhhhcCCCCCCCC
Q 024990            5 YVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPLDL   84 (259)
Q Consensus         5 ~~~~~Gm~~l~~~La~~l~~~i~~~~~V~~I~~~~~~~~~~v~~~~G~~~~~~d~VIla~~~~p~~~a~~ll~~~~~~~~   84 (259)
                      |++.+||++|++.||..+++  +++++|+.|.+  .++.|+|++++|+....||.||+|   .|+||+..||...   ..
T Consensus       101 yvg~pgmsalak~LAtdL~V--~~~~rVt~v~~--~~~~W~l~~~~g~~~~~~d~vvla---~PAPQ~~~LLt~~---~~  170 (331)
T COG3380         101 YVGEPGMSALAKFLATDLTV--VLETRVTEVAR--TDNDWTLHTDDGTRHTQFDDVVLA---IPAPQTATLLTTD---AD  170 (331)
T ss_pred             cccCcchHHHHHHHhccchh--hhhhhhhhhee--cCCeeEEEecCCCcccccceEEEe---cCCCcchhhcCcc---cc
Confidence            99999999999999998877  99999999998  678999999888755589999999   9999999999642   11


Q ss_pred             CcchhHHHHhccCCCcceeEEEEeccCCCCCCCccceeecCCCceEEEEecCCCCCCCCCCceEEEEeCHHHHHHHHhhc
Q 024990           85 TFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSFQDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQT  164 (259)
Q Consensus        85 ~~~~~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~~g~~~~~~~~l~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~  164 (259)
                      ....++++.+..+.|.|||++++.|++++. .|+.|..+ ++++|.|+.++.+|+|+.+.++.||+|++++|++.|++. 
T Consensus       171 ~~p~~l~~~~a~V~y~Pc~s~~lg~~q~l~-~P~~G~~v-dg~~laWla~d~sK~g~~p~~~~~vvqasp~wSr~h~~~-  247 (331)
T COG3380         171 DLPAALRAALADVVYAPCWSAVLGYPQPLD-RPWPGNFV-DGHPLAWLARDASKKGHVPDGEIWVVQASPDWSREHLDH-  247 (331)
T ss_pred             cchHHHHHhhccceehhHHHHHhcCCccCC-CCCCCccc-CCCeeeeeeccccCCCCCCcCceEEEEeCchHHHHhhcC-
Confidence            245678999999999999999999998875 68999555 446899999998899998878899999999999999998 


Q ss_pred             CCCCCchhhHHHHHHHHHHHHHhcCC-CCCCCceEeEeeccccCCCCCcCCCCCeee-cCCCCEEEeecCCCCCChhHHH
Q 024990          165 GLQKPSEATLKKVAEEMFQEFQGTGL-SIPLPIFRKAHRWGSAFPAASIAKEERCLW-DVKRRLAICGDFCVSPNVEGAI  242 (259)
Q Consensus       165 ~~~~~~~~~~e~v~~~l~~~~~~~~~-~~~~p~~~~~~rW~~a~p~~~~g~~~~~~~-~~~~~l~laGD~~~g~~ie~A~  242 (259)
                              +.|+++..+..++..+.+ .+++|.+..+|||+||+|+....  .+.+. +...+|++|||||.|+++|+|+
T Consensus       248 --------~~e~~i~~l~aA~~~~~~~~~~~p~~s~~H~WrYA~P~~~~~--~~~L~ad~~~~l~~cGDwc~GgrVEgA~  317 (331)
T COG3380         248 --------PAEQVIVALRAAAQELDGDRLPEPDWSDAHRWRYAIPNDAVA--GPPLDADRELPLYACGDWCAGGRVEGAV  317 (331)
T ss_pred             --------CHHHHHHHHHHhhhhccCCCCCcchHHHhhcccccccccccc--CCccccCCCCceeeecccccCcchhHHH
Confidence                    678888888888877744 67899999999999999998764  46666 7788999999999999999999


Q ss_pred             HHHHHHHHHHHhhh
Q 024990          243 LSGLDAASKLTEIL  256 (259)
Q Consensus       243 ~SG~~aA~~l~~~l  256 (259)
                      .||+.+|++|++.|
T Consensus       318 LSGlAaA~~i~~~L  331 (331)
T COG3380         318 LSGLAAADHILNGL  331 (331)
T ss_pred             hccHHHHHHHHhcC
Confidence            99999999998764

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
3kkj_A336 X-Ray Structure Of P. Syringae Q888a4 Oxidoreductas 1e-19
>pdb|3KKJ|A Chain A, X-Ray Structure Of P. Syringae Q888a4 Oxidoreductase At Resolution 2.5a, Northeast Structural Genomics Consortium Target Psr10 Length = 336 Back     alignment and structure 
Iteration: 1

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 121/249 (48%), Gaps = 29/249 (11%)
Query: 4   KYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVAS 63
           ++VG PG ++I +A      V     +     E    +  W++   +GQ+ G F+ V+  
Sbjct: 102 RWVGKPGXSAITRAXRGDXPVSFSCRI----TEVFRGEEHWNLLDAEGQNHGPFSHVI-- 155
Query: 64  DKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSSIPVKGFSF 123
              + +P  +  T       L  AP LA  +  +  +P +A+ LAF  PL + P +G   
Sbjct: 156 ---IATPAPQAST------LLAAAPKLASVVAGVKXDPTWAVALAFETPLQT-PXQGCFV 205
Query: 124 QDSEVLSWAHCDSSKPGRSANSERWVLHSTADYARTVIAQTGLQKPSEATLKKVAEEMFQ 183
           QDS  L W   + SKP R    + W+LH+T+ ++R  +         +A+ ++V E +  
Sbjct: 206 QDSP-LDWLARNRSKPERDDTLDTWILHATSQWSRQNL---------DASREQVIEHLHG 255
Query: 184 EF-QGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLWDVKRRLAICGDFCVSPNVEGAI 242
            F +    + P P+F  AHRW  A PA   A E   L D    + +CGD+C+S  VEGA 
Sbjct: 256 AFAELIDCTXPAPVFSLAHRWLYARPAG--AHEWGALSDADLGIYVCGDWCLSGRVEGAW 313
Query: 243 LSGLDAASK 251
           LSG +AA +
Sbjct: 314 LSGQEAARR 322

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query259
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 1e-31
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 7e-31
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 1e-06
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 6e-05
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 100.0
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.97
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.95
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.94
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.94
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 99.92
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.9
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.89
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.89
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.88
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.87
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.86
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.86
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.84
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.84
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.84
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.82
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.81
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.78
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.69
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.66
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.66
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.62
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.62
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.5
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.39
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.88
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.82
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.82
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.64
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.34
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.02
1vg0_A650 RAB proteins geranylgeranyltransferase component A 97.01
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.0
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 96.77
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 96.68
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.64
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.45
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 96.43
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.42
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.39
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 96.27
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 96.15
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.12
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 95.83
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 95.35
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 95.0
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 94.88
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 94.49
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 94.47
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 94.29
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 94.29
2ywl_A180 Thioredoxin reductase related protein; uncharacter 94.21
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 94.21
3dme_A369 Conserved exported protein; structural genomics, P 94.13
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 93.93
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 93.87
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 93.79
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 93.73
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 93.66
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 93.59
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 93.57
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 93.13
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 92.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 92.94
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 92.93
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 92.89
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 92.81
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 92.81
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 92.57
4hb9_A412 Similarities with probable monooxygenase; flavin, 92.55
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 92.54
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 92.48
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 92.43
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 92.39
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 92.39
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 92.28
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 92.16
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 92.04
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 92.02
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 91.6
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 91.57
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 91.4
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 91.33
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 91.28
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 91.03
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 90.99
2gqf_A401 Hypothetical protein HI0933; structural genomics, 90.94
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 90.81
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 90.62
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 90.59
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 90.54
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 90.41
1fec_A490 Trypanothione reductase; redox-active center, oxid 90.31
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 90.26
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 90.26
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 90.11
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 89.8
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 89.77
4dna_A463 Probable glutathione reductase; structural genomic 89.47
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 88.89
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 88.69
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 88.69
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 88.67
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 88.52
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 88.41
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 88.04
1ojt_A482 Surface protein; redox-active center, glycolysis, 87.86
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 87.81
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 87.44
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 87.43
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 86.97
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 86.67
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 86.57
2cul_A232 Glucose-inhibited division protein A-related PROT 86.54
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 86.35
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 86.33
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 86.01
3r9u_A315 Thioredoxin reductase; structural genomics, center 85.07
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 84.58
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 84.26
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 84.23
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 84.16
3atr_A 453 Conserved archaeal protein; saturating double bond 83.8
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 83.42
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 83.4
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 83.38
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 83.35
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 83.27
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 83.25
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 83.17
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 83.05
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 82.96
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 82.55
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 82.52
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 82.46
2cul_A232 Glucose-inhibited division protein A-related PROT 82.36
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 82.21
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 82.11
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 81.85
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 81.79
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 81.72
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 81.54
2bry_A497 NEDD9 interacting protein with calponin homology a 81.32
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 81.31
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 81.25
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 81.04
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 80.91
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 80.9
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 80.68
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 80.41
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 80.29
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 80.28
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.1e-38  Score=275.27  Aligned_cols=236  Identities=22%  Similarity=0.326  Sum_probs=199.3

Q ss_pred             cceecCCCchHHHHHHhcCCCCeeEcceEEEEEEeecCCCceEEEccCCCccccccEEEecCCCCCCcchhhhcCCCCCC
Q 024990            3 KKYVGVPGMNSICKALCHQPGVESKFGVGVGRFEWLEDKNLWSVSGLDGQSLGQFNGVVASDKNVVSPRFRDVTGRPPPL   82 (259)
Q Consensus         3 ~~~~~~~Gm~~l~~~La~~l~~~i~~~~~V~~I~~~~~~~~~~v~~~~G~~~~~~d~VIla~~~~p~~~a~~ll~~~~~~   82 (259)
                      .+|+..+||++++++|++.++++|+++++|.+|++  ++++|+|++.+|+.+ .||+||+|   +|++++.+|+....| 
T Consensus       103 ~~~~~~~g~~~l~~~l~~~~g~~i~~~~~V~~i~~--~~~~~~v~~~~g~~~-~ad~vV~A---~p~~~~~~ll~~~~~-  175 (342)
T 3qj4_A          103 CNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINL--RDDKWEVSKQTGSPE-QFDLIVLT---MPVPEILQLQGDITT-  175 (342)
T ss_dssp             EEEECTTCTTHHHHHHHHHHTCEEESSCCEEEEEE--CSSSEEEEESSSCCE-EESEEEEC---SCHHHHTTCBSTHHH-
T ss_pred             cceecCCCHHHHHHHHHHhcCCEEEeCCEEEEEEE--cCCEEEEEECCCCEE-EcCEEEEC---CCHHHHHHHhccccc-
Confidence            46899999999999999988889999999999998  778999998888754 89999999   999999999975211 


Q ss_pred             CCCcchhHHHHhccCCCcceeEEEEeccCCCCC-CCccceeecCCCceEEEEecCCCCCCC--CCCceEEEEeCHHHHHH
Q 024990           83 DLTFAPDLAVKLEEIPVNPCFALMLAFSEPLSS-IPVKGFSFQDSEVLSWAHCDSSKPGRS--ANSERWVLHSTADYART  159 (259)
Q Consensus        83 ~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~~~-~~~~g~~~~~~~~l~~~~~~~~k~~~~--~~~~~~~~~~~~~~~~~  159 (259)
                        .++++..+.++.++|.+++++++.|+++++. .|+.|+.+++++.+.|++++++|++|.  ++...+++++++.|+.+
T Consensus       176 --~l~~~~~~~l~~~~~~~~~~v~l~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~k~~r~~~~~~~~~v~~~~~~~~~~  253 (342)
T 3qj4_A          176 --LISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVT  253 (342)
T ss_dssp             --HSCHHHHHHHHTCCBCCEEEEEEECSSCC--CCSCSEEECSSCSSEEEEEEHHHHTTCCCC-CCCEEEEEECHHHHHH
T ss_pred             --ccCHHHHHHHhcCCccccEEEEEEECCCCccCCceeeEEccCCcceEEEEccccCCCCCCCCCCceEEEECCHHHHHH
Confidence              0344678899999999999999999986543 678898887766789999999998864  23458899999999998


Q ss_pred             HHhhcCCCCCchhhHHHHHHHHHHHHHhcCCCCCCCceEeEeeccccCCCCCcCCCCCeee-cCCCCEEEeecCCCCCCh
Q 024990          160 VIAQTGLQKPSEATLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPAASIAKEERCLW-DVKRRLAICGDFCVSPNV  238 (259)
Q Consensus       160 ~~~~~~~~~~~~~~~e~v~~~l~~~~~~~~~~~~~p~~~~~~rW~~a~p~~~~g~~~~~~~-~~~~~l~laGD~~~g~~i  238 (259)
                      +++.         +++++.+.++++|.++++..++|+++++|||+|++|++.......++. +..++|++||||+.|++|
T Consensus       254 ~~~~---------~~~~~~~~~~~~l~~~~g~~~~p~~~~v~rW~~a~p~~~~~~~~~~~~~~~~~~l~laGd~~~g~~v  324 (342)
T 3qj4_A          254 YLEH---------SIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNF  324 (342)
T ss_dssp             TTTS---------CHHHHHHHHHHHHHHHSCSCCCCSEEEEEEETTCSBSSCCSSSCSCEEEETTTEEEECSGGGSCSSH
T ss_pred             hhcC---------CHHHHHHHHHHHHHHhccCCCCCceeeeccccccccccccCCCcceeEecCCccEEEEccccCCCCc
Confidence            8776         679999999999999888778999999999999999986532233444 677899999999999999


Q ss_pred             hHHHHHHHHHHHHHHhhh
Q 024990          239 EGAILSGLDAASKLTEIL  256 (259)
Q Consensus       239 e~A~~SG~~aA~~l~~~l  256 (259)
                      |+|++||++||++|++.|
T Consensus       325 ~~ai~sg~~aa~~i~~~l  342 (342)
T 3qj4_A          325 DGCITSALCVLEALKNYI  342 (342)
T ss_dssp             HHHHHHHHHHHHHHTTC-
T ss_pred             cHHHHHHHHHHHHHHhhC
Confidence            999999999999998754
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query259
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.05
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.82
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.7
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.33
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.17
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.71
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.64
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.49
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.4
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.39
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.28
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.02
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.98
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.84
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.84
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 96.59
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 96.55
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.51
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.44
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.32
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.29
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.25
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 96.21
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 96.14
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.88
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.69
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.52
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.18
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.14
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.01
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 94.94
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.89
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.82
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.55
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 94.51
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.4
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.23
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.98
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.16
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.69
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.67
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 89.65
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 88.41
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 84.48
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 83.09
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 81.85
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 81.84
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 81.14
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 81.02
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 80.54
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 80.51
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FAD-linked reductases, C-terminal domain
superfamily: FAD-linked reductases, C-terminal domain
family: L-aminoacid/polyamine oxidase
domain: Protoporphyrinogen oxidase
species: Myxococcus xanthus [TaxId: 34]

Probab=99.05  E-value=7.8e-11  Score=83.50  Aligned_cols=103  Identities=17%  Similarity=0.175  Sum_probs=76.9

Q ss_pred             CCcceeEEEEeccCCCCCC-CccceeecCC--CceEEEEecCCC-CCCCCCC-ceEEEEeCHHHHHHHHhhcCCCCCchh
Q 024990           98 PVNPCFALMLAFSEPLSSI-PVKGFSFQDS--EVLSWAHCDSSK-PGRSANS-ERWVLHSTADYARTVIAQTGLQKPSEA  172 (259)
Q Consensus        98 ~~~~~~~~~l~~~~~~~~~-~~~g~~~~~~--~~l~~~~~~~~k-~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~  172 (259)
                      .|.++.+|.++|+++.... .-+|++++..  ..+..++++|.| |++.+++ ..++++.+..+..+....         
T Consensus         1 ~Ya~vavV~l~~~~~~~~~~~GfG~LVP~~e~~~~lg~~f~S~~fp~r~p~~~~llrv~~Gg~~~~~~~~~---------   71 (108)
T d2ivda2           1 AYAPIAVVHLGFDAGTLPAPDGFGFLVPAEEQRRMLGAIHASTTFPFRAEGGRVLYSCMVGGARQPGLVEQ---------   71 (108)
T ss_dssp             CBCCEEEEEEEECTTSSCCCCSSEEECCGGGCCSCCEEEEHHHHCGGGBSTTCEEEEEEEECTTCGGGGGS---------
T ss_pred             CCCCEEEEEEEEcHHHCCCCCceEEEccCCCCCeEEEEEEEccccccccCCCCEEEEEEeCCCCCcccccC---------
Confidence            4899999999998753322 3466666542  234457788888 8887644 456788776655555544         


Q ss_pred             hHHHHHHHHHHHHHhcCCCCCCCceEeEeeccccCCC
Q 024990          173 TLKKVAEEMFQEFQGTGLSIPLPIFRKAHRWGSAFPA  209 (259)
Q Consensus       173 ~~e~v~~~l~~~~~~~~~~~~~p~~~~~~rW~~a~p~  209 (259)
                      +++++.+.++++++++++...+|..++++||+.++||
T Consensus        72 ~d~~l~~~a~~dL~~~lgi~~~P~~~~v~rw~~aiPQ  108 (108)
T d2ivda2          72 DEDALAALAREELKALAGVTARPSFTRVFRWPLGIPQ  108 (108)
T ss_dssp             CHHHHHHHHHHHHHHHHCCCSCCSEEEEEEESSCCBC
T ss_pred             CHHHHHHHHHHHHHHHhCCCCCCcEEEeeECCCCcCc
Confidence            6789999999999998777778999999999999986
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure