Citrus Sinensis ID: 025169

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDLAEKKLDL
ccHHHHHHHHHHHHHccEEEEEccccccccccccHHHHHHHHHHcHHcccccEEEEEEEEEccccHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHcccccccccccccHHHHHHHHHccccEEEccccccccccccccccccHHHHHHccccEEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHHHHHHHHccccEEccccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHcccHHccccccccHHHHHHHHHccccEEEEccccEEEEccccHHHccHHHHHHcccEEEEEccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccc
MSKRSYMDAVVEGLRAVSAVdvdfasrsidvrrpvntknmndacngtrgKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVgidlsgnptkgewttFLPALKFAREQGLQITlhcgeipnkEEIQSMLDFLpqrighaccfEEEEWRklksskipveicltsnirtetissldihhfvdlykaqhplvlctddsgvfstsvSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDLAEKKLDL
MSKRSYMDAVVEGLRavsavdvdfasrsidvrrpvntknmndacngtrgkkIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEwrklksskipveICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIfangrvkeDLKEIfdlaekkldl
MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDLAEKKLDL
********AVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDL*******
MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDLAEKKLDL
********AVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDLAEKKLDL
MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDLAEKKLDL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIFDLAEKKLDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query257 2.2.26 [Sep-21-2011]
Q6DHV7355 Adenosine deaminase-like yes no 0.859 0.622 0.362 6e-42
Q0VC13351 Adenosine deaminase-like yes no 0.848 0.621 0.363 1e-41
Q295P6340 Adenosine deaminase-like yes no 0.747 0.564 0.456 4e-41
Q80SY6360 Adenosine deaminase-like yes no 0.883 0.630 0.358 3e-40
Q4V831347 Adenosine deaminase-like N/A no 0.848 0.628 0.380 3e-40
Q4V9P6348 Adenosine deaminase-like yes no 0.856 0.632 0.372 7e-40
Q9VHH7337 Adenosine deaminase-like yes no 0.727 0.554 0.431 1e-38
B8CV32331 Adenosine deaminase OS=Sh yes no 0.739 0.574 0.300 3e-19
Q8IG39388 Adenosine deaminase-like yes no 0.758 0.502 0.323 5e-19
Q98GV2324 Adenine deaminase OS=Rhiz yes no 0.739 0.586 0.300 3e-18
>sp|Q6DHV7|ADAL_HUMAN Adenosine deaminase-like protein OS=Homo sapiens GN=ADAL PE=2 SV=2 Back     alignment and function desciption
 Score =  171 bits (432), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 149/259 (57%), Gaps = 38/259 (14%)

Query: 1   MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSI 60
           M+K++Y+++++EG++     ++D                            I VR L+++
Sbjct: 116 MTKKTYVESILEGIKQSKQENLD----------------------------IDVRYLIAV 147

Query: 61  DRRETTEAAMETVKLALEM---RDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITL 117
           DRR     A ETVKLA E     +  V+G+DLSG+PT G+   FL  L  A++ GL++ L
Sbjct: 148 DRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKKAGLKLAL 207

Query: 118 HCGEIPN-KEEIQSMLDFLPQRIGHACCFEEEEWRKL------KSSKIPVEICLTSNIRT 170
           H  EIPN K+E Q +LD LP RIGH       E   L      +  +IP+E+CLTSN+++
Sbjct: 208 HLSEIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLELCLTSNVKS 267

Query: 171 ETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSA 230
           +T+ S D HHF   Y   HP V+CTDD GVF+T +S+EY LAA  F+L + +++ L+  +
Sbjct: 268 QTVPSYDQHHFGFWYSIAHPSVICTDDKGVFATHLSQEYQLAAETFNLTQSQVWDLSYES 327

Query: 231 VKFIFANGRVKEDLKEIFD 249
           + +IFA+   + +L++ ++
Sbjct: 328 INYIFASDSTRSELRKKWN 346
Putative nucleoside deaminase. May catalyze the hydrolytic deamination of adenosine or some similar substrate and play a role in purine metabolism.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 5EC: .EC: 4EC: .EC: -
>sp|Q0VC13|ADAL_BOVIN Adenosine deaminase-like protein OS=Bos taurus GN=ADAL PE=2 SV=1 Back     alignment and function description
>sp|Q295P6|ADAL_DROPS Adenosine deaminase-like protein OS=Drosophila pseudoobscura pseudoobscura GN=GA11319 PE=3 SV=2 Back     alignment and function description
>sp|Q80SY6|ADAL_MOUSE Adenosine deaminase-like protein OS=Mus musculus GN=Adal PE=2 SV=1 Back     alignment and function description
>sp|Q4V831|ADALA_XENLA Adenosine deaminase-like protein A OS=Xenopus laevis GN=adal-a PE=2 SV=1 Back     alignment and function description
>sp|Q4V9P6|ADAL_DANRE Adenosine deaminase-like protein OS=Danio rerio GN=adal PE=2 SV=1 Back     alignment and function description
>sp|Q9VHH7|ADAL_DROME Adenosine deaminase-like protein OS=Drosophila melanogaster GN=Ada PE=2 SV=1 Back     alignment and function description
>sp|B8CV32|ADD_SHEPW Adenosine deaminase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=add PE=3 SV=1 Back     alignment and function description
>sp|Q8IG39|ADAL_CAEEL Adenosine deaminase-like protein OS=Caenorhabditis elegans GN=C44B7.12 PE=3 SV=2 Back     alignment and function description
>sp|Q98GV2|ADE_RHILO Adenine deaminase OS=Rhizobium loti (strain MAFF303099) GN=mll3163 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
224142856 363 predicted protein [Populus trichocarpa] 1.0 0.707 0.743 1e-112
255554947 364 Adenosine deaminase, putative [Ricinus c 1.0 0.706 0.748 1e-111
449479433 363 PREDICTED: LOW QUALITY PROTEIN: adenosin 0.968 0.685 0.690 1e-103
449433942 363 PREDICTED: adenosine deaminase-like prot 0.968 0.685 0.690 1e-103
359483383 359 PREDICTED: adenosine deaminase-like prot 0.968 0.693 0.696 1e-101
147833191355 hypothetical protein VITISV_030807 [Viti 0.968 0.701 0.696 1e-101
357480235 376 Adenosine deaminase-like protein [Medica 0.992 0.678 0.687 1e-100
357480237 375 Adenosine deaminase-like protein [Medica 0.992 0.68 0.687 1e-100
388499048 365 unknown [Lotus japonicus] 0.988 0.695 0.667 1e-99
356521975 363 PREDICTED: adenosine deaminase-like prot 0.988 0.699 0.670 3e-98
>gi|224142856|ref|XP_002335976.1| predicted protein [Populus trichocarpa] gi|222836542|gb|EEE74949.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/257 (74%), Positives = 224/257 (87%)

Query: 1   MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSI 60
           MSK SYM+AVVEGLRAV+AVD+DF     + +  +N+  MNDAC+GT+ KKIYVRLLLSI
Sbjct: 107 MSKHSYMEAVVEGLRAVTAVDIDFVPHKFNTQDSLNSIAMNDACDGTKKKKIYVRLLLSI 166

Query: 61  DRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCG 120
           DRRETTEAA+ETVKLALEMRDLGVVGIDLSGNP  GEW TFLPALKFA+EQGL ITLHCG
Sbjct: 167 DRRETTEAAIETVKLALEMRDLGVVGIDLSGNPVVGEWNTFLPALKFAQEQGLYITLHCG 226

Query: 121 EIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHH 180
           E+ N +E+Q MLDFLPQRIGHA  FEEEEWR+LK+SKIPVEICLTSNI+TE+ISS+DIHH
Sbjct: 227 EVLNCQEVQPMLDFLPQRIGHAIFFEEEEWRQLKTSKIPVEICLTSNIKTESISSIDIHH 286

Query: 181 FVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRV 240
           FVDLY A+HPLVLCTDD+GVFSTS+S EY LA++AF LG++EMF+LA++ ++FIFA   V
Sbjct: 287 FVDLYNAKHPLVLCTDDAGVFSTSLSNEYKLASTAFGLGKKEMFELARTGIEFIFAGDEV 346

Query: 241 KEDLKEIFDLAEKKLDL 257
           K+DL E FD A KKL+L
Sbjct: 347 KQDLVETFDSAAKKLNL 363

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255554947|ref|XP_002518511.1| Adenosine deaminase, putative [Ricinus communis] gi|223542356|gb|EEF43898.1| Adenosine deaminase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449479433|ref|XP_004155598.1| PREDICTED: LOW QUALITY PROTEIN: adenosine deaminase-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449433942|ref|XP_004134755.1| PREDICTED: adenosine deaminase-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359483383|ref|XP_002265831.2| PREDICTED: adenosine deaminase-like protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833191|emb|CAN68640.1| hypothetical protein VITISV_030807 [Vitis vinifera] gi|302144084|emb|CBI23189.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357480235|ref|XP_003610403.1| Adenosine deaminase-like protein [Medicago truncatula] gi|355511458|gb|AES92600.1| Adenosine deaminase-like protein [Medicago truncatula] gi|388499194|gb|AFK37663.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357480237|ref|XP_003610404.1| Adenosine deaminase-like protein [Medicago truncatula] gi|355511459|gb|AES92601.1| Adenosine deaminase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388499048|gb|AFK37590.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356521975|ref|XP_003529625.1| PREDICTED: adenosine deaminase-like protein-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
TAIR|locus:2138967355 AT4G04880 "AT4G04880" [Arabido 0.949 0.687 0.645 1.5e-83
UNIPROTKB|Q8H3U7368 P0496C02.124 "Os07g0661000 pro 0.972 0.679 0.593 1.8e-78
UNIPROTKB|A8J7C2461 CHLREDRAFT_175699 "Predicted p 0.782 0.436 0.517 3.7e-54
UNIPROTKB|E2RSY5356 ADAL "Uncharacterized protein" 0.754 0.544 0.446 3.2e-43
UNIPROTKB|F1LRK5360 LOC311352 "Protein LOC311352" 0.793 0.566 0.425 1.8e-42
UNIPROTKB|Q6DHV7355 ADAL "Adenosine deaminase-like 0.758 0.549 0.434 7.5e-42
UNIPROTKB|F1N1T1351 ADAL "Adenosine deaminase-like 0.758 0.555 0.419 2.5e-41
UNIPROTKB|Q0VC13351 ADAL "Adenosine deaminase-like 0.758 0.555 0.419 2.5e-41
MGI|MGI:1923144360 Adal "adenosine deaminase-like 0.793 0.566 0.415 4.6e-40
ZFIN|ZDB-GENE-050913-145348 adal "adenosine deaminase-like 0.793 0.586 0.425 5.8e-40
TAIR|locus:2138967 AT4G04880 "AT4G04880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 837 (299.7 bits), Expect = 1.5e-83, P = 1.5e-83
 Identities = 162/251 (64%), Positives = 202/251 (80%)

Query:     1 MSKRSYMDAVVEGLRAVSAVDVDFASRSIDVRRPVNTKNMNDACNGTRGKKIYVRLLLSI 60
             MSKRSYM+AV++GLR+VS VD+DF + S       +++ +++A +G   KKIYVRLLLSI
Sbjct:   107 MSKRSYMEAVIQGLRSVSEVDIDFVTAS-------DSQKLHNAGDGIGRKKIYVRLLLSI 159

Query:    61 DRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCG 120
             DRRETTE+AMETVKLALEMRD+GVVGIDLSGNP  GEW+TFLPAL++A++  L ITLHCG
Sbjct:   160 DRRETTESAMETVKLALEMRDVGVVGIDLSGNPLVGEWSTFLPALQYAKDNDLHITLHCG 219

Query:   121 EIPNKEEIQSMLDFLPQRIGHACCFEEEEWRKLKSSKIPVEICLTSNIRTETISSLDIHH 180
             E+PN +EIQ+MLDF P RIGHAC F++E+W KLKS +IPVEICLTSNI T++ISS+DIHH
Sbjct:   220 EVPNPKEIQAMLDFKPHRIGHACFFKDEDWTKLKSFRIPVEICLTSNIVTKSISSIDIHH 279

Query:   181 FVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRV 240
             F DLY A+HPL+LCTDD GVFSTS+S EY LA  +  L + E F LA++A+   FA   V
Sbjct:   280 FADLYNAKHPLILCTDDFGVFSTSLSNEYALAVRSLGLSKSETFALARAAIDATFAEDEV 339

Query:   241 KEDLKEIFDLA 251
             K+ L+ IFD A
Sbjct:   340 KQQLRFIFDSA 350
GO:0004000 "adenosine deaminase activity" evidence=IBA
GO:0005737 "cytoplasm" evidence=IBA
GO:0006154 "adenosine catabolic process" evidence=IBA
GO:0009168 "purine ribonucleoside monophosphate biosynthetic process" evidence=IEA;ISS
GO:0019239 "deaminase activity" evidence=IEA;ISS
UNIPROTKB|Q8H3U7 P0496C02.124 "Os07g0661000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8J7C2 CHLREDRAFT_175699 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSY5 ADAL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRK5 LOC311352 "Protein LOC311352" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DHV7 ADAL "Adenosine deaminase-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1T1 ADAL "Adenosine deaminase-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VC13 ADAL "Adenosine deaminase-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1923144 Adal "adenosine deaminase-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-145 adal "adenosine deaminase-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.40.691
3rd Layer3.5.4.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_5350002
hypothetical protein (364 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0022041801
SubName- Full=Putative uncharacterized protein; (342 aa)
     •  0.899
grail3.0006001701
hypothetical protein (247 aa)
     •  0.899
eugene3.00440120
hypothetical protein (390 aa)
     •  0.899
estExt_fgenesh4_pm.C_970013
SubName- Full=Putative uncharacterized protein; (386 aa)
     •  0.899
estExt_Genewise1_v1.C_LG_VIII1052
SubName- Full=Putative uncharacterized protein; (341 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
cd00443305 cd00443, ADA_AMPD, Adenosine/AMP deaminase 9e-59
cd01320325 cd01320, ADA, Adenosine deaminase (ADA) is a monom 2e-39
PRK09358340 PRK09358, PRK09358, adenosine deaminase; Provision 5e-36
TIGR01430324 TIGR01430, aden_deam, adenosine deaminase 2e-35
COG1816345 COG1816, Add, Adenosine deaminase [Nucleotide tran 4e-31
pfam00962328 pfam00962, A_deaminase, Adenosine/AMP deaminase 9e-27
PTZ00124362 PTZ00124, PTZ00124, adenosine deaminase; Provision 2e-15
cd01292275 cd01292, metallo-dependent_hydrolases, Superfamily 5e-13
cd01321345 cd01321, ADGF, Adenosine deaminase-related growth 6e-09
TIGR01431479 TIGR01431, adm_rel, adenosine deaminase-related gr 5e-04
cd01303429 cd01303, GDEase, Guanine deaminase (GDEase) 0.001
>gnl|CDD|238250 cd00443, ADA_AMPD, Adenosine/AMP deaminase Back     alignment and domain information 
 Score =  188 bits (479), Expect = 9e-59
 Identities = 83/205 (40%), Positives = 114/205 (55%), Gaps = 10/205 (4%)

Query: 51  KIYVRLLLSIDRRET----TEAAMETVKLALEMRDLGVVGIDLSGNPTKGE--WTTFLPA 104
            I VRL+LS+DRR         A E ++LA  + +  VVGIDL G+ +KGE     F   
Sbjct: 100 PIKVRLILSVDRRGPYVQNYLVASEILELAKFLSN-YVVGIDLVGDESKGENPLRDFYSY 158

Query: 105 LKFAREQG-LQITLHCGEIPNKEEIQSMLDFLPQRIGHACC--FEEEEWRKLKSSKIPVE 161
            ++AR  G L +TLHCGE  N+EE+   L  LP RIGH        E    +K   IP+E
Sbjct: 159 YEYARRLGLLGLTLHCGETGNREELLQALLLLPDRIGHGIFLLKHPELIYLVKLRNIPIE 218

Query: 162 ICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRR 221
           +C TSN+   T+ S + H F+  +KA  P+ L TDD G+F TS+S EY LAA  F L   
Sbjct: 219 VCPTSNVVLGTVQSYEKHPFMRFFKAGLPVSLSTDDPGIFGTSLSEEYSLAAKTFGLTFE 278

Query: 222 EMFQLAKSAVKFIFANGRVKEDLKE 246
           ++ +L +++V   FA    K+ L E
Sbjct: 279 DLCELNRNSVLSSFAKDEEKKSLLE 303

Adenosine deaminases (ADAs) are present in pro- and eukaryotic organisms and catalyze the zinc dependent irreversible deamination of adenosine nucleosides to inosine nucleosides and ammonia. The eukaryotic AMP deaminase catalyzes a similar reaction leading to the hydrolytic removal of an amino group at the 6 position of the adenine nucleotide ring, a branch point in the adenylate catabolic pathway. Length = 305
>gnl|CDD|238645 cd01320, ADA, Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>gnl|CDD|236480 PRK09358, PRK09358, adenosine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|233410 TIGR01430, aden_deam, adenosine deaminase Back     alignment and domain information
>gnl|CDD|224729 COG1816, Add, Adenosine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|216216 pfam00962, A_deaminase, Adenosine/AMP deaminase Back     alignment and domain information
>gnl|CDD|173415 PTZ00124, PTZ00124, adenosine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|238617 cd01292, metallo-dependent_hydrolases, Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>gnl|CDD|238646 cd01321, ADGF, Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information
>gnl|CDD|233411 TIGR01431, adm_rel, adenosine deaminase-related growth factor Back     alignment and domain information
>gnl|CDD|238628 cd01303, GDEase, Guanine deaminase (GDEase) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 257
cd01321345 ADGF Adenosine deaminase-related growth factors (A 100.0
PTZ00124362 adenosine deaminase; Provisional 100.0
PF00962331 A_deaminase: Adenosine/AMP deaminase immunodeficie 100.0
COG1816345 Add Adenosine deaminase [Nucleotide transport and 100.0
cd00443305 ADA_AMPD Adenosine/AMP deaminase. Adenosine deamin 100.0
PRK09358340 adenosine deaminase; Provisional 100.0
KOG1097399 consensus Adenine deaminase/adenosine deaminase [N 100.0
TIGR01431479 adm_rel adenosine deaminase-related growth factor. 100.0
TIGR01430324 aden_deam adenosine deaminase. This family include 100.0
cd01320325 ADA Adenosine deaminase (ADA) is a monomeric zinc 100.0
cd01319496 AMPD AMP deaminase (AMPD) catalyzes the hydrolytic 99.95
PLN03055602 AMP deaminase; Provisional 99.94
TIGR01429611 AMP_deaminase AMP deaminase. This model describes 99.94
PLN02768835 AMP deaminase 99.93
PRK07213375 chlorohydrolase; Provisional 99.92
cd01312381 Met_dep_hydrolase_D Metallo-dependent hydrolases, 99.91
TIGR03314441 Se_ssnA putative selenium metabolism protein SsnA. 99.91
TIGR01224377 hutI imidazolonepropionase. This enzyme catalyzes 99.91
cd01305263 archeal_chlorohydrolases Predicted chlorohydrolase 99.91
PTZ00310 1453 AMP deaminase; Provisional 99.9
PRK07203442 putative chlorohydrolase/aminohydrolase; Validated 99.9
PRK09228433 guanine deaminase; Provisional 99.89
PRK15493435 5-methylthioadenosine/S-adenosylhomocysteine deami 99.89
PRK08418408 chlorohydrolase; Provisional 99.89
PRK06687419 chlorohydrolase; Validated 99.89
PTZ00310 1453 AMP deaminase; Provisional 99.89
cd01303429 GDEase Guanine deaminase (GDEase). Guanine deamina 99.88
cd01296371 Imidazolone-5PH Imidazolonepropionase/imidazolone- 99.88
PRK08393424 N-ethylammeline chlorohydrolase; Provisional 99.88
cd01313418 Met_dep_hydrolase_E Metallo-dependent hydrolases, 99.88
TIGR02967401 guan_deamin guanine deaminase. This model describe 99.87
PRK09230426 cytosine deaminase; Provisional 99.87
PRK12393457 amidohydrolase; Provisional 99.87
PRK09229456 N-formimino-L-glutamate deiminase; Validated 99.87
TIGR02022455 hutF formiminoglutamate deiminase. In some species 99.87
PRK06380418 metal-dependent hydrolase; Provisional 99.86
PRK08203451 hydroxydechloroatrazine ethylaminohydrolase; Revie 99.86
PRK06038430 N-ethylammeline chlorohydrolase; Provisional 99.85
COG0402421 SsnA Cytosine deaminase and related metal-dependen 99.85
PRK09045443 N-ethylammeline chlorohydrolase; Provisional 99.84
PRK08204449 hypothetical protein; Provisional 99.84
cd01292275 metallo-dependent_hydrolases Superfamily of metall 99.81
PRK06886329 hypothetical protein; Validated 99.8
cd01298411 ATZ_TRZ_like TRZ/ATZ family contains enzymes from 99.79
PRK07228445 N-ethylammeline chlorohydrolase; Provisional 99.78
cd01293398 Bact_CD Bacterial cytosine deaminase and related m 99.77
PRK06151488 N-ethylammeline chlorohydrolase; Provisional 99.75
PRK14085382 imidazolonepropionase; Provisional 99.74
PRK09356406 imidazolonepropionase; Validated 99.74
KOG3968439 consensus Atrazine chlorohydrolase/guanine deamina 99.72
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 99.72
PRK07572426 cytosine deaminase; Validated 99.68
PRK07583438 cytosine deaminase-like protein; Validated 99.57
PRK05985391 cytosine deaminase; Provisional 99.53
KOG1096768 consensus Adenosine monophosphate deaminase [Nucle 99.51
COG1228406 HutI Imidazolonepropionase and related amidohydrol 99.5
cd01300479 YtcJ_like YtcJ_like metal dependent amidohydrolase 99.48
PRK06846410 putative deaminase; Validated 99.36
PRK12394379 putative metallo-dependent hydrolase; Provisional 99.27
cd01306325 PhnM PhnM is believed to be a subunit of the membr 99.13
cd01309359 Met_dep_hydrolase_C Metallo-dependent hydrolases, 99.11
PF01979333 Amidohydro_1: Amidohydrolase family; InterPro: IPR 99.05
PRK15446383 phosphonate metabolism protein PhnM; Provisional 99.04
COG1574535 Predicted metal-dependent hydrolase with the TIM-b 98.96
PLN02942486 dihydropyrimidinase 98.95
TIGR02033454 D-hydantoinase D-hydantoinase. This model represen 98.86
cd01314447 D-HYD D-hydantoinases (D-HYD) also called dihydrop 98.85
TIGR01975389 isoAsp_dipep isoaspartyl dipeptidase IadA. The L-i 98.82
PRK10657388 isoaspartyl dipeptidase; Provisional 98.78
TIGR02318376 phosphono_phnM phosphonate metabolism protein PhnM 98.67
PF07969404 Amidohydro_3: Amidohydrolase family; InterPro: IPR 98.64
PRK09357423 pyrC dihydroorotase; Validated 98.63
PRK08323459 phenylhydantoinase; Validated 98.56
TIGR00010252 hydrolase, TatD family. Several genomes have multi 98.47
cd01307338 Met_dep_hydrolase_B Metallo-dependent hydrolases, 98.3
cd00530293 PTE Phosphotriesterase (PTE) catalyzes the hydroly 98.3
cd01297415 D-aminoacylase D-aminoacylases (N-acyl-D-Amino aci 98.29
PRK09237380 dihydroorotase; Provisional 98.28
cd01295 422 AdeC Adenine deaminase (AdeC) directly deaminates 98.28
cd01310251 TatD_DNAse TatD like proteins; E.coli TatD is a cy 98.12
COG1099254 Predicted metal-dependent hydrolases with the TIM- 98.09
TIGR01178 552 ade adenine deaminase. The family described by thi 97.98
cd00854374 NagA N-acetylglucosamine-6-phosphate deacetylase, 97.96
PRK09236444 dihydroorotase; Reviewed 97.93
PRK13207 568 ureC urease subunit alpha; Reviewed 97.92
cd01317374 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; 97.91
PRK10812265 putative DNAse; Provisional 97.64
PRK07575438 dihydroorotase; Provisional 97.51
TIGR00857411 pyrC_multi dihydroorotase, multifunctional complex 97.47
PRK13309 572 ureC urease subunit alpha; Reviewed 97.42
TIGR01792 567 urease_alph urease, alpha subunit. This model desc 97.42
PRK09875292 putative hydrolase; Provisional 97.38
PRK06361212 hypothetical protein; Provisional 97.35
COG3964386 Predicted amidohydrolase [General function predict 97.35
PRK06189451 allantoinase; Provisional 97.32
PRK13206 573 ureC urease subunit alpha; Reviewed 97.3
cd01308387 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hy 97.3
PRK10425258 DNase TatD; Provisional 97.16
PF13147304 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2 97.15
PRK11449258 putative deoxyribonuclease YjjV; Provisional 97.1
cd01302337 Cyclic_amidohydrolases Cyclic amidohydrolases, inc 97.07
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 97.05
PRK08392215 hypothetical protein; Provisional 97.0
cd01315447 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinas 96.92
cd00375 567 Urease_alpha Urease alpha-subunit; Urease is a nic 96.81
PRK13985 568 ureB urease subunit beta; Provisional 96.81
PF01026255 TatD_DNase: TatD related DNase The Pfam entry find 96.77
TIGR03178443 allantoinase allantoinase. This enzyme carries out 96.76
TIGR03583365 EF_0837 probable amidohydrolase EF_0837/AHA_3915. 96.63
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 96.47
PRK08044449 allantoinase; Provisional 96.35
PRK13308 569 ureC urease subunit alpha; Reviewed 96.26
PLN02303 837 urease 96.25
PRK09061 509 D-glutamate deacylase; Validated 96.17
TIGR01496257 DHPS dihydropteroate synthase. This model represen 96.11
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 96.03
PRK07945335 hypothetical protein; Provisional 95.8
PLN02795505 allantoinase 95.62
PRK07328269 histidinol-phosphatase; Provisional 95.53
PRK00912237 ribonuclease P protein component 3; Provisional 95.46
PRK05588255 histidinol-phosphatase; Provisional 95.41
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 95.38
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 95.26
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 95.22
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 94.78
COG1001 584 AdeC Adenine deaminase [Nucleotide transport and m 94.72
PRK08609570 hypothetical protein; Provisional 94.64
PRK07627425 dihydroorotase; Provisional 94.53
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 94.52
PRK02382443 dihydroorotase; Provisional 94.44
PRK09059429 dihydroorotase; Validated 94.34
COG1735316 Php Predicted metal-dependent hydrolase with the T 94.31
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 94.25
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 94.21
PRK13404477 dihydropyrimidinase; Provisional 94.21
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.19
cd01294335 DHOase Dihydroorotase (DHOase) catalyzes the rever 94.1
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 94.1
PF02126308 PTE: Phosphotriesterase family; InterPro: IPR00155 93.87
COG0191286 Fba Fructose/tagatose bisphosphate aldolase [Carbo 93.85
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 93.72
PF04909273 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 93.67
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 93.61
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 93.59
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 93.58
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 93.54
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 93.4
PRK11858378 aksA trans-homoaconitate synthase; Reviewed 93.21
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 93.16
COG2159293 Predicted metal-dependent hydrolase of the TIM-bar 93.14
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 93.05
PRK09060444 dihydroorotase; Validated 92.89
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 92.66
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 92.61
PLN02746347 hydroxymethylglutaryl-CoA lyase 92.58
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 92.51
PRK12330 499 oxaloacetate decarboxylase; Provisional 92.49
PRK12331448 oxaloacetate decarboxylase; Provisional 92.17
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 92.15
PRK12581 468 oxaloacetate decarboxylase; Provisional 92.02
TIGR02090363 LEU1_arch isopropylmalate/citramalate/homocitrate 91.98
PF00682237 HMGL-like: HMGL-like of this family is not conserv 91.74
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 91.49
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 91.37
cd01301309 rDP_like renal dipeptidase (rDP), best studied in 91.36
PRK06801286 hypothetical protein; Provisional 91.1
PRK09248246 putative hydrolase; Validated 91.07
PRK08185283 hypothetical protein; Provisional 91.06
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 91.04
COG0826 347 Collagenase and related proteases [Posttranslation 90.99
PRK14042 596 pyruvate carboxylase subunit B; Provisional 90.88
PRK15108345 biotin synthase; Provisional 90.81
TIGR00284 499 dihydropteroate synthase-related protein. This pro 90.78
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.74
PRK10027 588 cryptic adenine deaminase; Provisional 90.72
PRK08610286 fructose-bisphosphate aldolase; Reviewed 90.6
PRK08417386 dihydroorotase; Provisional 89.89
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 89.84
COG1387237 HIS2 Histidinol phosphatase and related hydrolases 89.73
PRK09389 488 (R)-citramalate synthase; Provisional 89.69
TIGR00856341 pyrC_dimer dihydroorotase, homodimeric type. This 89.67
PRK07709285 fructose-bisphosphate aldolase; Provisional 89.66
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 89.52
cd01318361 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; 89.42
PRK00915 513 2-isopropylmalate synthase; Validated 89.31
PF01244320 Peptidase_M19: Membrane dipeptidase (Peptidase fam 89.02
COG1820380 NagA N-acetylglucosamine-6-phosphate deacetylase [ 88.98
COG1831285 Predicted metal-dependent hydrolase (urease superf 88.95
TIGR00221380 nagA N-acetylglucosamine-6-phosphate deacetylase. 88.84
PRK03892216 ribonuclease P protein component 3; Provisional 88.5
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.49
PRK14041 467 oxaloacetate decarboxylase; Provisional 88.44
PRK09282 592 pyruvate carboxylase subunit B; Validated 88.41
PRK07369418 dihydroorotase; Provisional 88.33
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 88.13
PRK14040 593 oxaloacetate decarboxylase; Provisional 88.11
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 88.08
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 88.03
PRK07329246 hypothetical protein; Provisional 87.93
COG3454377 Metal-dependent hydrolase involved in phosphonate 87.49
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 86.9
PRK08123270 histidinol-phosphatase; Reviewed 86.68
TIGR01856253 hisJ_fam histidinol phosphate phosphatase HisJ fam 86.55
PLN03228503 methylthioalkylmalate synthase; Provisional 86.43
PRK06740331 histidinol-phosphatase; Validated 86.2
PRK11572248 copper homeostasis protein CutC; Provisional 86.06
COG2355313 Zn-dependent dipeptidase, microsomal dipeptidase h 86.05
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 85.95
TIGR00973 494 leuA_bact 2-isopropylmalate synthase, bacterial ty 84.53
PRK05451345 dihydroorotase; Provisional 84.34
PF04551359 GcpE: GcpE protein; InterPro: IPR004588 This prote 84.17
PRK12999 1146 pyruvate carboxylase; Reviewed 84.08
PF13918177 PLDc_3: PLD-like domain 83.78
PRK06806281 fructose-bisphosphate aldolase; Provisional 83.77
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 83.59
PRK00208250 thiG thiazole synthase; Reviewed 83.54
PLN02321 632 2-isopropylmalate synthase 83.06
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 82.18
PRK07315293 fructose-bisphosphate aldolase; Provisional 81.96
PRK06256336 biotin synthase; Validated 81.88
PF05913 357 DUF871: Bacterial protein of unknown function (DUF 81.77
PLN02599364 dihydroorotase 81.63
PRK05835307 fructose-bisphosphate aldolase; Provisional 81.1
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 80.78
PRK04165 450 acetyl-CoA decarbonylase/synthase complex subunit 80.57
PRK11449258 putative deoxyribonuclease YjjV; Provisional 80.41
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 80.4
COG0084256 TatD Mg-dependent DNase [DNA replication, recombin 80.3
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 80.16
PRK11613282 folP dihydropteroate synthase; Provisional 80.14
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 80.12
>cd01321 ADGF Adenosine deaminase-related growth factors (ADGF), a novel family of secreted growth-factors with sequence similarty to adenosine deaminase Back     alignment and domain information 
Probab=100.00  E-value=2.3e-50  Score=364.61  Aligned_cols=235  Identities=21%  Similarity=0.302  Sum_probs=213.0

Q ss_pred             ccceeeeeccCcc---ccccCCCchhhhhhHh---h-cccCC--CcEEEEEEEeeCCCCHHHHHHHHHHHHhhC---CCc
Q 025169           16 AVSAVDVDFASRS---IDVRRPVNTKNMNDAC---N-GTRGK--KIYVRLLLSIDRRETTEAAMETVKLALEMR---DLG   83 (257)
Q Consensus        16 ~v~y~E~r~~p~~---~~~~~~~~~~~~~~~~---~-a~~~~--gir~~li~~~~r~~~~e~~~~~~~~~~~~~---~~~   83 (257)
                      ||+|+|+||+|..   ++.+|++.+++++++.   + +.+..  ||.+++|+|++|+.+++.+.+.++.+.+++   .+.
T Consensus        83 gV~Y~Eir~~P~~~~~~~~~g~~~~~v~~av~~~~~~~~~~~~~~i~v~lI~~~~R~~~~e~~~e~~~~a~~~~~~~~~~  162 (345)
T cd01321          83 NVQYVELRSSFSPLYDLDGREYDYEETVQLLEEVVEKFKKTHPDFIGLKIIYATLRNFNDSEIKESMEQCLNLKKKFPDF  162 (345)
T ss_pred             CCEEEEEeecchHHHHccCCCCCHHHHHHHHHHHHHHHHHhCCCCceEEEEEEecCCCCHHHHHHHHHHHHHHHHhCCCe
Confidence            6999999999954   4458899999887766   2 22233  899999999999999999999999998874   235


Q ss_pred             eEEEeccCCCC-CCChhcHHHHHHHHHHcC--CceeeecCCCCC-----HhhHHHHHhcCCcEEeecccc--cHHHHHHH
Q 025169           84 VVGIDLSGNPT-KGEWTTFLPALKFAREQG--LQITLHCGEIPN-----KEEIQSMLDFLPQRIGHACCF--EEEEWRKL  153 (257)
Q Consensus        84 vvg~~l~g~~~-~~~~~~~~~~~~~A~~~g--l~v~~Ha~E~~~-----~~~i~~~l~lg~~ri~Hg~~l--~~~~~~~l  153 (257)
                      |+|+|++|+|. ..++..|.++|+.||+.|  +++|+||||..+     +.++++++.+|++|||||+.+  +|++++++
T Consensus       163 VvGidL~G~E~~~~~~~~f~~~f~~ar~~g~~l~~t~HAGE~~~~~~~~~~~v~~al~lg~~RIGHG~~~~~dp~ll~~l  242 (345)
T cd01321         163 IAGFDLVGQEDAGRPLLDFLPQLLWFPKQCAEIPFFFHAGETNGDGTETDENLVDALLLNTKRIGHGFALPKHPLLMDLV  242 (345)
T ss_pred             EEEEecCCCccCCCCHHHHHHHHHHHHHhCCCCceEeecCCCcCCCCCChhHHHHHHHhCCCcCccccccCcCHHHHHHH
Confidence            99999999984 668899999999999999  999999999974     457888998999999999998  69999999


Q ss_pred             hcCCCcEEecccccceeccccCCCcccHHHHHhcCCCEEecCCCCCCCCC-ChHHHHHHHHHhCC---CCHHHHHHHHHH
Q 025169          154 KSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFST-SVSREYDLAASAFS---LGRREMFQLAKS  229 (257)
Q Consensus       154 ~~~~i~v~~cP~SN~~l~~~~~~~~~pi~~l~~~Gv~v~lgTD~~~~~~~-~l~~E~~~a~~~~~---ls~~~v~~~~~n  229 (257)
                      ++++|++++||+||..++.++++..||++.|+++||+|+||||||+.|++ ++++||+.+...+|   ++.+++.++++|
T Consensus       243 ~~~~I~lEvCPtSN~~~~~v~~~~~HPl~~ll~~Gv~vtinTDDp~~f~t~~l~~Ey~~~~~~~g~~~l~~~~l~~l~~n  322 (345)
T cd01321         243 KKKNIAIEVCPISNQVLGLVSDLRNHPAAALLARGVPVVISSDDPGFWGAKGLSHDFYQAFMGLAPADAGLRGLKQLAEN  322 (345)
T ss_pred             HHcCCeEEECcchhhhhccccchhhChHHHHHHCCCeEEEeCCCcchhCCCCchHHHHHHHHHhccCCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999 99999999999999   999999999999


Q ss_pred             HHHHcCCChHHHHHHHHHHHH
Q 025169          230 AVKFIFANGRVKEDLKEIFDL  250 (257)
Q Consensus       230 ~~~~~~~~~~~k~~l~~~~~~  250 (257)
                      |+++||+++++|++|+++|++
T Consensus       323 si~~sF~~~~~K~~l~~~~~~  343 (345)
T cd01321         323 SIRYSALSDQEKDEAVAKWEK  343 (345)
T ss_pred             HHHHHCCCHHHHHHHHHHHHh
Confidence            999999999999999999864

>PTZ00124 adenosine deaminase; Provisional Back     alignment and domain information
>PF00962 A_deaminase: Adenosine/AMP deaminase immunodeficiency disease (SCID); InterPro: IPR001365 Adenosine deaminase (3 Back     alignment and domain information
>COG1816 Add Adenosine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00443 ADA_AMPD Adenosine/AMP deaminase Back     alignment and domain information
>PRK09358 adenosine deaminase; Provisional Back     alignment and domain information
>KOG1097 consensus Adenine deaminase/adenosine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01431 adm_rel adenosine deaminase-related growth factor Back     alignment and domain information
>TIGR01430 aden_deam adenosine deaminase Back     alignment and domain information
>cd01320 ADA Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively Back     alignment and domain information
>cd01319 AMPD AMP deaminase (AMPD) catalyzes the hydrolytic deamination of adensosine monophosphate (AMP) at position 6 of the adenine nucleotide ring Back     alignment and domain information
>PLN03055 AMP deaminase; Provisional Back     alignment and domain information
>TIGR01429 AMP_deaminase AMP deaminase Back     alignment and domain information
>PLN02768 AMP deaminase Back     alignment and domain information
>PRK07213 chlorohydrolase; Provisional Back     alignment and domain information
>cd01312 Met_dep_hydrolase_D Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>TIGR03314 Se_ssnA putative selenium metabolism protein SsnA Back     alignment and domain information
>TIGR01224 hutI imidazolonepropionase Back     alignment and domain information
>cd01305 archeal_chlorohydrolases Predicted chlorohydrolases Back     alignment and domain information
>PTZ00310 AMP deaminase; Provisional Back     alignment and domain information
>PRK07203 putative chlorohydrolase/aminohydrolase; Validated Back     alignment and domain information
>PRK09228 guanine deaminase; Provisional Back     alignment and domain information
>PRK15493 5-methylthioadenosine/S-adenosylhomocysteine deaminase; Provisional Back     alignment and domain information
>PRK08418 chlorohydrolase; Provisional Back     alignment and domain information
>PRK06687 chlorohydrolase; Validated Back     alignment and domain information
>PTZ00310 AMP deaminase; Provisional Back     alignment and domain information
>cd01303 GDEase Guanine deaminase (GDEase) Back     alignment and domain information
>cd01296 Imidazolone-5PH Imidazolonepropionase/imidazolone-5-propionate hydrolase (Imidazolone-5PH) catalyzes the third step in the histidine degradation pathway, the hydrolysis of (S)-3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate to N-formimidoyl-L-glutamate Back     alignment and domain information
>PRK08393 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01313 Met_dep_hydrolase_E Metallo-dependent hydrolases, subgroup D is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>TIGR02967 guan_deamin guanine deaminase Back     alignment and domain information
>PRK09230 cytosine deaminase; Provisional Back     alignment and domain information
>PRK12393 amidohydrolase; Provisional Back     alignment and domain information
>PRK09229 N-formimino-L-glutamate deiminase; Validated Back     alignment and domain information
>TIGR02022 hutF formiminoglutamate deiminase Back     alignment and domain information
>PRK06380 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK08203 hydroxydechloroatrazine ethylaminohydrolase; Reviewed Back     alignment and domain information
>PRK06038 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>COG0402 SsnA Cytosine deaminase and related metal-dependent hydrolases [Nucleotide transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09045 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK08204 hypothetical protein; Provisional Back     alignment and domain information
>cd01292 metallo-dependent_hydrolases Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK06886 hypothetical protein; Validated Back     alignment and domain information
>cd01298 ATZ_TRZ_like TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases Back     alignment and domain information
>PRK07228 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>cd01293 Bact_CD Bacterial cytosine deaminase and related metal-dependent hydrolases Back     alignment and domain information
>PRK06151 N-ethylammeline chlorohydrolase; Provisional Back     alignment and domain information
>PRK14085 imidazolonepropionase; Provisional Back     alignment and domain information
>PRK09356 imidazolonepropionase; Validated Back     alignment and domain information
>KOG3968 consensus Atrazine chlorohydrolase/guanine deaminase [Nucleotide transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PRK07572 cytosine deaminase; Validated Back     alignment and domain information
>PRK07583 cytosine deaminase-like protein; Validated Back     alignment and domain information
>PRK05985 cytosine deaminase; Provisional Back     alignment and domain information
>KOG1096 consensus Adenosine monophosphate deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1228 HutI Imidazolonepropionase and related amidohydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01300 YtcJ_like YtcJ_like metal dependent amidohydrolases Back     alignment and domain information
>PRK06846 putative deaminase; Validated Back     alignment and domain information
>PRK12394 putative metallo-dependent hydrolase; Provisional Back     alignment and domain information
>cd01306 PhnM PhnM is believed to be a subunit of the membrane associated C-P lyase complex Back     alignment and domain information
>cd01309 Met_dep_hydrolase_C Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PF01979 Amidohydro_1: Amidohydrolase family; InterPro: IPR006680 This group of enzymes represents a large metal dependent hydrolase superfamily [] Back     alignment and domain information
>PRK15446 phosphonate metabolism protein PhnM; Provisional Back     alignment and domain information
>COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PLN02942 dihydropyrimidinase Back     alignment and domain information
>TIGR02033 D-hydantoinase D-hydantoinase Back     alignment and domain information
>cd01314 D-HYD D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin Back     alignment and domain information
>TIGR01975 isoAsp_dipep isoaspartyl dipeptidase IadA Back     alignment and domain information
>PRK10657 isoaspartyl dipeptidase; Provisional Back     alignment and domain information
>TIGR02318 phosphono_phnM phosphonate metabolism protein PhnM Back     alignment and domain information
>PF07969 Amidohydro_3: Amidohydrolase family; InterPro: IPR013108 Amidohydrolases are a diverse superfamily of enzymes which catalyse the hydrolysis of amide or amine bonds in a large number of different substrates including urea, cytosine, AMP, formylmethanofuran, etc [, ] Back     alignment and domain information
>PRK09357 pyrC dihydroorotase; Validated Back     alignment and domain information
>PRK08323 phenylhydantoinase; Validated Back     alignment and domain information
>TIGR00010 hydrolase, TatD family Back     alignment and domain information
>cd01307 Met_dep_hydrolase_B Metallo-dependent hydrolases, subgroup B is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>cd00530 PTE Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon Back     alignment and domain information
>cd01297 D-aminoacylase D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics Back     alignment and domain information
>PRK09237 dihydroorotase; Provisional Back     alignment and domain information
>cd01295 AdeC Adenine deaminase (AdeC) directly deaminates adenine to form hypoxanthine Back     alignment and domain information
>cd01310 TatD_DNAse TatD like proteins; E Back     alignment and domain information
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>TIGR01178 ade adenine deaminase Back     alignment and domain information
>cd00854 NagA N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate Back     alignment and domain information
>PRK09236 dihydroorotase; Reviewed Back     alignment and domain information
>PRK13207 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01317 DHOase_IIa Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK10812 putative DNAse; Provisional Back     alignment and domain information
>PRK07575 dihydroorotase; Provisional Back     alignment and domain information
>TIGR00857 pyrC_multi dihydroorotase, multifunctional complex type Back     alignment and domain information
>PRK13309 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>TIGR01792 urease_alph urease, alpha subunit Back     alignment and domain information
>PRK09875 putative hydrolase; Provisional Back     alignment and domain information
>PRK06361 hypothetical protein; Provisional Back     alignment and domain information
>COG3964 Predicted amidohydrolase [General function prediction only] Back     alignment and domain information
>PRK06189 allantoinase; Provisional Back     alignment and domain information
>PRK13206 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>cd01308 Isoaspartyl-dipeptidase Isoaspartyl dipeptidase hydrolyzes the beta-L-isoaspartyl linkages in dipeptides, as part of the degradative pathway to eliminate proteins with beta-L-isoaspartyl peptide bonds, bonds whereby the beta-group of an aspartate forms the peptide link with the amino group of the following amino acid Back     alignment and domain information
>PRK10425 DNase TatD; Provisional Back     alignment and domain information
>PF13147 Amidohydro_4: Amidohydrolase; PDB: 3SFW_B 2FTW_A 2PUZ_B 2GOK_B 3HM7_E 3D6N_A 1XRT_A 1XRF_A 1YNY_B 1K1D_F Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>cd01302 Cyclic_amidohydrolases Cyclic amidohydrolases, including hydantoinase, dihydropyrimidinase, allantoinase, and dihydroorotase, are involved in the metabolism of pyrimidines and purines, sharing the property of hydrolyzing the cyclic amide bond of each substrate to the corresponding N-carbamyl amino acids Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PRK08392 hypothetical protein; Provisional Back     alignment and domain information
>cd01315 L-HYD_ALN L-Hydantoinases (L-HYDs) and Allantoinase (ALN); L-Hydantoinases are a member of the dihydropyrimidinase family, which catalyzes the reversible hydrolytic ring opening of dihydropyrimidines and hydantoins (five-membered cyclic diamides used in biotechnology) Back     alignment and domain information
>cd00375 Urease_alpha Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide Back     alignment and domain information
>PRK13985 ureB urease subunit beta; Provisional Back     alignment and domain information
>PF01026 TatD_DNase: TatD related DNase The Pfam entry finds members not in the Prosite definition Back     alignment and domain information
>TIGR03178 allantoinase allantoinase Back     alignment and domain information
>TIGR03583 EF_0837 probable amidohydrolase EF_0837/AHA_3915 Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK08044 allantoinase; Provisional Back     alignment and domain information
>PRK13308 ureC urease subunit alpha; Reviewed Back     alignment and domain information
>PLN02303 urease Back     alignment and domain information
>PRK09061 D-glutamate deacylase; Validated Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>PLN02795 allantoinase Back     alignment and domain information
>PRK07328 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK00912 ribonuclease P protein component 3; Provisional Back     alignment and domain information
>PRK05588 histidinol-phosphatase; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>COG1001 AdeC Adenine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>PRK07627 dihydroorotase; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK02382 dihydroorotase; Provisional Back     alignment and domain information
>PRK09059 dihydroorotase; Validated Back     alignment and domain information
>COG1735 Php Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK13404 dihydropyrimidinase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd01294 DHOase Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PF02126 PTE: Phosphotriesterase family; InterPro: IPR001559 Synonym(s): Paraoxonase, A-esterase, Aryltriphosphatase, Phosphotriesterase, Paraoxon hydrolase Bacteria such as Brevundimonas diminuta (Pseudomonas diminuta) harbour a plasmid that carries the gene for Aryldialkylphosphatase (3 Back     alignment and domain information
>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PF04909 Amidohydro_2: Amidohydrolase; InterPro: IPR006992 These proteins are related to the metal-dependent hydrolase superfamily [] Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>COG2159 Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK09060 dihydroorotase; Validated Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd01301 rDP_like renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK09248 putative hydrolase; Validated Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK10027 cryptic adenine deaminase; Provisional Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK08417 dihydroorotase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>COG1387 HIS2 Histidinol phosphatase and related hydrolases of the PHP family [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>TIGR00856 pyrC_dimer dihydroorotase, homodimeric type Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>cd01318 DHOase_IIb Dihydroorotase (DHOase), subgroup IIb; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PF01244 Peptidase_M19: Membrane dipeptidase (Peptidase family M19); InterPro: IPR008257 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1820 NagA N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1831 Predicted metal-dependent hydrolase (urease superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00221 nagA N-acetylglucosamine-6-phosphate deacetylase Back     alignment and domain information
>PRK03892 ribonuclease P protein component 3; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK07369 dihydroorotase; Provisional Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07329 hypothetical protein; Provisional Back     alignment and domain information
>COG3454 Metal-dependent hydrolase involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08123 histidinol-phosphatase; Reviewed Back     alignment and domain information
>TIGR01856 hisJ_fam histidinol phosphate phosphatase HisJ family Back     alignment and domain information
>PLN03228 methylthioalkylmalate synthase; Provisional Back     alignment and domain information
>PRK06740 histidinol-phosphatase; Validated Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type Back     alignment and domain information
>PRK05451 dihydroorotase; Provisional Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PF13918 PLDc_3: PLD-like domain Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PLN02321 2-isopropylmalate synthase Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>PLN02599 dihydroorotase Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional Back     alignment and domain information
>PRK11449 putative deoxyribonuclease YjjV; Provisional Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>COG0084 TatD Mg-dependent DNase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
3ewc_A371 Crystal Structure Of Adenosine Deaminase From Plasm 9e-11
3ewd_A370 Crystal Structure Of Adenosine Deaminase Mutant (De 9e-11
2amx_A376 Crystal Structure Of Plasmodium Yoelii Adenosine De 5e-10
2pgf_A371 Crystal Structure Of Adenosine Deaminase From Plasm 1e-09
2bgn_E363 Hiv-1 Tat Protein Derived N-Terminal Nonapeptide Tr 1e-08
1ndv_A356 Crystal Structure Of Adenosine Deaminase Complexed 1e-08
1w1i_E357 Crystal Structure Of Dipeptidyl Peptidase Iv (Dppiv 1e-08
1krm_A356 Crystal Structure Of Bovine Adenosine Deaminase Com 1e-08
3ou8_A326 The Crystal Structure Of Adenosine Deaminase From P 2e-08
3iar_A367 The Crystal Structure Of Human Adenosine Deaminase 3e-08
2ada_A352 Atomic Structure Of Adenosine Deaminase Complexed W 4e-08
1a4l_A349 Ada Structure Complexed With Deoxycoformycin At Ph 4e-08
3lgd_A508 Crystal Structure Of Human Adenosine Deaminase Grow 9e-08
1fkw_A349 Murine Adenosine Deaminase (D295e) Length = 349 2e-07
3km8_A352 Crystal Structuore Of Adenosine Deaminase From Mus 2e-07
1fkx_A349 Murine Adenosine Deaminase (D296a) Length = 349 4e-07
1uip_A349 Adenosine Deaminase (His 238 Glu Mutant) Length = 3 5e-07
1uio_A349 Adenosine Deaminase (His 238 Ala Mutant) Length = 3 7e-07
3rys_A343 The Crystal Structure Of Adenine Deaminase (Aaur111 4e-06
3t1g_A353 Engineering Of Organophosphate Hydrolase By Computa 1e-05
>pdb|3EWC|A Chain A, Crystal Structure Of Adenosine Deaminase From Plasmodial Vivax In Complex With Mt-Coformycin Length = 371 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 83/170 (48%), Gaps = 8/170 (4%)
Query: 85  VGIDLSGNPTKGEWTTFLPALKFAREQGLQITLHCGE---IPNKEEIQSMLDFLP-QRIG 140
           VG D  G+    +   +     + RE G+ +++H GE   +PN   + S +  L  +RIG
Sbjct: 195 VGFDHGGHEV--DLKEYKEIFDYVRESGVPLSVHAGEDVTLPNLNTLYSAIQVLKVERIG 252
Query: 141 HACCFEE--EEWRKLKSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDS 198
           H     E  E    +K   I +E+C  SN+  +   S+D H    LY A   + + +DD 
Sbjct: 253 HGIRVAESQELIDMVKEKNILLEVCPISNVLLKNAKSMDTHPIRQLYDAGVKVSVNSDDP 312
Query: 199 GVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIF 248
           G+F T+++ +Y+   +  +    +  ++ + A++  F +  +K+ +K ++
Sbjct: 313 GMFLTNINDDYEELYTHLNFTLEDFMKMNEWALEKSFMDSNIKDKIKNLY 362
>pdb|3EWD|A Chain A, Crystal Structure Of Adenosine Deaminase Mutant (Delta Asp172) From Plasmodium Vivax In Complex With Mt-Coformycin Length = 370 Back     alignment and structure
>pdb|2AMX|A Chain A, Crystal Structure Of Plasmodium Yoelii Adenosine Deaminase (Py02076) Length = 376 Back     alignment and structure
>pdb|2PGF|A Chain A, Crystal Structure Of Adenosine Deaminase From Plasmodium Vivax In Complex With Adenosine Length = 371 Back     alignment and structure
>pdb|2BGN|E Chain E, Hiv-1 Tat Protein Derived N-Terminal Nonapeptide Trp2-Tat (1-9) Bound To The Active Site Of Dipeptidyl Peptidase Iv (Cd26) Length = 363 Back     alignment and structure
>pdb|1NDV|A Chain A, Crystal Structure Of Adenosine Deaminase Complexed With Fr117016 Length = 356 Back     alignment and structure
>pdb|1W1I|E Chain E, Crystal Structure Of Dipeptidyl Peptidase Iv (Dppiv Or Cd26) In Complex With Adenosine Deaminase Length = 357 Back     alignment and structure
>pdb|1KRM|A Chain A, Crystal Structure Of Bovine Adenosine Deaminase Complexed With 6-Hydroxyl-1,6-Dihydropurine Riboside Length = 356 Back     alignment and structure
>pdb|3OU8|A Chain A, The Crystal Structure Of Adenosine Deaminase From Pseudomonas Aeruginosa Length = 326 Back     alignment and structure
>pdb|3IAR|A Chain A, The Crystal Structure Of Human Adenosine Deaminase Length = 367 Back     alignment and structure
>pdb|2ADA|A Chain A, Atomic Structure Of Adenosine Deaminase Complexed With A Transition-State Analog: Understanding Catalysis And Immunodeficiency Mutations Length = 352 Back     alignment and structure
>pdb|1A4L|A Chain A, Ada Structure Complexed With Deoxycoformycin At Ph 7.0 Length = 349 Back     alignment and structure
>pdb|3LGD|A Chain A, Crystal Structure Of Human Adenosine Deaminase Growth Factor, Adenosine Deaminase Type 2 (Ada2) Length = 508 Back     alignment and structure
>pdb|1FKW|A Chain A, Murine Adenosine Deaminase (D295e) Length = 349 Back     alignment and structure
>pdb|3KM8|A Chain A, Crystal Structuore Of Adenosine Deaminase From Mus Musculus Complexed With 9-Deazainosine Length = 352 Back     alignment and structure
>pdb|1FKX|A Chain A, Murine Adenosine Deaminase (D296a) Length = 349 Back     alignment and structure
>pdb|1UIP|A Chain A, Adenosine Deaminase (His 238 Glu Mutant) Length = 349 Back     alignment and structure
>pdb|1UIO|A Chain A, Adenosine Deaminase (His 238 Ala Mutant) Length = 349 Back     alignment and structure
>pdb|3RYS|A Chain A, The Crystal Structure Of Adenine Deaminase (Aaur1117) From Arthrobacter Aurescens Length = 343 Back     alignment and structure
>pdb|3T1G|A Chain A, Engineering Of Organophosphate Hydrolase By Computational Design And Directed Evolution Length = 353 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
3lgd_A508 Adenosine deaminase CECR1; TIM barrel, dimerizatio 1e-49
3pao_A326 Adenosine deaminase; structural genomics, PSI-2, p 5e-42
3rys_A343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 2e-41
3iar_A367 Adenosine deaminase; purine metabolism structural 1e-40
2pgf_A371 Adenosine deaminase; metallo-dependent hydrolase, 2e-40
2a3l_A701 AMP deaminase, AMPD; atampd, AT2G38280, adenosine 3e-14
>3lgd_A Adenosine deaminase CECR1; TIM barrel, dimerization and receptor binding domains, glyco hydrolase, growth factor, secreted; HET: NAG; 2.00A {Homo sapiens} PDB: 3lgg_A* Length = 508 Back     alignment and structure
 Score =  169 bits (430), Expect = 1e-49
 Identities = 49/218 (22%), Positives = 86/218 (39%), Gaps = 17/218 (7%)

Query: 49  GKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLG---VVGIDLSGNPTKGE-WTTFLPA 104
            + I ++++ S  R +      E++++A+ +R      V G DL G+   G     +  A
Sbjct: 255 PEFIGIKIIYSDHRSKDVAVIAESIRMAMGLRIKFPTVVAGFDLVGHEDTGHSLHDYKEA 314

Query: 105 LKFAREQGLQIT--LHCGEIPN-----KEEIQSMLDFLPQRIGHACCFEEEE--WRKLKS 155
           L    + G+++    H GE           I   L     RIGH     +          
Sbjct: 315 LMIPAKDGVKLPYFFHAGETDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWK 374

Query: 156 SKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVF-STSVSREYDLAAS 214
             IP+E+C  SN   + +S L  H    L    HP+V+ +DD  +F +  +S ++     
Sbjct: 375 KDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFM 434

Query: 215 AF---SLGRREMFQLAKSAVKFIFANGRVKEDLKEIFD 249
                    R + QLA +++K+       K    EI+ 
Sbjct: 435 GIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWK 472
>3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* Length = 326 Back     alignment and structure
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} Length = 343 Back     alignment and structure
>3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... Length = 367 Back     alignment and structure
>2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A Length = 371 Back     alignment and structure
>2a3l_A AMP deaminase, AMPD; atampd, AT2G38280, adenosine 5'-monophosphate deaminase, COF 5'-phosphate, structural genomics; HET: CF5; 3.34A {Arabidopsis thaliana} SCOP: c.1.9.1 Length = 701 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
3rys_A343 Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2 100.0
4gxw_A380 Adenosine deaminase; amidohydrolase, COG1816, EFI, 100.0
3iar_A367 Adenosine deaminase; purine metabolism structural 100.0
3pao_A326 Adenosine deaminase; structural genomics, PSI-2, p 100.0
3lgd_A508 Adenosine deaminase CECR1; TIM barrel, dimerizatio 100.0
2pgf_A371 Adenosine deaminase; metallo-dependent hydrolase, 100.0
2a3l_A701 AMP deaminase, AMPD; atampd, AT2G38280, adenosine 100.0
4aql_A476 Guanine deaminase; hydrolase, purine metabolism; H 99.89
3ls9_A456 Triazine hydrolase; atrazine chlorohydrolase TRZN; 99.88
4dyk_A451 Amidohydrolase; adenosine deaminase, nysgrc, struc 99.86
3h4u_A479 Amidohydrolase; signature of Zn ligands, structura 99.86
4dzh_A472 Amidohydrolase; adenosine deaminase, nysgrc, struc 99.85
3mdu_A453 N-formimino-L-glutamate iminohydrolase; amonohydra 99.84
3lnp_A468 Amidohydrolase family protein OLEI01672_1_465; TIM 99.82
4f0r_A447 5-methylthioadenosine/S-adenosylhomocysteine DEAM; 99.82
4f0l_A458 Amidohydrolase; ssgcid, structural genomics, seatt 99.79
3v7p_A427 Amidohydrolase family protein; iron binding site, 99.77
2ood_A475 BLR3880 protein; PSI-II, PSI-2, guanine deaminase, 99.74
2i9u_A439 Cytosine/guanine deaminase related protein; protei 99.72
2bb0_A421 Imidazolonepropionase; TIM barrel, hydrolase; 2.00 99.71
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 99.71
2imr_A420 Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, 99.7
3feq_A423 Putative amidohydrolase; unknown source, sargasso 99.7
2paj_A492 Putative cytosine/guanine deaminase; NYSGXRC, PSI- 99.7
2q09_A416 Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dio 99.7
2r8c_A426 Putative amidohydrolase; unknown source, sargasso 99.69
2puz_A419 Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino 99.66
2qs8_A418 XAA-Pro dipeptidase; amidohydrolase, TIM barrel, p 99.63
1ra0_A430 Cytosine deaminase; alpha-beta barrel, hexamer, co 99.62
1p1m_A406 Hypothetical protein TM0936; putative metal depend 99.6
2qt3_A403 N-isopropylammelide isopropyl amidohydrolase; N-is 99.58
3be7_A408 Zn-dependent arginine carboxypeptidase; unknown so 99.54
3icj_A534 Uncharacterized metal-dependent hydrolase; structu 99.53
3ooq_A396 Amidohydrolase; structural genomics, protein struc 99.45
2p9b_A458 Possible prolidase; protein structure initiative I 99.43
2vun_A386 Enamidase; nicotinate degradation, binuclear metal 99.34
3hpa_A479 Amidohydrolase; signature of Zn ligands, structura 99.08
1yrr_A382 N-acetylglucosamine-6-phosphate deacetylase; (beta 99.07
2ics_A379 Adenine deaminase; TIM barrel, binuclear zinc, ade 99.0
2ogj_A417 Dihydroorotase; TIM barrel, binuclear zinc, imidaz 98.99
2vhl_A396 N-acetylglucosamine-6-phosphate deacetylase; N- ac 98.8
2z00_A426 Dihydroorotase; zinc binding protein, hydrolase, m 98.75
2gwn_A452 Dihydroorotase; zinc-binding prote structural geno 98.72
1xrt_A467 Dihydroorotase, dhoase; amidohydrolase, metalloenz 98.69
1o12_A376 N-acetylglucosamine-6-phosphate deacetylase; struc 98.67
1gkp_A458 Hydantoinase; hydrolase, dihydropyrimidinase, cycl 98.66
1nfg_A457 D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2 98.64
1gkr_A458 Hydantoinase, non-ATP dependent L-selective hydant 98.58
1e9y_B 569 Urease subunit beta; hydrolase, dodecamer; HET: KC 98.54
1yix_A265 Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW 98.44
2fty_A 559 Dihydropyrimidinase; alpha/beta barrel, beta-sandw 98.3
1zzm_A259 Putative deoxyribonuclease YJJV; hydrolaze, zinc, 98.26
3nqb_A 608 Adenine deaminase 2; PSI-II, structural genomics, 98.25
4ac7_C 570 Urease subunit alpha; hydrolase, bacillus pasteuri 98.23
3mtw_A403 L-arginine carboxypeptidase CC2672; hydrolase; HET 98.21
4ubp_C 570 Protein (urease (chain C)); bacillus pasteurii, ni 98.21
3sfw_A461 Dihydropyrimidinase; hydrolase, zinc binding; HET: 98.2
2vm8_A501 Dihydropyrimidinase-related protein 2; neurogenesi 98.18
1rk6_A496 D-aminoacylase; TIM barrel, beta barrel, insertion 98.16
2y1h_A272 Putative deoxyribonuclease tatdn3; hydrolase; 2.50 98.13
3rcm_A287 TATD family hydrolase; HET: CIT; 2.05A {Pseudomona 98.05
1onw_A390 Isoaspartyl dipeptidase; amidohydrolase, hydrolase 97.88
1xwy_A264 DNAse TATD, deoxyribonuclease TATD; TIM barrael, z 97.86
2vc7_A314 Aryldialkylphosphatase; phosphotriesterase, promis 97.78
1bf6_A291 Phosphotriesterase homology protein; hypothetical 97.7
3hm7_A448 Allantoinase; metallo-dependent hydrolase, protein 97.7
2xio_A301 Putative deoxyribonuclease tatdn1; hydrolase; 1.19 97.63
3gri_A424 Dihydroorotase, dhoase; hydrolase, IDP00795, metal 97.6
3tn4_A360 Phosphotriesterase; lactonase, hydrolase; HET: KCX 97.6
3k2g_A364 Resiniferatoxin-binding, phosphotriesterase- relat 97.58
3mpg_A428 Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus 97.57
2ob3_A330 Parathion hydrolase; metalloenzyme, TIM barrel, ne 97.55
3dc8_A490 Dihydropyrimidinase; TIM-barrel, hydrolase; HET: K 97.5
3gtx_A339 Organophosphorus hydrolase; mutant, amidohydrolase 97.49
1j6o_A268 TATD-related deoxyribonuclease; structural genomic 97.43
3rhg_A365 Putative phophotriesterase; hydrolase, amidohydrol 97.42
2gzx_A265 Putative TATD related DNAse; deoxyribonuclease, NE 97.39
2vr2_A 541 Dihydropyrimidinase; hydantoinase, metal-binding, 97.38
2ftw_A 521 Dihydropyrimidine amidohydrolase; (beta-alpha)8-ba 97.35
3ovg_A363 Amidohydrolase; structural genomics, PSI-2, protei 97.35
3pnz_A330 Phosphotriesterase family protein; amidohydrolase 97.34
3e74_A473 Allantoinase; (beta/alpha)8-barrel domain, small b 97.25
3cjp_A272 Predicted amidohydrolase, dihydroorotase family; s 97.08
3gg7_A254 Uncharacterized metalloprotein; structural genomic 97.0
1v77_A212 PH1877P, hypothetical protein PH1877; RNAse P prot 96.6
3irs_A291 Uncharacterized protein BB4693; structural genomic 96.42
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 96.36
2ffi_A288 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; 96.36
3mkv_A426 Putative amidohydrolase; sargasso SEA, structural 96.31
3gip_A480 N-acyl-D-glutamate deacylase; amidohydrolase famil 95.84
2f6k_A307 Metal-dependent hydrolase; metal dependent hydroly 95.72
2dvt_A327 Thermophilic reversible gamma-resorcylate decarbo; 95.41
3iv8_A381 N-acetylglucosamine-6-phosphate deacetylase; IDP01 95.01
2z26_A347 Dihydroorotase, dhoase; TIM barrel, hydrolase; HET 94.76
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 94.42
3guw_A261 Uncharacterized protein AF_1765; alpha-beta protei 94.36
4i6k_A294 Amidohydrolase family protein; enzyme function ini 94.34
2hbv_A334 2-amino-3-carboxymuconate 6-semialdehyde decarbox; 94.24
2i5g_A325 Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, stru 94.2
1itu_A369 Renal dipeptidase; glycoprotein, membrane-bound, z 94.18
2wm1_A336 2-amino-3-carboxymuconate-6-semialdehyde decarboxy 94.05
4do7_A303 Amidohydrolase 2; enzyme function initiative, EFI, 93.66
3rmj_A370 2-isopropylmalate synthase; LEUA, truncation, neis 93.59
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 93.38
3eeg_A325 2-isopropylmalate synthase; 11106D, beta barrel, P 93.21
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 93.2
3ble_A337 Citramalate synthase from leptospira interrogans; 93.07
3e2v_A401 3'-5'-exonuclease; structural genomics, hydrolase, 92.97
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 92.48
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 92.32
3ivs_A423 Homocitrate synthase, mitochondrial; TIM barrel, m 92.29
2ztj_A382 Homocitrate synthase; (beta/alpha)8 TIM barrel, su 92.15
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 91.97
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 91.95
2rag_A417 Dipeptidase; aminohydrolase, structural genomics, 91.77
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 91.36
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 91.26
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 91.07
3ly0_A364 Dipeptidase AC. metallo peptidase. merops family M 90.68
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 88.98
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 88.95
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 88.58
3qy7_A262 Tyrosine-protein phosphatase YWQE; TIM barrel, pol 88.39
3b40_A417 PVDM, probable dipeptidase; structural genomics, h 88.13
3pnu_A359 Dihydroorotase; TIM barrel, zinc binding, hydrolas 87.93
2wje_A247 CPS4B, tyrosine-protein phosphatase CPSB; capsule 87.06
3neh_A318 Renal dipeptidase family protein; structural genom 86.67
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 86.22
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 85.77
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 85.46
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 85.24
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 84.04
3ipw_A325 Hydrolase TATD family protein; niaid, ssgcid, seat 83.33
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 83.12
2w9m_A578 Polymerase X; SAXS, DNA repair, DNA polymerase, DN 82.71
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 82.02
3lmz_A257 Putative sugar isomerase; structural genomics, joi 81.88
3id7_A400 Dipeptidase; streptomyces coelicolor A3(2), hydrol 80.35
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 80.34
>3rys_A Adenosine deaminase 1; SGX, hydrolase; HET: ADE; 2.60A {Arthrobacter aurescens} SCOP: c.1.9.0 Back     alignment and structure
Probab=100.00  E-value=4.9e-54  Score=387.31  Aligned_cols=239  Identities=19%  Similarity=0.256  Sum_probs=225.1

Q ss_pred             ccceeeeeccCccccccCCCchhhhhhHh----hcccCCCcEEEEEEEeeCCCCHHHHHHHHHHHHhhCCCceEEEeccC
Q 025169           16 AVSAVDVDFASRSIDVRRPVNTKNMNDAC----NGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSG   91 (257)
Q Consensus        16 ~v~y~E~r~~p~~~~~~~~~~~~~~~~~~----~a~~~~gir~~li~~~~r~~~~e~~~~~~~~~~~~~~~~vvg~~l~g   91 (257)
                      ||+|+|+||+|+.|+.+|++.+++++.+.    ++.+++||++++|+|++|+.+++.+.+.++++.+| .++++|+|++|
T Consensus        94 gV~y~Eir~~P~~~~~~gl~~~~~v~~v~~~~~~a~~~~gi~~~lI~~~~R~~~~~~a~~~l~~a~~~-~~~vvG~dL~g  172 (343)
T 3rys_A           94 GVRHAEIMMDPQAHTSRGVALETCVNGVANALATSEEDFGVSTLLIAAFLRDMSEDSALEVLDQLLAM-HAPIAGIGLDS  172 (343)
T ss_dssp             TEEEEEEEECHHHHHTTTCCHHHHHHHHHHHHTTHHHHHSCEEEEEEEEETTSCHHHHHHHHHHHHHT-TCCCCEEEEES
T ss_pred             CCEEEEEEecHHHhccCCCCHHHHHHHHHHHHHHHhhcCceeEEEEEEeCCCCCHHHHHHHHHHHHhC-CCCEEEEecCC
Confidence            69999999999999999999999887665    45567899999999999999999999999999998 45699999999


Q ss_pred             CCCCCChhcHHHHHHHHHHcCCceeeecCCCCCHhhHHHHHh-cCCcEEeeccccc--HHHHHHHhcCCCcEEecccccc
Q 025169           92 NPTKGEWTTFLPALKFAREQGLQITLHCGEIPNKEEIQSMLD-FLPQRIGHACCFE--EEEWRKLKSSKIPVEICLTSNI  168 (257)
Q Consensus        92 ~~~~~~~~~~~~~~~~A~~~gl~v~~Ha~E~~~~~~i~~~l~-lg~~ri~Hg~~l~--~~~~~~l~~~~i~v~~cP~SN~  168 (257)
                      +|..+|++.|+++++.|++.|+++++|+||+.++.++.+++. +|++||+||+++.  |+++++|+++||++++||+||+
T Consensus       173 ~E~~~~~~~~~~~~~~A~~~gl~~~~HagE~~~~~~i~~al~~lg~~rIgHgv~l~~d~~l~~~l~~~~i~le~cP~SN~  252 (343)
T 3rys_A          173 AEVGNPPSKFERLYQRAAEAGLRRIAHAGEEGPASYITEALDVLHVERIDHGIRCMEDTDVVQRLVAEQVPLTVCPLSNV  252 (343)
T ss_dssp             CCTTCCGGGGHHHHHHHHHTTCEEEEEESSSSCHHHHHHHHHTSCCSEEEECGGGGGCHHHHHHHHHHTCCEEECHHHHH
T ss_pred             cccCCCHHHHHHHHHHHHHCCCeEEEeeCCCCCHHHHHHHHhcCCcceeeeeeeecCChHHHHHHHhcCCCeeEchhHHH
Confidence            999999999999999999999999999999998899999997 8999999999994  6899999999999999999999


Q ss_pred             eeccccCCCcccHHHHHhcCCCEEecCCCCCCCCCChHHHHHHHHHhCCCCHHHHHHHHHHHHHHcCCChHHHHHHHHHH
Q 025169          169 RTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKFIFANGRVKEDLKEIF  248 (257)
Q Consensus       169 ~l~~~~~~~~~pi~~l~~~Gv~v~lgTD~~~~~~~~l~~E~~~a~~~~~ls~~~v~~~~~n~~~~~~~~~~~k~~l~~~~  248 (257)
                      +++.+++++.||+++|+++||+|+||||||++|+++|++||+.++..+|+|.+++.++++||+++||+++++|++|+++|
T Consensus       253 ~l~~~~~~~~hPi~~ll~~Gv~V~l~TDdp~~~~~~l~~E~~~a~~~~~l~~~~l~~l~~nsi~~sf~~~~~K~~l~~~~  332 (343)
T 3rys_A          253 RLRAVDKLADHPLPEMLAIGLNVCVNSDDPAYFGGYVDDNFEQLVKVLEFSVPEQATLAANSIRSSFASDARKAVLLDEV  332 (343)
T ss_dssp             HTTSSSCGGGCSHHHHHHTTCCEEECCBSTTTTTCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHSSSCHHHHHHHHHHH
T ss_pred             HhCCCCCcccchHHHHHHCCCeEEEeCCCccccCCCHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Confidence            99998888899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhc
Q 025169          249 DLAEKKL  255 (257)
Q Consensus       249 ~~~~~~~  255 (257)
                      ++.....
T Consensus       333 ~~~~~~~  339 (343)
T 3rys_A          333 TEWVKAS  339 (343)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHhh
Confidence            9987654
>4gxw_A Adenosine deaminase; amidohydrolase, COG1816, EFI, structural genomics, hydrolase; 1.30A {Burkholderia ambifaria} Back     alignment and structure
>3iar_A Adenosine deaminase; purine metabolism structural genomics, structural genomics consortium, SGC, D mutation, hereditary hemolytic anemia, hydrolase; HET: 3D1; 1.52A {Homo sapiens} SCOP: c.1.9.1 PDB: 2bgn_E* 1w1i_E* 1qxl_A* 1krm_A* 1vfl_A 1ndv_A* 1ndy_A* 1ndz_A* 1o5r_A* 1uml_A* 1v79_A* 1v7a_A* 1ndw_A 1wxy_A* 1wxz_A* 2e1w_A* 2z7g_A* 2ada_A* 3mvi_A 1a4l_A* ... Back     alignment and structure
>3pao_A Adenosine deaminase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: ADE; 2.49A {Pseudomonas aeruginosa} PDB: 3pan_A* 3ou8_A* 3pbm_A* Back     alignment and structure
>3lgd_A Adenosine deaminase CECR1; TIM barrel, dimerization and receptor binding domains, glyco hydrolase, growth factor, secreted; HET: NAG; 2.00A {Homo sapiens} PDB: 3lgg_A* Back     alignment and structure
>2pgf_A Adenosine deaminase; metallo-dependent hydrolase, structural genomics, medical ST genomics of pathogenic protozoa consortium, MSGPP; HET: MSE ADN; 1.89A {Plasmodium vivax} PDB: 2pgr_A* 2qvn_A* 3ewc_A* 3ewd_A* 2amx_A Back     alignment and structure
>2a3l_A AMP deaminase, AMPD; atampd, AT2G38280, adenosine 5'-monophosphate deaminase, COF 5'-phosphate, structural genomics; HET: CF5; 3.34A {Arabidopsis thaliana} SCOP: c.1.9.1 Back     alignment and structure
>4aql_A Guanine deaminase; hydrolase, purine metabolism; HET: TXC; 1.99A {Homo sapiens} PDB: 2uz9_A* 3e0l_A Back     alignment and structure
>3ls9_A Triazine hydrolase; atrazine chlorohydrolase TRZN; 1.40A {Arthrobacter aurescens} PDB: 3lsc_A* 3lsb_A* Back     alignment and structure
>4dyk_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO PSI-biology, NEW YORK structural genomics research consorti hydrolase; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>4dzh_A Amidohydrolase; adenosine deaminase, nysgrc, structural GENO YORK structural genomics research consortium; 1.55A {Xanthomonas campestris PV} Back     alignment and structure
>3mdu_A N-formimino-L-glutamate iminohydrolase; amonohydralase family, N-formimino-L-glutamate iminohydrolas guanidino-L-glutamate; HET: NGQ; 1.40A {Pseudomonas aeruginosa} PDB: 3mdw_A* Back     alignment and structure
>3lnp_A Amidohydrolase family protein OLEI01672_1_465; TIM barrel, beta-fold, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Oleispira antarctica} Back     alignment and structure
>4f0r_A 5-methylthioadenosine/S-adenosylhomocysteine DEAM; structural genomics, PSI-biology; HET: MSE MTA; 1.80A {Chromobacterium violaceum} PDB: 4f0s_A* Back     alignment and structure
>4f0l_A Amidohydrolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>3v7p_A Amidohydrolase family protein; iron binding site, enzyme functio initiative, EFI; HET: TLA; 1.35A {Nitratiruptor SP} Back     alignment and structure
>2ood_A BLR3880 protein; PSI-II, PSI-2, guanine deaminase, guanine, structural genomics, protein structure initiative; HET: GUN; 2.62A {Bradyrhizobium japonicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2i9u_A Cytosine/guanine deaminase related protein; protein structure initiative II (PSI-II), amidohydrol guanine deaminase; HET: GUN; 2.05A {Clostridium acetobutylicum} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2bb0_A Imidazolonepropionase; TIM barrel, hydrolase; 2.00A {Bacillus subtilis} SCOP: b.92.1.10 c.1.9.17 PDB: 2g3f_A Back     alignment and structure
>2imr_A Hypothetical protein DR_0824; zinc, NYSGXRC, PSI2, structural genomics, protein structure initiative; 1.78A {Deinococcus radiodurans} SCOP: b.92.1.11 c.1.9.16 Back     alignment and structure
>3feq_A Putative amidohydrolase; unknown source, sargasso SEA, structural GEN protein structure initiative, PSI; 2.63A {Unidentified} PDB: 3lwy_A* 3n2c_A* Back     alignment and structure
>2paj_A Putative cytosine/guanine deaminase; NYSGXRC, PSI-II, amidohydrolase, sargasso SEA, enviro sample, structural genomics; 2.70A {Unidentified} SCOP: b.92.1.4 c.1.9.9 Back     alignment and structure
>2q09_A Imidazolonepropionase; 9252H, NYSGXRC, 3-(2, 5-dioxo-imidazo 4YL)-propionic acid, PSI-2 community, structural genomics, structure initiative; HET: DI6; 1.97A {Unidentified} SCOP: b.92.1.10 c.1.9.17 PDB: 2oof_A* Back     alignment and structure
>2r8c_A Putative amidohydrolase; unknown source, sargasso SEA, structural genomics, protein structure initiative, PSI; 2.31A {Unidentified} PDB: 3mkv_A* Back     alignment and structure
>2puz_A Imidazolonepropionase; NYSGXRC, PSI-2, N-formimino-L- glutamate, product-bound, structural genomics, protein STRU initiative; HET: NIG; 1.83A {Agrobacterium tumefaciens str} SCOP: b.92.1.10 c.1.9.17 PDB: 2gok_A Back     alignment and structure
>2qs8_A XAA-Pro dipeptidase; amidohydrolase, TIM barrel, protein structure initiative, PSI-2, NYSGXRC, structural genomics; 2.33A {Alteromonas macleodii} SCOP: b.92.1.9 c.1.9.18 Back     alignment and structure
>1ra0_A Cytosine deaminase; alpha-beta barrel, hexamer, conformation change, D314G mutant, hydrolase; 1.12A {Escherichia coli} SCOP: b.92.1.2 c.1.9.5 PDB: 1r9x_A 1ra5_A 1r9y_A 1r9z_A 1rak_A 3r0d_A* 3o7u_A* 3rn6_A* 1k6w_A 1k70_A 3g77_A Back     alignment and structure
>1p1m_A Hypothetical protein TM0936; putative metal dependent hydrolase, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: b.92.1.4 c.1.9.9 PDB: 2plm_A* 1j6p_A Back     alignment and structure
>2qt3_A N-isopropylammelide isopropyl amidohydrolase; N-isopropylammelide isopropylaminohydrolase ATZC, structural genomics, NYSGXRC, target 9364B; 2.24A {Pseudomonas SP} Back     alignment and structure
>3be7_A Zn-dependent arginine carboxypeptidase; unknown source, amidohydrolase, sargasso SEA, structural GEN protein structure initiative, PSI; HET: ARG; 2.30A {Unidentified} SCOP: b.92.1.9 c.1.9.18 PDB: 3dug_A* Back     alignment and structure
>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structur initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* Back     alignment and structure
>3ooq_A Amidohydrolase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, H PSI-2; 2.06A {Thermotoga maritima} Back     alignment and structure
>2p9b_A Possible prolidase; protein structure initiative II, PSI-2, amidohydrolase, structural genomics; 1.70A {Bifidobacterium longum NCC2705} SCOP: b.92.1.10 c.1.9.17 Back     alignment and structure
>2vun_A Enamidase; nicotinate degradation, binuclear metal center, amidohydrolases, stereospecificity, hydrolase; 1.89A {Eubacterium barkeri} Back     alignment and structure
>3hpa_A Amidohydrolase; signature of Zn ligands, structural genomics, NYSGXRC, target 9236E, PSI-2, protein structure initiative; 2.20A {Unidentified} Back     alignment and structure
>1yrr_A N-acetylglucosamine-6-phosphate deacetylase; (beta/alpha)8 barrel, beta sandwich, hydrolase; 2.00A {Escherichia coli} SCOP: b.92.1.5 c.1.9.10 PDB: 1ymy_A 2p50_A 2p53_A* Back     alignment and structure
>2ics_A Adenine deaminase; TIM barrel, binuclear zinc, adenine complex, amidohydrolase, structural genomics, PSI, protein structure initiative; HET: KCX ADE; 2.30A {Enterococcus faecalis} SCOP: b.92.1.8 c.1.9.14 Back     alignment and structure
>2ogj_A Dihydroorotase; TIM barrel, binuclear zinc, imidazole complex, amido hydrola 9244B, structural genomics, PSI-2; HET: KCX; 2.62A {Agrobacterium tumefaciens} Back     alignment and structure
>2vhl_A N-acetylglucosamine-6-phosphate deacetylase; N- acetyleglucosamine-6-phosphate, carbohydrate metabolism, hydrolase; HET: GLP PGE; 2.05A {Bacillus subtilis} Back     alignment and structure
>2z00_A Dihydroorotase; zinc binding protein, hydrolase, metal-binding, pyrimidine biosynthesis, structural genomics, NPPSFA; 2.42A {Thermus thermophilus} Back     alignment and structure
>2gwn_A Dihydroorotase; zinc-binding prote structural genomics, PSI, protein structure initiative, MID center for structural genomics, MCSG; HET: KCX GOL; 1.85A {Porphyromonas gingivalis} Back     alignment and structure
>1xrt_A Dihydroorotase, dhoase; amidohydrolase, metalloenzyme, pyrimidine; 1.61A {Aquifex aeolicus} SCOP: b.92.1.3 c.1.9.6 PDB: 1xrf_A 3d6n_A* Back     alignment and structure
>1o12_A N-acetylglucosamine-6-phosphate deacetylase; structural genomics, TM0814, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: b.92.1.5 c.1.9.10 Back     alignment and structure
>1gkp_A Hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX EPE; 1.29A {Thermus SP} SCOP: b.92.1.3 c.1.9.6 PDB: 1gkq_A* Back     alignment and structure
>1nfg_A D-hydantoinase; TIM barrel, hydrolase; HET: KCX; 2.70A {Ralstonia pickettii} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>1gkr_A Hydantoinase, non-ATP dependent L-selective hydantoinase; hydrolase, dihydropyrimidinase, cyclic amidase; HET: KCX; 2.60A {Arthrobacter aurescens} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>1e9y_B Urease subunit beta; hydrolase, dodecamer; HET: KCX; 3.00A {Helicobacter pylori} SCOP: b.92.1.1 c.1.9.2 PDB: 1e9z_B* 3qga_C* 3qgk_C* Back     alignment and structure
>1yix_A Deoxyribonuclease YCFH; TIM barrel, zinc ION, NEW YORK SGX center for structural genomics, nysgxrc; 1.90A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2fty_A Dihydropyrimidinase; alpha/beta barrel, beta-sandwich, hydrolase; HET: KCX; 2.40A {Lachancea kluyveri} SCOP: b.92.1.3 c.1.9.6 PDB: 2fvk_A* 2fvm_A* Back     alignment and structure
>1zzm_A Putative deoxyribonuclease YJJV; hydrolaze, zinc, PEG, structural genomics, PSI; HET: P33; 1.80A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>3nqb_A Adenine deaminase 2; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics, nysgxrc; 2.21A {Agrobacterium tumefaciens} PDB: 3t81_A 3t8l_A Back     alignment and structure
>4ac7_C Urease subunit alpha; hydrolase, bacillus pasteurii; HET: CXM KCX FLC; 1.50A {Sporosarcina pasteurii} PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 4ubp_C* 1ie7_C* Back     alignment and structure
>3mtw_A L-arginine carboxypeptidase CC2672; hydrolase; HET: KCX M3R; 1.70A {Caulobacter vibrioides} Back     alignment and structure
>4ubp_C Protein (urease (chain C)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.92.1.1 c.1.9.2 PDB: 1s3t_C* 2ubp_C* 3ubp_C* 1ubp_C* 1ie7_C* Back     alignment and structure
>3sfw_A Dihydropyrimidinase; hydrolase, zinc binding; HET: KCX; 1.73A {Brevibacillus agri} PDB: 1yny_A 1k1d_A* Back     alignment and structure
>2vm8_A Dihydropyrimidinase-related protein 2; neurogenesis, phosphoprotein, differentiation, CRMP, cytoplasm, TIM barrel, polymorphism, axonal pathfinding; 1.9A {Homo sapiens} PDB: 2gse_A 1kcx_A Back     alignment and structure
>1rk6_A D-aminoacylase; TIM barrel, beta barrel, insertion, hydrolase; 1.43A {Alcaligenes faecalis} SCOP: b.92.1.6 b.92.1.6 c.1.9.11 PDB: 1rjp_A 1v51_A 1rjq_A 1rjr_A 1rk5_A 1v4y_A 1m7j_A Back     alignment and structure
>2y1h_A Putative deoxyribonuclease tatdn3; hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>3rcm_A TATD family hydrolase; HET: CIT; 2.05A {Pseudomonas putida} Back     alignment and structure
>1onw_A Isoaspartyl dipeptidase; amidohydrolase, hydrolase, metalloprotease; HET: KCX; 1.65A {Escherichia coli} SCOP: b.92.1.7 c.1.9.13 PDB: 1onx_A* 1po9_A* 1poj_A* 1pok_B* 2aqo_A* 1ybq_A* 2aqv_A* Back     alignment and structure
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12 Back     alignment and structure
>2vc7_A Aryldialkylphosphatase; phosphotriesterase, promiscuous activities, enzyme evolution, hyperthermophilic, lactonase, hydrolase; HET: KCX GOL HT5; 2.05A {Sulfolobus solfataricus} PDB: 2vc5_A* Back     alignment and structure
>1bf6_A Phosphotriesterase homology protein; hypothetical protein; 1.70A {Escherichia coli} SCOP: c.1.9.3 Back     alignment and structure
>3hm7_A Allantoinase; metallo-dependent hydrolase, protein structure initiative, PSI-2, NEW YORK structural genomix research CON nysgxrc; 2.60A {Bacillus halodurans} Back     alignment and structure
>2xio_A Putative deoxyribonuclease tatdn1; hydrolase; 1.19A {Homo sapiens} Back     alignment and structure
>3gri_A Dihydroorotase, dhoase; hydrolase, IDP00795, metal-binding, pyrimidine biosynthesis, structural genomics; 2.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3tn4_A Phosphotriesterase; lactonase, hydrolase; HET: KCX; 1.50A {Geobacillus kaustophilus} PDB: 3tnb_A* 3tn3_A* 3tn5_A* 3tn6_A* 3ojg_A* 3orw_A* 3f4c_A* 3f4d_A* Back     alignment and structure
>3k2g_A Resiniferatoxin-binding, phosphotriesterase- related protein; TIM barrel, binuclear zinc, protein structure initiative II (PSI II); 1.80A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3mpg_A Dihydroorotase, dhoase; hydrolase; 2.60A {Bacillus anthracis} Back     alignment and structure
>2ob3_A Parathion hydrolase; metalloenzyme, TIM barrel, nerve agents; HET: KCX BTB; 1.04A {Brevundimonas diminuta} PDB: 1psc_A* 1jgm_A* 3cak_A* 1ez2_A* 1eyw_A* 1hzy_A 1i0b_A 1i0d_A 1p6b_A* 1p6c_A* 2oql_A* 2o4q_A* 3cs2_A* 3e3h_A* 1qw7_A* 1dpm_A* 2o4m_A* 1pta_A 3c86_A* 2d2j_A ... Back     alignment and structure
>3dc8_A Dihydropyrimidinase; TIM-barrel, hydrolase; HET: KCX; 1.85A {Sinorhizobium meliloti} Back     alignment and structure
>3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* Back     alignment and structure
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12 Back     alignment and structure
>3rhg_A Putative phophotriesterase; hydrolase, amidohydrolase, zinc binding site, enzyme functio initiative, EFI; HET: SO4; 1.53A {Proteus mirabilis} Back     alignment and structure
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural GENO PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>2vr2_A Dihydropyrimidinase; hydantoinase, metal-binding, disease mutation, dihydropyrimi amidohydrolase, nucleotide metabolism, DPYS, dhpase, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2ftw_A Dihydropyrimidine amidohydrolase; (beta-alpha)8-barrel, beta-sandwich; HET: KCX; 2.05A {Dictyostelium discoideum} SCOP: b.92.1.3 c.1.9.6 Back     alignment and structure
>3ovg_A Amidohydrolase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, NYSGXRC, HAD, PSI; HET: KCX; 2.06A {Mycoplasma synoviae} PDB: 3msr_A* Back     alignment and structure
>3pnz_A Phosphotriesterase family protein; amidohydrolase fold; HET: KCX; 1.60A {Listeria monocytogenes serotype 4b strorganism_taxid} SCOP: c.1.9.0 Back     alignment and structure
>3e74_A Allantoinase; (beta/alpha)8-barrel domain, small beta-sheet domain, hydrolase, metal-binding, purine metabolism, zinc; HET: KCX; 2.10A {Escherichia coli} Back     alignment and structure
>3cjp_A Predicted amidohydrolase, dihydroorotase family; structural genomics, protein structure initiative; 1.85A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3gg7_A Uncharacterized metalloprotein; structural genomics, unknown function, plasmid, PSI-2, protein structure initiative; 1.50A {Deinococcus radiodurans} SCOP: c.1.9.0 Back     alignment and structure
>1v77_A PH1877P, hypothetical protein PH1877; RNAse P protein, TIM-barrel, RNA binding protein; 1.80A {Pyrococcus horikoshii} SCOP: c.6.3.2 PDB: 2czv_A* Back     alignment and structure
>3irs_A Uncharacterized protein BB4693; structural genomics, PSI-2, protein structure initiative, TI protein; HET: GOL; 1.76A {Bordetella bronchiseptica} PDB: 3k4w_A Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>2ffi_A 2-pyrone-4,6-dicarboxylic acid hydrolase, putativ; TIM-barrel protein., structural genomics, PSI, protein struc initiative; 2.61A {Pseudomonas putida} SCOP: c.1.9.15 Back     alignment and structure
>3mkv_A Putative amidohydrolase; sargasso SEA, structural genomics, protein structure initiat NEW YORK structural genomix research consortium, nysgxrc; HET: KCX; 2.40A {Undefined} Back     alignment and structure
>3gip_A N-acyl-D-glutamate deacylase; amidohydrolase family, hydrolase; 1.50A {Bordetella bronchiseptica} PDB: 3giq_A* Back     alignment and structure
>2f6k_A Metal-dependent hydrolase; metal dependent hydrolyse, aminohydro_2, ACMDS, ACMS, trypto metabolism, quinolinic acid, QUIN; 2.50A {Lactobacillus plantarum} SCOP: c.1.9.15 Back     alignment and structure
>2dvt_A Thermophilic reversible gamma-resorcylate decarbo; TIM barrel, lyase; 1.70A {Rhizobium SP} SCOP: c.1.9.15 PDB: 2dvu_A* 2dvx_A* 3s4t_A* Back     alignment and structure
>3iv8_A N-acetylglucosamine-6-phosphate deacetylase; IDP01334, fruct phosphate, carbohydrate metabolism, hydrolase; HET: F6P; 2.53A {Vibrio cholerae} PDB: 3egj_A* Back     alignment and structure
>2z26_A Dihydroorotase, dhoase; TIM barrel, hydrolase; HET: KCX DOR NCD; 1.29A {Escherichia coli} PDB: 2z24_A* 2z25_A* 2eg6_A* 1xge_A* 2eg7_A* 2eg8_A* 2z27_A* 2e25_A* 2z28_A* 2z29_A* 3mjm_A* 2z2a_A* 1j79_A* 2z2b_A* 3ihn_A* 3jze_A* Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3guw_A Uncharacterized protein AF_1765; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.20A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>4i6k_A Amidohydrolase family protein; enzyme function initiative, isomerase, structural; HET: CIT; 2.28A {Acinetobacter baumannii} Back     alignment and structure
>2hbv_A 2-amino-3-carboxymuconate 6-semialdehyde decarbox; ACMSD, TIM-barrel, decarboxylase, metaloenzyme, lyase; 1.65A {Pseudomonas fluorescens} SCOP: c.1.9.15 PDB: 2hbx_A Back     alignment and structure
>2i5g_A Amidohydrolase; NYSGXRC, NYSGXRC-9311A, PSI2, structural genomics, protein structure initiative; 2.60A {Pseudomonas aeruginosa} Back     alignment and structure
>1itu_A Renal dipeptidase; glycoprotein, membrane-bound, zinc protease BET lactamase, cilastatin, complex (hydrolase-inhibitor), hydro; HET: NAG CIL; 2.00A {Homo sapiens} SCOP: c.1.9.7 PDB: 1itq_A* Back     alignment and structure
>2wm1_A 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; neurological disorders, metal-dependent amidohydrolase, kynurenine pathway; HET: 13P; 2.01A {Homo sapiens} Back     alignment and structure
>4do7_A Amidohydrolase 2; enzyme function initiative, EFI, structural TIM-barrel fold, putative lactonase; 1.70A {Burkholderia multivorans} PDB: 4dlm_A 4dnm_A* 4dlf_A Back     alignment and structure
>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3e2v_A 3'-5'-exonuclease; structural genomics, hydrolase, PSI-2, protein initiative, NEW YORK SGX research center for structural GEN nysgxrc; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A* Back     alignment and structure
>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A* Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>2rag_A Dipeptidase; aminohydrolase, structural genomics, NYSGXRC, target 9257A, protein structure initiative; 2.00A {Caulobacter crescentus} Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3ly0_A Dipeptidase AC. metallo peptidase. merops family M19; structural genomics, nysgrc, target 9523C, phosphinate inhibitor, PSI-2; HET: LY0; 1.40A {Rhodobacter sphaeroides} PDB: 3fdg_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3qy7_A Tyrosine-protein phosphatase YWQE; TIM barrel, polymerase and histindinol phosphatase(PHP)-like phosphatase, hydrolase; 1.62A {Bacillus subtilis} PDB: 3qy6_A Back     alignment and structure
>3b40_A PVDM, probable dipeptidase; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3pnu_A Dihydroorotase; TIM barrel, zinc binding, hydrolase, structu genomics, center for structural genomics of infectious DISE csgid; HET: KCX; 2.40A {Campylobacter jejuni subsp} Back     alignment and structure
>2wje_A CPS4B, tyrosine-protein phosphatase CPSB; capsule biogenesis/degradation, manganese, hydrolase, exopolysaccharide synthesis; 1.90A {Streptococcus pneumoniae} PDB: 2wjd_A 2wjf_A 3qy8_A Back     alignment and structure
>3neh_A Renal dipeptidase family protein; structural genomics, nysgrc, dipeptide L-Leu-D-Ala, PSI-2, P structure initiative; HET: L3A; 1.64A {Listeria monocytogenes} PDB: 3lu2_A Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>3ipw_A Hydrolase TATD family protein; niaid, ssgcid, seattle structural genomics center for infect disease, dysentery, liver abcess; 1.95A {Entamoeba histolytica hm-1} Back     alignment and structure
>2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>3id7_A Dipeptidase; streptomyces coelicolor A3(2), hydrolase; 1.30A {Streptomyces coelicolor} PDB: 3isi_X* 3itc_A* 3k5x_A* 3s2j_A* 3s2l_A* 3s2m_A* 3s2n_A* Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 257
d1a4ma_349 c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus 5e-37
d2amxa1357 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plas 2e-34
d2a3la1628 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalyti 4e-28
>d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} Length = 349 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: Adenosine/AMP deaminase
domain: Adenosine deaminase (ADA)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  131 bits (330), Expect = 5e-37
 Identities = 47/202 (23%), Positives = 87/202 (43%), Gaps = 7/202 (3%)

Query: 54  VRLLLSIDRRETTEAAMETVKLALEMRDLGVVGIDLSGNPTKG---EWTTFLPALKFARE 110
           VR +L   R +    ++E ++L  +     VV +DL+G+ T      +   + A + A +
Sbjct: 145 VRSILCCMRHQP-SWSLEVLELCKKYNQKTVVAMDLAGDETIEGSSLFPGHVEAYEGAVK 203

Query: 111 QGLQITLHCGEIPNKEEIQSMLDFL-PQRIGHA--CCFEEEEWRKLKSSKIPVEICLTSN 167
            G+  T+H GE+ + E ++  +D L  +R+GH      +E  + +L    +  E+C  S+
Sbjct: 204 NGIHRTVHAGEVGSPEVVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSS 263

Query: 168 IRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLA 227
             T        H  V     +    L TDD  +F +++  +Y +          E  +L 
Sbjct: 264 YLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLN 323

Query: 228 KSAVKFIFANGRVKEDLKEIFD 249
            +A K  F     K++L E   
Sbjct: 324 INAAKSSFLPEEEKKELLERLY 345
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Length = 357 Back     information, alignment and structure
>d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 628 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
d1a4ma_349 Adenosine deaminase (ADA) {Mouse (Mus musculus) [T 100.0
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 100.0
d2a3la1628 AMP deaminase (AMPD), catalytic domain {Thale cres 99.97
d1p1ma2281 Hypothetical protein TM0936, probable catalytic do 99.94
d2i9ua2310 Guanine deaminase {Clostridium acetobutylicum [Tax 99.91
d2uz9a2313 Guanine deaminase {Human (Homo sapiens) [TaxId: 96 99.86
d2imra2308 Hypothetical protein DR0824 {Deinococcus radiodura 99.75
d2paja2336 Hypothetical protein GOS_1943094 {Environmental sa 99.74
d2bb0a2300 Imidazolonepropionase {Bacillus subtilis [TaxId: 1 99.71
d2q09a2301 Probable 4-imidazolone-5-propanoate amidohydrolase 99.71
d2puza2301 Imidazolonepropionase {Agrobacterium tumefaciens [ 99.62
d1ra0a2320 Cytosine deaminase catalytic domain {Escherichia c 99.24
d2ooda2325 Guanine deaminase {Bradyrhizobium japonicum [TaxId 99.21
d3be7a2303 Zn-dependent arginine carboxypeptidase {Unidentifi 99.12
d2qs8a2310 Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 99.07
d2r8ca2311 Uncharacterized protein EAJ56179 {Unidentified org 99.0
d2p9ba2324 Uncharacterized protein BL1453 {Bifidobacterium lo 98.9
d1yrra2297 N-acetylglucosamine-6-phosphate deacetylase, NagA, 98.21
d1xwya1260 Deoxyribonuclease TatD (MttC) {Escherichia coli [T 97.62
d1zzma1259 Putative deoxyribonuclease YjjV {Escherichia coli 97.53
d1bf6a_291 Phosphotriesterase homology protein {Escherichia c 97.53
d2icsa2267 Putative adenine deaminase EF0837 {Enterococcus fa 97.41
d1i0da_331 Phosphotriesterase (parathion hydrolase, PTE) {Pse 97.38
d1v77a_202 Ribonuclease P protein component 3, Rnp3 {Pyrococc 97.36
d1yixa1265 Putative deoxyribonuclease YcfH {Escherichia coli 97.18
d1j6oa_260 Hypothetical protein TM0667 {Thermotoga maritima [ 97.09
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 95.3
d1onwa2284 Isoaspartyl dipeptidase, catalytic domain {Escheri 95.23
d2vhla2301 N-acetylglucosamine-6-phosphate deacetylase, NagA, 93.64
d1ynya2332 D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} 92.62
d1o12a2288 N-acetylglucosamine-6-phosphate deacetylase, NagA, 91.4
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 90.97
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 88.85
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 88.64
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 87.94
d1itua_369 Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 87.87
d2f6ka1306 Putative amidohydrolase LP2961 {Lactobacillus plan 87.74
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 87.31
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 86.85
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 86.18
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 84.72
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 84.38
d2fvka2 384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 82.51
d2gwga1342 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas 82.24
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 81.35
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 81.18
d1nfga2330 D-hydantoinase {Burkholderia pickettii [TaxId: 329 80.11
>d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Metallo-dependent hydrolases
family: Adenosine/AMP deaminase
domain: Adenosine deaminase (ADA)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=3.6e-49  Score=354.91  Aligned_cols=237  Identities=22%  Similarity=0.308  Sum_probs=214.6

Q ss_pred             ccceeeeeccCcccc------------ccCCCchhhhhhHh----hcccCCCcEEEEEEEeeCCCCHHHHHHHHHHHHhh
Q 025169           16 AVSAVDVDFASRSID------------VRRPVNTKNMNDAC----NGTRGKKIYVRLLLSIDRRETTEAAMETVKLALEM   79 (257)
Q Consensus        16 ~v~y~E~r~~p~~~~------------~~~~~~~~~~~~~~----~a~~~~gir~~li~~~~r~~~~e~~~~~~~~~~~~   79 (257)
                      ||+|+|+||+|..+.            .+|++..++++.+.    ++....|++++++.++.|+ .++++.+.+..+.++
T Consensus        91 nv~y~Elr~~P~~~~~~~~~~~~~~~~~~~l~~~~vv~~i~~~~~~~~~~~~~~~~~i~~~~r~-~~~~~~e~~~~~~~~  169 (349)
T d1a4ma_          91 GVVYVEVRYSPHLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRH-QPSWSLEVLELCKKY  169 (349)
T ss_dssp             TEEEEEEEECSGGGCCSSCSSCGGGCCCCSCCHHHHHHHHHHHHHHHHHHHCCEEEEEEEEETT-CGGGHHHHHHHHHHT
T ss_pred             CeeEEEEEeChhhhcccccccchhhhhhcCCCHHHHHHHHHHHHHHhcccCCceEEEEEEEecc-chhhHHHHHHHHHHh
Confidence            699999999997654            45677788777655    3456789999999999996 455677888888888


Q ss_pred             CCCceEEEeccCCCCCCChh---cHHHHHHHHHHcCCceeeecCCCCCHhhHHHHHh-cCCcEEeecccc--cHHHHHHH
Q 025169           80 RDLGVVGIDLSGNPTKGEWT---TFLPALKFAREQGLQITLHCGEIPNKEEIQSMLD-FLPQRIGHACCF--EEEEWRKL  153 (257)
Q Consensus        80 ~~~~vvg~~l~g~~~~~~~~---~~~~~~~~A~~~gl~v~~Ha~E~~~~~~i~~~l~-lg~~ri~Hg~~l--~~~~~~~l  153 (257)
                      ..++++|+|++|+|...+++   .|.++|+.||+.|+++++|+||..+++++.+++. +|++|||||+.+  +++.++++
T Consensus       170 ~~~~vvGidl~G~E~~~~~~~~~~~~~~f~~ar~~gl~~t~HaGE~~~~~~i~~ai~~l~~~RIGHG~~l~~d~~l~~~~  249 (349)
T d1a4ma_         170 NQKTVVAMDLAGDETIEGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGSPEVVREAVDILKTERVGHGYHTIEDEALYNRL  249 (349)
T ss_dssp             BTTTEEEEEEESCTTSTTGGGCHHHHHHHHHHHHHTCEEEEEESSSSCHHHHHHHHHTSCCSEEEECGGGGGSHHHHHHH
T ss_pred             cccccccceecCccCCCChhhHHHHHHHHHHHHHcCCceeeccCCCCChHHHHHHHHHhCCcccCCceecccCHHHHHHh
Confidence            88889999999998776654   4888999999999999999999999999998886 899999999998  88999999


Q ss_pred             hcCCCcEEecccccceeccccCCCcccHHHHHhcCCCEEecCCCCCCCCCChHHHHHHHHHhCCCCHHHHHHHHHHHHHH
Q 025169          154 KSSKIPVEICLTSNIRTETISSLDIHHFVDLYKAQHPLVLCTDDSGVFSTSVSREYDLAASAFSLGRREMFQLAKSAVKF  233 (257)
Q Consensus       154 ~~~~i~v~~cP~SN~~l~~~~~~~~~pi~~l~~~Gv~v~lgTD~~~~~~~~l~~E~~~a~~~~~ls~~~v~~~~~n~~~~  233 (257)
                      ++++|++++||+||+.++.++++..||++.|+++||||+||||||++|+++|++||..+++.+|++.+|+.++++||+++
T Consensus       250 ~~~~I~lEvCptSN~~~~~~~~~~~HP~~~~~~~gv~v~i~TDDp~~f~t~Ls~Ey~~a~~~~~l~~~~l~~l~~nsi~~  329 (349)
T d1a4ma_         250 LKENMHFEVCPWSSYLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKS  329 (349)
T ss_dssp             HHTTCEEEECHHHHHHSSSSCTTSCCHHHHHHHTTCCEEECCBCTTTTTCCHHHHHHHHHHTTTCCHHHHHHHHHHHHHT
T ss_pred             hhcCceEEEcccccccccccCchhhHHHHHHHHCCCeEEEeCCCccccCCCHHHHHHHHHHHhCcCHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCChHHHHHHHHHHHHHHh
Q 025169          234 IFANGRVKEDLKEIFDLAEK  253 (257)
Q Consensus       234 ~~~~~~~k~~l~~~~~~~~~  253 (257)
                      ||+++++|++|+++|.+.+|
T Consensus       330 sf~~~~~K~~l~~~~~~~~~  349 (349)
T d1a4ma_         330 SFLPEEEKKELLERLYREYQ  349 (349)
T ss_dssp             SSCCHHHHHHHHHHHHHHTC
T ss_pred             hCCCHHHHHHHHHHHHHhhC
Confidence            99999999999999988764
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2a3la1 c.1.9.1 (A:212-839) AMP deaminase (AMPD), catalytic domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p1ma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i9ua2 c.1.9.9 (A:67-376) Guanine deaminase {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2uz9a2 c.1.9.9 (A:76-388) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2paja2 c.1.9.9 (A:70-405) Hypothetical protein GOS_1943094 {Environmental samples} Back     information, alignment and structure
>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q09a2 c.1.9.17 (A:66-366) Probable 4-imidazolone-5-propanoate amidohydrolase GOS_1928421 {Environmental samples} Back     information, alignment and structure
>d2puza2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ra0a2 c.1.9.5 (A:56-375) Cytosine deaminase catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ooda2 c.1.9.9 (A:73-397) Guanine deaminase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d3be7a2 c.1.9.18 (A:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2qs8a2 c.1.9.18 (A:64-373) Xaa-Pro dipeptidase {Alteromonas macleodii [TaxId: 28108]} Back     information, alignment and structure
>d2r8ca2 c.1.9.18 (A:58-368) Uncharacterized protein EAJ56179 {Unidentified organism [TaxId: 32644]} Back     information, alignment and structure
>d2p9ba2 c.1.9.17 (A:71-394) Uncharacterized protein BL1453 {Bifidobacterium longum [TaxId: 216816]} Back     information, alignment and structure
>d1yrra2 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwya1 c.1.9.12 (A:1-260) Deoxyribonuclease TatD (MttC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzma1 c.1.9.12 (A:1-259) Putative deoxyribonuclease YjjV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2icsa2 c.1.9.14 (A:55-321) Putative adenine deaminase EF0837 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1i0da_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]} Back     information, alignment and structure
>d1v77a_ c.6.3.2 (A:) Ribonuclease P protein component 3, Rnp3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yixa1 c.1.9.12 (A:1-265) Putative deoxyribonuclease YcfH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6oa_ c.1.9.12 (A:) Hypothetical protein TM0667 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d1onwa2 c.1.9.13 (A:63-346) Isoaspartyl dipeptidase, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ynya2 c.1.9.6 (A:53-384) D-hydantoinase {Bacillus sp. AR9 [TaxId: 301298]} Back     information, alignment and structure
>d1o12a2 c.1.9.10 (A:44-331) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1nfga2 c.1.9.6 (A:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]} Back     information, alignment and structure