Citrus Sinensis ID: 025134


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MFCGMLVQDPSKGDPNDVDAIFNQAKELGAVEGPLEHLSPSSSSRSFTGTARLLSGETVPSAPQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLIRRDVKCPEPEKHHVPFQGVGRTLGSSSTAASEPTVDSTPVNTASSSSEGLVVDENLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSVVIQKF
ccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccEEccccccccccccccccEEEEEEEcccEEEcccccccccccccHHHHHHHHccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEcccccHHHHHHHHHHccccccccccEEEEcccccccccccccHHHHcccccEEEEEc
ccccEEEcccccccccHHHHHHHHHHHccccccccccccccccccccccccEEcccccccccccccccEEEEEEEEcccEEEccccccccccHHHHHHHHHHHcccccHHHHccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccHccccccccccccccccccEEEEEEEccccEEEEEEcccccHHHHHHHHHHHccccccccEEEEEccccccccccccHHHHHccccEEEEEEc
mfcgmlvqdpskgdpndVDAIFNQAKelgavegplehlspssssrsftgtarllsgetvpsapqqpepivhnivfwangftvndgplrrlddpenaSFLESIkksecpkelepadkrssvHVNLIrrdvkcpepekhhvpfqgvgrtlgssstaaseptvdstpvntasssseglvvdenlpstsVQIRLADGTRLIAHFnlhhtisdihsfidasrpgtarnyqlqmmgfppkvlaDRTQTIEQAGLANSVVIQKF
mfcgmlvqdpskgdpNDVDAIFNQAKELGAVEGPLEHLSPSSSSRSFTGTARLLSGETVPSAPQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESikksecpkelepadkrssvhvNLIRRdvkcpepekhhvpfqgvgrtlgSSSTAaseptvdstpvntasssseglvvdenlpSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIeqaglansvviqkf
MFCGMLVQDPSKGDPNDVDAIFNQAKELGAVEGPLEHLspssssrsFTGTARLLSGETVPSAPQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLIRRDVKCPEPEKHHVPFQGVGRTLGSSSTAASEPTVDSTPVNTASSSSEGLVVDENLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSVVIQKF
********************************************************************IVHNIVFWANGFTVNDG***************************************************************************************************SVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADR***I**************
MFCGML*********************************************************************WANGFTVNDGPLR*******************************VHVNLIRRDVKC**************************************************PSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSVVIQKF
MFCGMLVQDPSKGDPNDVDAIFNQAKELGAVEG*****************ARLLSGETVPSAPQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLIRRDVKCPEPEKHHVPFQGVGRT***************************LVVDENLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSVVIQKF
**CGMLVQDPSKGDPNDVDAIFNQAKEL*****************************TVPSAPQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLIRRDVKCPEPEKHHVPF***********************************VDENLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSVVIQKF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFCGMLVQDPSKGDPNDVDAIFNQAKELGAVEGPLEHLSPSSSSRSFTGTARLLSGETVPSAPQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLIRRDVKCPEPEKHHVPFQGVGRTLGSSSTAASEPTVDSTPVNTASSSSEGLVVDENLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSVVIQKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query257 2.2.26 [Sep-21-2011]
Q7Y175421 UBA and UBX domain-contai no no 0.968 0.591 0.583 2e-71
Q5RBG3370 NSFL1 cofactor p47 OS=Pon yes no 0.980 0.681 0.356 3e-34
Q9UNZ2370 NSFL1 cofactor p47 OS=Hom yes no 0.980 0.681 0.356 3e-34
Q3SZC4370 NSFL1 cofactor p47 OS=Bos yes no 0.961 0.667 0.345 3e-33
O35987370 NSFL1 cofactor p47 OS=Rat yes no 0.961 0.667 0.342 8e-33
Q9CZ44370 NSFL1 cofactor p47 OS=Mus yes no 0.961 0.667 0.342 8e-33
Q0P3R5350 UBX domain-containing pro N/A no 0.906 0.665 0.354 1e-31
P0C627331 UBX domain-containing pro no no 0.957 0.743 0.340 3e-31
Q5ZK10369 NSFL1 cofactor p47 OS=Gal yes no 0.961 0.669 0.327 9e-31
Q0KL01331 UBX domain-containing pro no no 0.957 0.743 0.333 2e-30
>sp|Q7Y175|UBAX1_ARATH UBA and UBX domain-containing protein At4g15410 OS=Arabidopsis thaliana GN=At4g15410 PE=2 SV=1 Back     alignment and function desciption
 Score =  268 bits (686), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 188/262 (71%), Gaps = 13/262 (4%)

Query: 3   CGMLVQDPSKGDPNDVDAIFNQAKELGAVEGPLEHLSPS-SSSRSFTGTARLLSGETVPS 61
            GM+VQDP K    DVD +F+QA++  AV+ P+E   PS S+S SFTG ARLLSGE V S
Sbjct: 166 SGMMVQDPKK--VKDVDELFDQARQ-SAVDRPVE---PSRSASTSFTGAARLLSGEAVSS 219

Query: 62  APQQPEP-----IVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADK 116
           +PQQ +      I+H I FW NGFTVNDGPLR   DPENA+F+ SI +SECP ELEPADK
Sbjct: 220 SPQQQQQEQPQRIMHTITFWLNGFTVNDGPLRGFSDPENAAFMNSISRSECPSELEPADK 279

Query: 117 RSSVHVNLIRRDVKCPEPEKHHVPFQGVGRTLGSSSTAASEPTVDSTP-VNTASSSSEGL 175
           +  VHV+L+RR     EP K   PFQGVGRTLG+S + +S     S+  +N A + S GL
Sbjct: 280 KIPVHVDLVRRGENFTEPPKPKNPFQGVGRTLGASGSGSSSAPQASSAPMNVAPAPSRGL 339

Query: 176 VVDENLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKV 235
           VVD   P+TS+Q+RLADGTRL++ FN HHT+ D+  FIDASRPG ++ YQL  MGFPPK 
Sbjct: 340 VVDPAAPTTSIQLRLADGTRLVSRFNNHHTVRDVRGFIDASRPGGSKEYQLLTMGFPPKQ 399

Query: 236 LADRTQTIEQAGLANSVVIQKF 257
           L +  QTIEQAG+AN+VVIQKF
Sbjct: 400 LTELDQTIEQAGIANAVVIQKF 421





Arabidopsis thaliana (taxid: 3702)
>sp|Q5RBG3|NSF1C_PONAB NSFL1 cofactor p47 OS=Pongo abelii GN=NSFL1C PE=2 SV=1 Back     alignment and function description
>sp|Q9UNZ2|NSF1C_HUMAN NSFL1 cofactor p47 OS=Homo sapiens GN=NSFL1C PE=1 SV=2 Back     alignment and function description
>sp|Q3SZC4|NSF1C_BOVIN NSFL1 cofactor p47 OS=Bos taurus GN=NSFL1C PE=2 SV=1 Back     alignment and function description
>sp|O35987|NSF1C_RAT NSFL1 cofactor p47 OS=Rattus norvegicus GN=Nsfl1c PE=1 SV=1 Back     alignment and function description
>sp|Q9CZ44|NSF1C_MOUSE NSFL1 cofactor p47 OS=Mus musculus GN=Nsfl1c PE=1 SV=1 Back     alignment and function description
>sp|Q0P3R5|UBX2B_XENLA UBX domain-containing protein 2B OS=Xenopus laevis GN=ubxn2b PE=2 SV=1 Back     alignment and function description
>sp|P0C627|UBX2B_RAT UBX domain-containing protein 2B OS=Rattus norvegicus GN=Ubxn2b PE=1 SV=1 Back     alignment and function description
>sp|Q5ZK10|NSF1C_CHICK NSFL1 cofactor p47 OS=Gallus gallus GN=NSFL1C PE=2 SV=1 Back     alignment and function description
>sp|Q0KL01|UBX2B_MOUSE UBX domain-containing protein 2B OS=Mus musculus GN=Ubxn2b PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
255554763305 NSFL1 cofactor p47, putative [Ricinus co 0.988 0.832 0.827 1e-118
225444462299 PREDICTED: UBA and UBX domain-containing 0.972 0.836 0.792 1e-112
224115898305 predicted protein [Populus trichocarpa] 0.980 0.826 0.808 1e-112
224115762253 predicted protein [Populus trichocarpa] 0.976 0.992 0.8 1e-111
118488401305 unknown [Populus trichocarpa] 0.980 0.826 0.785 1e-109
224118108309 predicted protein [Populus trichocarpa] 0.980 0.815 0.757 1e-106
356555700301 PREDICTED: UBA and UBX domain-containing 0.984 0.840 0.762 1e-105
255638519301 unknown [Glycine max] 0.984 0.840 0.762 1e-105
356532265301 PREDICTED: UBA and UBX domain-containing 0.984 0.840 0.743 1e-103
449455377302 PREDICTED: UBA and UBX domain-containing 0.980 0.834 0.747 1e-101
>gi|255554763|ref|XP_002518419.1| NSFL1 cofactor p47, putative [Ricinus communis] gi|223542264|gb|EEF43806.1| NSFL1 cofactor p47, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/255 (82%), Positives = 235/255 (92%), Gaps = 1/255 (0%)

Query: 4   GMLVQDPSKGDPNDVDAIFNQAKELGAVEGPLEHLSPSSSSRSFTGTARLLSGETVPSAP 63
           GMLVQDPSKG+ NDVDAIFNQA++LGAVEGPL+ L PSSSSRSFTGT RLLSGET+PSAP
Sbjct: 51  GMLVQDPSKGNGNDVDAIFNQARQLGAVEGPLDPLRPSSSSRSFTGTGRLLSGETIPSAP 110

Query: 64  QQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVN 123
           QQPE ++HNIVFW NGFTVNDGPLRRLDDPENA FLESI+KSECPKEL PAD+RSSVHVN
Sbjct: 111 QQPEAVIHNIVFWTNGFTVNDGPLRRLDDPENAPFLESIRKSECPKELAPADRRSSVHVN 170

Query: 124 LIRRDVKCPEPEKH-HVPFQGVGRTLGSSSTAASEPTVDSTPVNTASSSSEGLVVDENLP 182
           LIRR+ +CPEPEK  HVPFQGVGRTLGSS TAASEPT +STPVNTA +SS G+VVDE+LP
Sbjct: 171 LIRREEQCPEPEKQRHVPFQGVGRTLGSSCTAASEPTANSTPVNTAPTSSMGVVVDESLP 230

Query: 183 STSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQT 242
           STS+Q+RLADGTR+IAHFN HHT++DI +FIDASRPG A+NYQLQ+MGFPPK+L D TQT
Sbjct: 231 STSIQLRLADGTRMIAHFNYHHTVNDIRAFIDASRPGGAQNYQLQLMGFPPKLLGDPTQT 290

Query: 243 IEQAGLANSVVIQKF 257
           IEQAGLANSVVIQKF
Sbjct: 291 IEQAGLANSVVIQKF 305




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225444462|ref|XP_002272066.1| PREDICTED: UBA and UBX domain-containing protein At4g15410 [Vitis vinifera] gi|147798327|emb|CAN74529.1| hypothetical protein VITISV_031346 [Vitis vinifera] gi|297741768|emb|CBI32997.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115898|ref|XP_002317152.1| predicted protein [Populus trichocarpa] gi|222860217|gb|EEE97764.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115762|ref|XP_002317118.1| predicted protein [Populus trichocarpa] gi|222860183|gb|EEE97730.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118488401|gb|ABK96017.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118108|ref|XP_002331560.1| predicted protein [Populus trichocarpa] gi|222873784|gb|EEF10915.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356555700|ref|XP_003546168.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Glycine max] Back     alignment and taxonomy information
>gi|255638519|gb|ACU19568.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356532265|ref|XP_003534694.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like [Glycine max] Back     alignment and taxonomy information
>gi|449455377|ref|XP_004145429.1| PREDICTED: UBA and UBX domain-containing protein At4g15410-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
TAIR|locus:2132001367 PUX3 "AT4G22150" [Arabidopsis 0.964 0.675 0.689 5.1e-90
TAIR|locus:2137291303 PUX4 "plant UBX domain contain 0.968 0.821 0.675 6.5e-90
TAIR|locus:2130110421 PUX5 "serine/threonine protein 0.968 0.591 0.584 2.5e-74
TAIR|locus:2089920435 AT3G21660 "AT3G21660" [Arabido 0.420 0.248 0.508 7.4e-39
UNIPROTKB|Q9UNZ2370 NSFL1C "NSFL1 cofactor p47" [H 0.976 0.678 0.353 1.8e-32
UNIPROTKB|Q3SZC4370 NSFL1C "NSFL1 cofactor p47" [B 0.976 0.678 0.353 2.6e-31
MGI|MGI:3042273370 Nsfl1c "NSFL1 (p97) cofactor ( 0.976 0.678 0.349 8.8e-31
RGD|619952370 Nsfl1c "NSFL1 (p97) cofactor ( 0.976 0.678 0.349 8.8e-31
ASPGD|ASPL0000010843373 AN11055 [Emericella nidulans ( 0.817 0.563 0.368 3e-30
DICTYBASE|DDB_G0293498415 DDB_G0293498 "UBX domain-conta 0.968 0.6 0.344 4.9e-30
TAIR|locus:2132001 PUX3 "AT4G22150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 898 (321.2 bits), Expect = 5.1e-90, P = 5.1e-90
 Identities = 178/258 (68%), Positives = 209/258 (81%)

Query:     4 GMLVQDPSKGDP--NDVDAIFNQAKELGAVEGPLEHLXXXXXXXXFTGTARLLSGETVPS 61
             GMLVQDP+K +P  +DVD IFNQA++LGAVEGPLEH         FTGT RLLSGE+VP+
Sbjct:   116 GMLVQDPTK-EPKHDDVDEIFNQARQLGAVEGPLEH---PSSSRSFTGTGRLLSGESVPT 171

Query:    62 APQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVH 121
             A QQPEP++HNI+FW+NGFTV+DGPLR+LDDPENASFL+SI+KSECPKELEP DKR+ VH
Sbjct:   172 ALQQPEPVIHNIIFWSNGFTVDDGPLRKLDDPENASFLDSIRKSECPKELEPVDKRAPVH 231

Query:   122 VNLIRRDVKCPEPEKHHVPFQGVGRTLG--SSSTAASEPTVDSTPVNTASSSSEGLVVDE 179
             VNL+RRD KCPE EK  V FQGVGRTLG  SSSTA+S+  +  T V    S  + LVVDE
Sbjct:   232 VNLMRRDEKCPEKEKLKVSFQGVGRTLGGASSSTASSQSNL--TDVAAVQSPLQSLVVDE 289

Query:   180 NLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADR 239
              LPSTS+Q+RLADGTR++A FN HHT++DI  FI+ SRPG   NY LQ+MGFPPK L D 
Sbjct:   290 TLPSTSIQLRLADGTRMVAKFNNHHTVNDIRGFIEFSRPGNPNNYTLQVMGFPPKPLTDP 349

Query:   240 TQTIEQAGLANSVVIQKF 257
             +QTIEQAGLA+SVVIQKF
Sbjct:   350 SQTIEQAGLASSVVIQKF 367




GO:0008150 "biological_process" evidence=ND
TAIR|locus:2137291 PUX4 "plant UBX domain containing protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130110 PUX5 "serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B prime gamma" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089920 AT3G21660 "AT3G21660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UNZ2 NSFL1C "NSFL1 cofactor p47" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZC4 NSFL1C "NSFL1 cofactor p47" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:3042273 Nsfl1c "NSFL1 (p97) cofactor (p47)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619952 Nsfl1c "NSFL1 (p97) cofactor (p47)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ASPGD|ASPL0000010843 AN11055 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293498 DDB_G0293498 "UBX domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00011514001
SubName- Full=Putative uncharacterized protein (Chromosome chr10 scaffold_312, whole genome shotgun sequence); (299 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
smart0055393 smart00553, SEP, Domain present in Saccharomyces c 4e-34
pfam0805975 pfam08059, SEP, SEP domain 2e-32
cd0177079 cd01770, p47_UBX, p47-like ubiquitin domain 2e-22
cd0176777 cd01767, UBX, UBX (ubiquitin regulatory X) domain 1e-17
pfam0078978 pfam00789, UBX, UBX domain 4e-14
cd0177279 cd01772, SAKS1_UBX, SAKS1-like UBX domain 4e-06
smart0016677 smart00166, UBX, Domain present in ubiquitin-regul 5e-05
>gnl|CDD|197786 smart00553, SEP, Domain present in Saccharomyces cerevisiae Shp1, Drosophila melanogaster eyes closed gene (eyc), and vertebrate p47 Back     alignment and domain information
 Score =  117 bits (296), Expect = 4e-34
 Identities = 40/87 (45%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 67  EPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLI- 125
           + ++H + FW+NGF+V+DGPLR  DDPENA FLESI++ E P EL    K   V+V++  
Sbjct: 1   QKVIHTLTFWSNGFSVDDGPLRTYDDPENAEFLESIRRGEAPLELLRVAKGQPVNVDVED 60

Query: 126 RRDVKCPEPEKHHVPFQGVGRTLGSSS 152
            RD     P     PF G G+ LGS  
Sbjct: 61  HRDEDYVAPPGAFKPFSGSGQKLGSPG 87


Length = 93

>gnl|CDD|219713 pfam08059, SEP, SEP domain Back     alignment and domain information
>gnl|CDD|176365 cd01770, p47_UBX, p47-like ubiquitin domain Back     alignment and domain information
>gnl|CDD|176362 cd01767, UBX, UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>gnl|CDD|216120 pfam00789, UBX, UBX domain Back     alignment and domain information
>gnl|CDD|176367 cd01772, SAKS1_UBX, SAKS1-like UBX domain Back     alignment and domain information
>gnl|CDD|197552 smart00166, UBX, Domain present in ubiquitin-regulatory proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 257
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 100.0
smart0055393 SEP Domain present in Saccharomyces cerevisiae Shp 100.0
PF0805975 SEP: SEP domain; InterPro: IPR012989 The SEP (afte 99.97
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 99.93
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 99.85
smart0016680 UBX Domain present in ubiquitin-regulatory protein 99.8
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 99.79
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 99.79
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 99.76
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 99.76
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 99.75
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 99.33
KOG1364356 consensus Predicted ubiquitin regulatory protein, 99.0
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 98.82
KOG1363460 consensus Predicted regulator of the ubiquitin pat 98.32
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 97.62
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 97.41
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 97.29
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 97.26
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 97.2
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 97.18
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 97.13
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 97.0
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 96.99
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 96.95
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 96.86
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 96.79
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 96.75
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 96.73
PTZ0004476 ubiquitin; Provisional 96.72
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 96.64
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 96.59
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 96.59
PF12090182 Spt20: Spt20 family; InterPro: IPR021950 This pres 96.59
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 96.53
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 96.47
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 96.38
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 95.97
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 95.94
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 95.74
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 95.33
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 94.91
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 94.86
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 94.54
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 94.46
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 94.36
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 93.7
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 92.82
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 92.47
PLN02560 308 enoyl-CoA reductase 90.71
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 90.6
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 89.15
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 87.96
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 86.83
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 86.74
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 84.3
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 83.15
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 82.82
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 82.18
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 81.89
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
Probab=100.00  E-value=2.5e-67  Score=486.81  Aligned_cols=252  Identities=49%  Similarity=0.803  Sum_probs=211.9

Q ss_pred             ccccccCCCCCC--CchHHHHHHHHHHcCCCCCCCCCCCCCCCCCceeeeeeecCCCCCCCCCC-------CCCCceEEE
Q 025134            3 CGMLVQDPSKGD--PNDVDAIFNQAKELGAVEGPLEHLSPSSSSRSFTGTARLLSGETVPSAPQ-------QPEPIVHNI   73 (257)
Q Consensus         3 SG~~V~~p~~~~--~~~v~~if~~A~~~ga~~~~~~~~~~~~~~~~F~G~G~~Lg~~~~~~~~~-------~~~~~~~~l   73 (257)
                      |||+|.+|+++.  .+.|+++|++|+++||++.+...  .-.....|.|++.-|.|+.+|...+       .++.+.|+|
T Consensus       112 ~gq~~v~~~~k~~~~e~v~~~~~~a~q~~a~~~~~~~--~~~~~~~~~gs~~~lsg~~~~~~~q~~~~~~~~~~~v~~~l  189 (380)
T KOG2086|consen  112 SGQMVVEPPDKKSSEEDVDEIFGQARQMGAVEGPLAP--SESSSGEFLGSGGDLSGEVVPLGTQQQQREAQPPEPVTVTL  189 (380)
T ss_pred             ccccccCCCccccHHHHHHHHHhhhcccCccccCccC--ccccccccccccccccCccccCCcccCcccccCCCcceeEE
Confidence            676666665543  35899999999999997644211  1123467889988888888775443       257799999


Q ss_pred             EEeccceeecCCCCccCCChhhHHHHHHHhcCCCCCcccCCCCCCceEEEEe-cccccCCCCCCCCccccccccccccCC
Q 025134           74 VFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLI-RRDVKCPEPEKHHVPFQGVGRTLGSSS  152 (257)
Q Consensus        74 ~lw~nGF~VddGp~R~y~dP~n~~FL~~I~~G~~P~EL~~~~~~~~V~v~l~-~r~e~y~~p~~~~~~F~G~G~~LGs~~  152 (257)
                      +||||||+|||||||+|+||+|++||++|++|+||.||+.++++++|+|+|+ ||+|+|.+|++.+++|+|+||+||++.
T Consensus       190 ~lW~nGFsvdDGplr~ydDP~N~~fL~~I~~Ge~P~eL~~~~~~~~V~v~v~~~r~E~~~~~~~~~~pF~G~Gq~LGs~~  269 (380)
T KOG2086|consen  190 KLWKNGFSVDDGPLRSYDDPANAEFLESIRKGEAPSELLPVDPGQEVDVKVEDHRDEDYLEPKPVFKPFSGEGQRLGSTA  269 (380)
T ss_pred             EEeeccccccCCCcccccChhHHHHHHHHhccCCCHHHhccccCCccceeccccccccccCCCcccCCCCCcCeecCCcC
Confidence            9999999999999999999999999999999999999999999999999999 589999999888999999999999987


Q ss_pred             CCCCCCC-CCCCC---CC-CCCCCCCCcccCCCCCceEEEEEcCCCCEEEEEeCCCCCHHHHHHHHHhhCCCC-CcCeEE
Q 025134          153 TAASEPT-VDSTP---VN-TASSSSEGLVVDENLPSTSVQIRLADGTRLIAHFNLHHTISDIHSFIDASRPGT-ARNYQL  226 (257)
Q Consensus       153 p~~~~~~-~~~~~---~~-~~~~~~~~~~vd~s~p~t~iqIRl~dG~rlv~~fn~s~TI~dl~~fi~~~~p~~-~~~f~L  226 (257)
                      |....++ +....   ++ .+..+...+.+|+..|+|+|||||+||+|+|++||++|||.|||.||..++|.+ ..+|.|
T Consensus       270 p~~~~ss~~~~~~~~p~~~~~~~~~~sl~~d~~~PtTsIQIRLanG~RlV~~fN~sHTv~DIR~fI~~aRp~~~~~~F~L  349 (380)
T KOG2086|consen  270 PGVSGSSSPPLTATVPANTQERSASSSLVIDPAEPTTSIQIRLANGTRLVLKFNHSHTVSDIREFIDTARPGDSSTYFIL  349 (380)
T ss_pred             CCccccCCCcccccCCccccccccccccccCCCCCcceEEEEecCCceeeeeccCcccHHHHHHHHHhcCCCCcCCceee
Confidence            7654322 11111   11 223356678899999999999999999999999999999999999999999987 568999


Q ss_pred             EecCCCCcccCCccCcHhhhCCCCeeEEeeC
Q 025134          227 QMMGFPPKVLADRTQTIEQAGLANSVVIQKF  257 (257)
Q Consensus       227 ~t~~fP~k~l~d~s~TL~eagL~navivqk~  257 (257)
                      ++ +||+|+|+|+++|||+|||+|+||||||
T Consensus       350 ~~-~FPpk~l~D~sqTle~AgL~Nsvlvqr~  379 (380)
T KOG2086|consen  350 MM-AFPPKPLSDDSQTLEEAGLLNSVLVQRL  379 (380)
T ss_pred             ee-cCCCcccCCcchhHHhccchhhhhhhhc
Confidence            98 9999999999999999999999999997



>smart00553 SEP Domain present in Saccharomyces cerevisiae Shp1, Drosophila melanogaster eyes closed gene (eyc), and vertebrate p47 Back     alignment and domain information
>PF08059 SEP: SEP domain; InterPro: IPR012989 The SEP (after shp1, eyc and p47) domain is an eukaryotic domain, which occurs frequently and mainly in single units Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>PF12090 Spt20: Spt20 family; InterPro: IPR021950 This presumed domain is found in the Spt20 proteins from both human and yeast Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
1s3s_G127 Crystal Structure Of Aaa Atpase P97VCP ND1 IN COMPL 3e-18
1i42_A89 Nmr Structure Of The Ubx Domain From P47 Length = 8 5e-16
1ss6_A102 Solution Structure Of Sep Domain From Human P47 Len 6e-09
1vaz_A88 Solution Structures Of The P47 Sep Domain Length = 4e-06
>pdb|1S3S|G Chain G, Crystal Structure Of Aaa Atpase P97VCP ND1 IN COMPLEX WITH P47 C Length = 127 Back     alignment and structure

Iteration: 1

Score = 88.6 bits (218), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 46/125 (36%), Positives = 72/125 (57%) Query: 133 EPEKHHVPFQGVGRTLGSSSTAASEPTVDSTPVNTASSSSEGLVVDENLPSTSVQIRLAD 192 +P+ F G G+ LGS++ + + + +S ++++E P+T++QIRLAD Sbjct: 2 KPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQIRLAD 61 Query: 193 GTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSV 252 G RL+ FN H ISDI FI +RP A + M FP K LAD QT+++A L N+V Sbjct: 62 GGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAV 121 Query: 253 VIQKF 257 ++Q+ Sbjct: 122 IVQRL 126
>pdb|1I42|A Chain A, Nmr Structure Of The Ubx Domain From P47 Length = 89 Back     alignment and structure
>pdb|1SS6|A Chain A, Solution Structure Of Sep Domain From Human P47 Length = 102 Back     alignment and structure
>pdb|1VAZ|A Chain A, Solution Structures Of The P47 Sep Domain Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 2e-39
1ss6_A102 P47, NSFL1 cofactor P47, P47 protein, P97; , SEP, 5e-34
1vaz_A88 NSFL1 cofactor P47; beta-BETA-beta-alpha-alpha-bet 1e-24
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 3e-17
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 2e-16
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 2e-15
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Length = 127 Back     alignment and structure
 Score =  132 bits (333), Expect = 2e-39
 Identities = 46/125 (36%), Positives = 72/125 (57%)

Query: 133 EPEKHHVPFQGVGRTLGSSSTAASEPTVDSTPVNTASSSSEGLVVDENLPSTSVQIRLAD 192
           +P+     F G G+ LGS++      +  +      + +S  ++++E  P+T++QIRLAD
Sbjct: 2   KPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQIRLAD 61

Query: 193 GTRLIAHFNLHHTISDIHSFIDASRPGTARNYQLQMMGFPPKVLADRTQTIEQAGLANSV 252
           G RL+  FN  H ISDI  FI  +RP  A    + M  FP K LAD  QT+++A L N+V
Sbjct: 62  GGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAV 121

Query: 253 VIQKF 257
           ++Q+ 
Sbjct: 122 IVQRL 126


>1ss6_A P47, NSFL1 cofactor P47, P47 protein, P97; , SEP, signaling protein; NMR {Homo sapiens} SCOP: d.245.1.1 Length = 102 Back     alignment and structure
>1vaz_A NSFL1 cofactor P47; beta-BETA-beta-alpha-alpha-beta, novel fold, lipid binding protein; NMR {Rattus norvegicus} SCOP: d.245.1.1 Length = 88 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Length = 124 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Length = 109 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Length = 84 Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Length = 109 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
1ss6_A102 P47, NSFL1 cofactor P47, P47 protein, P97; , SEP, 100.0
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 99.98
1vaz_A88 NSFL1 cofactor P47; beta-BETA-beta-alpha-alpha-bet 99.96
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 99.82
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 99.8
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 99.8
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 99.75
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.86
2pjh_A80 Protein NPL4, nuclear protein localization protein 97.67
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 97.45
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 97.44
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 97.43
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 97.41
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 97.38
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 97.34
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 97.24
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 97.23
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 97.23
3v6c_B91 Ubiquitin; structural genomics, structural genomic 97.22
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 97.2
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 97.1
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 97.09
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 97.07
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 97.05
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 97.0
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 97.0
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 96.98
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 96.96
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 96.95
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 96.95
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 96.93
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 96.89
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 96.88
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 96.87
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 96.87
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 96.86
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 96.84
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 96.84
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 96.82
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 96.81
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 96.81
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 96.81
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 96.75
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 96.68
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 96.67
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 96.67
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 96.65
3m62_B106 UV excision repair protein RAD23; armadillo-like r 96.57
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 96.56
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 96.55
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 96.54
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 96.5
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 96.45
1we6_A111 Splicing factor, putative; structural genomics, ub 96.42
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 96.41
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 96.41
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 96.28
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 96.25
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 96.24
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 96.21
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 96.17
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 96.17
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 96.1
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 96.06
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 96.06
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 96.01
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 95.97
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 95.95
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 95.93
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 95.91
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 95.91
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 95.8
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 95.79
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 95.78
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 95.74
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 94.71
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 95.59
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 95.58
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 95.5
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 95.43
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 95.39
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 95.35
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 94.58
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 94.48
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 94.03
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 93.86
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 93.61
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 93.53
2kj6_A97 Tubulin folding cofactor B; methods development, N 93.37
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 93.23
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 93.08
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 92.97
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 92.8
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 92.55
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 92.47
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 92.43
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 92.33
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 92.3
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 91.52
2fnj_B118 Transcription elongation factor B polypeptide 2; b 90.86
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 89.92
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 89.04
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 88.79
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 87.45
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 85.25
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 84.91
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 82.38
4ajy_B118 Transcription elongation factor B polypeptide 2; E 81.18
>1ss6_A P47, NSFL1 cofactor P47, P47 protein, P97; , SEP, signaling protein; NMR {Homo sapiens} SCOP: d.245.1.1 Back     alignment and structure
Probab=100.00  E-value=1.9e-37  Score=242.04  Aligned_cols=92  Identities=32%  Similarity=0.612  Sum_probs=86.4

Q ss_pred             CCCCceEEEEEeccceeecCCCCccCCChhhHHHHHHHhcCCCCCcccCCCCCCceEEEEec-ccccCCCCCCCCccccc
Q 025134           65 QPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLIR-RDVKCPEPEKHHVPFQG  143 (257)
Q Consensus        65 ~~~~~~~~l~lw~nGF~VddGp~R~y~dP~n~~FL~~I~~G~~P~EL~~~~~~~~V~v~l~~-r~e~y~~p~~~~~~F~G  143 (257)
                      .++.+.|+||||+|||+|||||||+|+||+|++||++|++|+||.||+.++++++|+|+|++ ++|+|++|++++++|+|
T Consensus         8 ~~~~~~~~ltlw~nGFtVdDGplR~ydDP~N~~FL~~I~~G~~P~EL~~~~~~~~V~v~v~d~~~e~y~~p~~~~~~F~G   87 (102)
T 1ss6_A            8 SSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTG   87 (102)
T ss_dssp             CCSCEEEEEEEESSEEEETTSCEEETTCTTTHHHHHHHHHTCCCHHHHTTSCSSCEEEEEEEEETTCCCSSSSSSTTSCS
T ss_pred             CCCCceEEEEEecCceEecCCCcccCCCHhHHHHHHHHHhCCCCHHHhcccCCCeEEEEeeeccCccccCCCCcccCCcc
Confidence            34678999999999999999999999999999999999999999999999999999999995 59999999888999999


Q ss_pred             cccccccCCCCCC
Q 025134          144 VGRTLGSSSTAAS  156 (257)
Q Consensus       144 ~G~~LGs~~p~~~  156 (257)
                      +||+||+++|...
T Consensus        88 ~G~~LGs~~p~~~  100 (102)
T 1ss6_A           88 EGQKLGSTAPQVL  100 (102)
T ss_dssp             SSSSGGGCCSSSS
T ss_pred             cCeECCCCCCCCc
Confidence            9999999988764



>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>1vaz_A NSFL1 cofactor P47; beta-BETA-beta-alpha-alpha-beta, novel fold, lipid binding protein; NMR {Rattus norvegicus} SCOP: d.245.1.1 Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 257
d1ss6a_102 d.245.1.1 (A:) NSFL1 (p97 ATPase) cofactor p47, SE 3e-33
d1i42a_89 d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 8e-28
d1wj4a_124 d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human 9e-18
d1s3si_50 d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 3e-17
d1h8ca_82 d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human 8e-15
d2cr5a196 d.15.1.2 (A:8-103) UBX domain-containing protein 6 6e-14
>d1ss6a_ d.245.1.1 (A:) NSFL1 (p97 ATPase) cofactor p47, SEP domain {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: NSFL1 (p97 ATPase) cofactor p47, SEP domain
superfamily: NSFL1 (p97 ATPase) cofactor p47, SEP domain
family: NSFL1 (p97 ATPase) cofactor p47, SEP domain
domain: NSFL1 (p97 ATPase) cofactor p47, SEP domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  114 bits (287), Expect = 3e-33
 Identities = 33/102 (32%), Positives = 52/102 (50%), Gaps = 6/102 (5%)

Query: 63  PQQPEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHV 122
               + +   +  W +GF++++G LR   DP NA FLESI++ E P EL        V++
Sbjct: 6   QHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNL 65

Query: 123 NLI-RRDVKCPEPEKHHVPFQGVGRTLGSSSTAASEPTVDST 163
           ++   RD    +P+     F G G+ LGS++     P V ST
Sbjct: 66  DMEDHRDEDFVKPKGAFKAFTGEGQKLGSTA-----PQVLST 102


>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1s3si_ d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
d1ss6a_102 NSFL1 (p97 ATPase) cofactor p47, SEP domain {Human 100.0
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.92
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 99.79
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 99.75
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 99.69
d1s3si_50 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.63
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 97.77
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 97.37
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 97.29
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 97.26
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 97.24
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 97.23
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 97.14
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 97.14
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 97.13
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 97.12
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 97.04
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 97.0
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 96.96
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 96.95
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 96.93
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 96.85
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 96.84
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 96.69
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 96.66
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 96.6
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.59
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 96.55
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 96.54
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 96.47
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 96.33
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 96.27
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 96.26
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 96.05
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 96.02
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 95.95
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 95.45
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 95.27
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 95.2
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 94.39
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 91.94
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 89.79
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 89.37
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 88.95
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 88.42
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 86.28
>d1ss6a_ d.245.1.1 (A:) NSFL1 (p97 ATPase) cofactor p47, SEP domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: NSFL1 (p97 ATPase) cofactor p47, SEP domain
superfamily: NSFL1 (p97 ATPase) cofactor p47, SEP domain
family: NSFL1 (p97 ATPase) cofactor p47, SEP domain
domain: NSFL1 (p97 ATPase) cofactor p47, SEP domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.3e-38  Score=245.00  Aligned_cols=92  Identities=32%  Similarity=0.615  Sum_probs=86.8

Q ss_pred             CCCceEEEEEeccceeecCCCCccCCChhhHHHHHHHhcCCCCCcccCCCCCCceEEEEe-cccccCCCCCCCCcccccc
Q 025134           66 PEPIVHNIVFWANGFTVNDGPLRRLDDPENASFLESIKKSECPKELEPADKRSSVHVNLI-RRDVKCPEPEKHHVPFQGV  144 (257)
Q Consensus        66 ~~~~~~~l~lw~nGF~VddGp~R~y~dP~n~~FL~~I~~G~~P~EL~~~~~~~~V~v~l~-~r~e~y~~p~~~~~~F~G~  144 (257)
                      .++++|+||||+|||+|||||||+|+||+|++||++|++|+||.||++++++++|+|+|+ |++|+|.+|++++++|+|+
T Consensus         9 ~~~v~v~l~lw~nGFtVdDGplR~yddP~N~~FL~~I~~G~~P~EL~~~~~~~~V~v~v~D~~~e~y~~pk~~~~~F~G~   88 (102)
T d1ss6a_           9 SQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGE   88 (102)
T ss_dssp             CSCEEEEEEEESSEEEETTSCEEETTCTTTHHHHHHHHHTCCCHHHHTTSCSSCEEEEEEEEETTCCCSSSSSSTTSCSS
T ss_pred             CCcceEEEEEecCceEecCCCcccCCCHhHHHHHHHHHhccCCHHHhcccCCCeEeEEEEeccCCcccCCCCcccCcccc
Confidence            467899999999999999999999999999999999999999999999999999999999 5699999998889999999


Q ss_pred             ccccccCCCCCCC
Q 025134          145 GRTLGSSSTAASE  157 (257)
Q Consensus       145 G~~LGs~~p~~~~  157 (257)
                      |++|||++|..++
T Consensus        89 G~~LGSp~P~v~~  101 (102)
T d1ss6a_          89 GQKLGSTAPQVLS  101 (102)
T ss_dssp             SSSGGGCCSSSSC
T ss_pred             CccCCCCCCCccc
Confidence            9999999998753



>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3si_ d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure