Citrus Sinensis ID: 025186

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAPPVLPQ
cccccccccccccccccccccccccEEEccccccccccccccccccccccccccEEEEEEccccccccccccccccccEEccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHcccEEcccccccccHHHHHHHHHHHHHHHccccHHHHccEEEEEccccccccccccEEEEccccccccccccccccccccc
cccccHHHHHccccccccHHccccEEEEccccccEEEccccccccccccccHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHcEccccccccccEccccccEEEcccccccEEccccccEEEEEEcccccEEHccccccccccHHHHccccccEEEcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHcccEEEEEEccccccccEEEEEEEEEccccccccccccccccccc
megsaneritfgkmgygckhyrrrcrirapccneifdcrhcHNEAAsmlrnpydrheLVRQDVKQVAQVCTNcgvnmgeyfCDICKFYdddiekgqfhcddcgicriggrenyfhckrcgscystslrnnhlciensmhhhcpiCYEYLFDSlrnttvmkcghtmhcECYHemikrdkyccpicsksvidmsRTWKRIDEEIeatvmpedyrhkKVWILcndcndttEVYFHIIGqkcshcksyntrsiappvlpq
megsaneritfgkmgygckhyrRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKsvidmsrtwKRIDEEIeatvmpedyrhkKVWILCNDCNDTTEVYFHIIGQKcshcksyntrsiappvlpq
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAPPVLPQ
********ITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNT**********
***************YGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRS**P*****
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAPPVLPQ
**********FGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTR*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAPPVLPQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q9CR50261 RING finger and CHY zinc yes no 0.921 0.904 0.433 8e-54
Q96PM5261 RING finger and CHY zinc yes no 0.949 0.931 0.426 1e-53
O14099425 Uncharacterized RING fing yes no 0.921 0.555 0.430 2e-46
>sp|Q9CR50|ZN363_MOUSE RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1 Back     alignment and function desciption
 Score =  210 bits (534), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 148/242 (61%), Gaps = 6/242 (2%)

Query: 17  GCKHYRRRCRIRAPCCNEIFDCRHCH--NEAASMLRNPYDRHELVR-QDVKQVAQVCTNC 73
           GC+HY R C ++APCC++++ CR CH  NE   + R      + +  + ++   Q C +C
Sbjct: 19  GCEHYDRACLLKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEVQCINCEKLQHAQQTCEDC 78

Query: 74  GVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLC 133
               GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T+LR  H C
Sbjct: 79  STLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKC 136

Query: 134 IENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSR 193
           IEN    +CPIC E +  S     V+ CGH +H  CY EM+K + Y CP+C  S +DM+R
Sbjct: 137 IENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLK-EGYRCPLCMHSALDMTR 195

Query: 194 TWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFHIIGQKCSHCKSYNTRSIAPPV 253
            W+++D E+  T MP +Y++  V ILCNDCN  + V FHI+G KC  C SYNT       
Sbjct: 196 YWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTAQAGGRR 255

Query: 254 LP 255
           +P
Sbjct: 256 VP 257
Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Increases AR transcription factor activity (By similarity). Contributes to the regulation of CDKN1B and p53/TP53 levels, and thereby contributes to the regulation of the cell cycle progression.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q96PM5|ZN363_HUMAN RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1 Back     alignment and function description
>sp|O14099|YERG_SCHPO Uncharacterized RING finger protein C2F3.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.16 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
359806446267 uncharacterized protein LOC100792038 [Gl 1.0 0.958 0.812 1e-128
225432370267 PREDICTED: RING finger and CHY zinc fing 1.0 0.958 0.812 1e-127
358248192267 uncharacterized protein LOC100812839 [Gl 1.0 0.958 0.801 1e-126
357447417267 RING finger and CHY zinc finger domain-c 1.0 0.958 0.805 1e-126
356555553267 PREDICTED: RING finger and CHY zinc fing 1.0 0.958 0.805 1e-126
224102637269 predicted protein [Populus trichocarpa] 0.984 0.936 0.825 1e-125
388519059267 unknown [Medicago truncatula] 1.0 0.958 0.801 1e-125
297807887267 zinc finger family protein [Arabidopsis 1.0 0.958 0.790 1e-125
15238890267 ring finger and CHY zinc finger domain-c 1.0 0.958 0.790 1e-124
255551659269 zinc finger protein, putative [Ricinus c 1.0 0.951 0.802 1e-123
>gi|359806446|ref|NP_001241502.1| uncharacterized protein LOC100792038 [Glycine max] gi|255646865|gb|ACU23903.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/267 (81%), Positives = 242/267 (90%), Gaps = 11/267 (4%)

Query: 1   MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVR 60
           MEGS NER+ FGKMGYGC HYRRRCRIRAPCCNEI+ CRHCHN+AAS+L+NP+DRHELVR
Sbjct: 1   MEGSVNERLDFGKMGYGCNHYRRRCRIRAPCCNEIYSCRHCHNDAASLLKNPFDRHELVR 60

Query: 61  QDVKQV-----------AQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGG 109
           QDVKQV           AQVCTNCGV MGEYFC+ICKF+DDD+EK QFHCDDCGICR+GG
Sbjct: 61  QDVKQVVCSVCDTEQPVAQVCTNCGVKMGEYFCNICKFFDDDVEKEQFHCDDCGICRVGG 120

Query: 110 RENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCEC 169
           R+N+FHCK+CGSCY+  LR+NHLC+ENSM HHCPICYEYLFDSL++T VMKCGHTMH EC
Sbjct: 121 RDNFFHCKKCGSCYAIGLRDNHLCVENSMRHHCPICYEYLFDSLKDTIVMKCGHTMHHEC 180

Query: 170 YHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEV 229
           Y EMIK DKYCCPICSKSVIDMS+TWKRIDEEIEATVMPEDYR++KVWILCNDCNDTTEV
Sbjct: 181 YVEMIKNDKYCCPICSKSVIDMSKTWKRIDEEIEATVMPEDYRNRKVWILCNDCNDTTEV 240

Query: 230 YFHIIGQKCSHCKSYNTRSIAPPVLPQ 256
           YFHI+GQKC HC+SYNTR++APPVLPQ
Sbjct: 241 YFHILGQKCGHCRSYNTRAVAPPVLPQ 267

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225432370|ref|XP_002276039.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|297736904|emb|CBI26105.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358248192|ref|NP_001239836.1| uncharacterized protein LOC100812839 [Glycine max] gi|255636475|gb|ACU18576.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357447417|ref|XP_003593984.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] gi|355483032|gb|AES64235.1| RING finger and CHY zinc finger domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356555553|ref|XP_003546095.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224102637|ref|XP_002312758.1| predicted protein [Populus trichocarpa] gi|222852578|gb|EEE90125.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388519059|gb|AFK47591.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297807887|ref|XP_002871827.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297317664|gb|EFH48086.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15238890|ref|NP_197366.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] gi|17381208|gb|AAL36416.1| unknown protein [Arabidopsis thaliana] gi|20465813|gb|AAM20011.1| unknown protein [Arabidopsis thaliana] gi|332005211|gb|AED92594.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255551659|ref|XP_002516875.1| zinc finger protein, putative [Ricinus communis] gi|223543963|gb|EEF45489.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
TAIR|locus:2180074267 MIEL1 "MYB30-Interacting E3 Li 1.0 0.958 0.790 2.8e-128
TAIR|locus:2099212287 AT3G62970 [Arabidopsis thalian 0.953 0.850 0.609 2.7e-93
TAIR|locus:2172656291 AT5G22920 [Arabidopsis thalian 0.921 0.810 0.584 2.3e-87
TAIR|locus:2179474328 AT5G25560 [Arabidopsis thalian 0.839 0.655 0.541 2.9e-71
UNIPROTKB|Q96PM5261 RCHY1 "RING finger and CHY zin 0.886 0.869 0.442 1.9e-60
UNIPROTKB|A4IFE2261 RCHY1 "RCHY1 protein" [Bos tau 0.886 0.869 0.433 3.9e-60
MGI|MGI:1915348261 Rchy1 "ring finger and CHY zin 0.886 0.869 0.446 3.9e-60
UNIPROTKB|J9NZR5259 RCHY1 "Uncharacterized protein 0.886 0.876 0.437 1.3e-59
ZFIN|ZDB-GENE-040801-73264 rchy1 "ring finger and CHY zin 0.890 0.863 0.429 1.7e-59
RGD|1359180261 Rchy1 "ring finger and CHY zin 0.886 0.869 0.437 9.3e-59
TAIR|locus:2180074 MIEL1 "MYB30-Interacting E3 Ligase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1259 (448.2 bits), Expect = 2.8e-128, P = 2.8e-128
 Identities = 211/267 (79%), Positives = 236/267 (88%)

Query:     1 MEGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVR 60
             ME S N+R+ FGKMG+GCKHY+RRC+IRAPCCNE+FDCRHCHNE+ S LRN YDRH+LVR
Sbjct:     1 MEASPNDRLHFGKMGFGCKHYKRRCQIRAPCCNEVFDCRHCHNESTSTLRNIYDRHDLVR 60

Query:    61 QDVKQV-----------AQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGG 109
             QDVKQV           AQVC+NCGVNMGEYFC IC FYDDD EK QFHCDDCGICR+GG
Sbjct:    61 QDVKQVICSVCDTEQPAAQVCSNCGVNMGEYFCSICIFYDDDTEKQQFHCDDCGICRVGG 120

Query:   110 RENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDSLRNTTVMKCGHTMHCEC 169
             REN+FHCK+CGSCY+  LRNNH C+ENSM HHCPICYEYLFDSL++T VMKCGHTMH EC
Sbjct:   121 RENFFHCKKCGSCYAVGLRNNHRCVENSMRHHCPICYEYLFDSLKDTNVMKCGHTMHVEC 180

Query:   170 YHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEV 229
             Y+EMIKRDK+CCPICS+SVIDMS+TW+R+DEEIEAT MP DYR KKVWILCNDCNDTTEV
Sbjct:   181 YNEMIKRDKFCCPICSRSVIDMSKTWQRLDEEIEATAMPSDYRDKKVWILCNDCNDTTEV 240

Query:   230 YFHIIGQKCSHCKSYNTRSIAPPVLPQ 256
             +FHIIGQKC HC+SYNTR+IAPPVLPQ
Sbjct:   241 HFHIIGQKCGHCRSYNTRAIAPPVLPQ 267
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2099212 AT3G62970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172656 AT5G22920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179474 AT5G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PM5 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFE2 RCHY1 "RCHY1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915348 Rchy1 "ring finger and CHY zinc finger domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZR5 RCHY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-73 rchy1 "ring finger and CHY zinc finger domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1359180 Rchy1 "ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9CR50ZN363_MOUSE6, ., 3, ., 2, ., -0.43380.92180.9042yesno
Q96PM5ZN363_HUMAN6, ., 3, ., 2, ., -0.42620.94920.9310yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00019811001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (267 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
pfam0549574 pfam05495, zf-CHY, CHY zinc finger 1e-12
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-04
smart0018440 smart00184, RING, Ring finger 8e-04
>gnl|CDD|218608 pfam05495, zf-CHY, CHY zinc finger Back     alignment and domain information 
 Score = 61.2 bits (149), Expect = 1e-12
 Identities = 35/82 (42%), Positives = 42/82 (51%), Gaps = 18/82 (21%)

Query: 18 CKHYRRR-CRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQVA-QVC----- 70
          CKHY R  C IRAPCCN+ + CR CH+E           H L R +VK V   VC     
Sbjct: 1  CKHYHRNLCAIRAPCCNKYYPCRLCHDELED--------HPLDRWNVKAVLCGVCRTEQT 52

Query: 71 ---TNCGVNMGEYFCDICKFYD 89
              NCGV   +Y+C ICK + 
Sbjct: 53 VQEYNCGVEFADYYCPICKLFF 74

This family of domains are likely to bind to zinc ions. They contain many conserved cysteine and histidine residues. We have named this domain after the N-terminal motif CXHY. This domain can be found in isolation in some proteins, but is also often associated with pfam00097. One of the proteins in this family is a mitochondrial intermembrane space protein called Hot13. This protein is involved in the assembly of small TIM complexes. Length = 74
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
KOG1940276 consensus Zn-finger protein [General function pred 100.0
PF1459961 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A. 99.96
PF0549571 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc 99.69
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.39
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.04
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.01
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.0
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.91
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.86
PHA02929238 N1R/p28-like protein; Provisional 98.83
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.7
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.7
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.68
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.64
PF1463444 zf-RING_5: zinc-RING finger domain 98.62
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.55
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.51
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.46
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.44
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.41
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.41
PHA02926242 zinc finger-like protein; Provisional 98.23
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.15
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.08
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.95
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.87
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.83
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.73
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.7
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.58
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.58
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.46
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.44
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.27
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.25
COG4357105 Zinc finger domain containing protein (CHY type) [ 97.24
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.21
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.21
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.08
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.05
KOG149384 consensus Anaphase-promoting complex (APC), subuni 96.97
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.8
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.59
KOG1941518 consensus Acetylcholine receptor-associated protei 96.56
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.48
COG52191525 Uncharacterized conserved protein, contains RING Z 96.28
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.23
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.14
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.12
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.11
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.99
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.98
KOG3002 299 consensus Zn finger protein [General function pred 95.96
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.93
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.85
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.8
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 95.46
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 95.42
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.3
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.26
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.23
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.57
KOG4445 368 consensus Uncharacterized conserved protein, conta 94.03
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 94.01
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.67
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.22
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.77
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 92.56
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 92.52
KOG4739 233 consensus Uncharacterized protein involved in syna 92.43
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 92.36
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 92.1
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 91.44
KOG0297 391 consensus TNF receptor-associated factor [Signal t 91.29
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 90.98
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 90.93
PHA02862156 5L protein; Provisional 90.81
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 90.41
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 90.33
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 90.28
PF04641260 Rtf2: Rtf2 RING-finger 90.22
KOG2660 331 consensus Locus-specific chromosome binding protei 90.12
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.1
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 89.91
COG5175 480 MOT2 Transcriptional repressor [Transcription] 89.52
KOG03091081 consensus Conserved WD40 repeat-containing protein 89.17
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 88.7
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 88.42
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 88.1
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 87.99
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 87.95
KOG1002 791 consensus Nucleotide excision repair protein RAD16 87.91
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 87.43
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 87.39
COG5152259 Uncharacterized conserved protein, contains RING a 87.09
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 86.09
KOG3039303 consensus Uncharacterized conserved protein [Funct 85.88
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 85.4
PHA02825162 LAP/PHD finger-like protein; Provisional 85.28
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 84.19
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 84.12
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 84.04
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 83.42
PF14353128 CpXC: CpXC protein 83.16
COG0375115 HybF Zn finger protein HypA/HybF (possibly regulat 82.1
COG5236 493 Uncharacterized conserved protein, contains RING Z 81.67
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 80.51
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=8.5e-70  Score=495.46  Aligned_cols=241  Identities=49%  Similarity=1.041  Sum_probs=231.6

Q ss_pred             CccccccCCCCccCCccccCCceeEcCcCCCeecCCcchhhhhccCCCCCCCceecchhhhhh-----------hhcccc
Q 025186            4 SANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQV-----------AQVCTN   72 (256)
Q Consensus         4 ~~~~~~~~~~~~~GC~HY~R~cki~apcC~~~y~CR~CHde~~~~~~~~~~~H~l~r~~v~~v-----------~~~C~~   72 (256)
                      ..+++.|++.+++||+||+|+|+++||+|++||+||+||+++.        +|.++|+.|.+|           ++.|.+
T Consensus        21 ~~~~~~d~~~~~~~c~hy~r~~~~~a~ccd~~~~C~hCH~~s~--------~h~~~r~~v~~~~C~~C~~~q~~~~~c~~   92 (276)
T KOG1940|consen   21 IHSDAEDEIAFPYGCPHYRRNCKSRAPCCDREITCRHCHNESE--------DHDLDRKTVYELLCMKCRKIQPVGQICSN   92 (276)
T ss_pred             cccccccccccccCCchhhhccccccccccceeeeEEecChhh--------hcccchhhhhhhhhhhHHhhhhhhhcccc
Confidence            3566889999999999999999999999999999999999976        799999998887           779999


Q ss_pred             cCcccceeeCCccccccCCCCCCcccCCCCCccccCCccceeecCccCccccccccCcceeecCCCCCCCchhhhhhccc
Q 025186           73 CGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHHHCPICYEYLFDS  152 (256)
Q Consensus        73 Cg~~f~~y~C~~C~l~dd~~~k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~s~~l~~~H~C~e~~~~~~CPICle~lf~s  152 (256)
                      |+..||+|||.+|+||||+++ .||||+.|||||+|++++||||++|+.|+++.+.+.|+|+|++++.+||||.|+||++
T Consensus        93 c~~~~g~~~c~~C~l~dd~~~-~~~hC~~C~icr~g~~~~~fhc~~c~~c~~~~~~~~H~c~e~~~~~ncPic~e~l~~s  171 (276)
T KOG1940|consen   93 CHVELGEYYCLICKLFDDDPS-KQYHCDLCGICREGLGLDFFHCKKCKACLSAYLSNWHKCVERSSEFNCPICKEYLFLS  171 (276)
T ss_pred             chhhhhhhcCccccccccccc-ceeccccccccccccccchhHHhhhHhHHhhhcccccchhhhcccCCCchhHHHhccc
Confidence            999999999999999999999 9999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccEEeccCCccChhhHHHHhcCCCCCCCCCCccccchhHHhHHHHHHHHhcCCChhhhcCeeEEEccCCCCcceeeee
Q 025186          153 LRNTTVMKCGHTMHCECYHEMIKRDKYCCPICSKSVIDMSRTWKRIDEEIEATVMPEDYRHKKVWILCNDCNDTTEVYFH  232 (256)
Q Consensus       153 ~~~v~~LpCGH~~H~~Cl~~~~~~~~~~CPiCrksv~dm~~~~~~lD~~i~~~pmP~~y~~~~v~I~CnDC~~~s~~~fH  232 (256)
                      ...+.+|+|||.+|..||.+++..+ |+||+|.+ ++||+.+|+++|.+|+++|||++|++++++|+||||+..++++||
T Consensus       172 ~~~~~~~~CgH~~h~~cf~e~~~~~-y~CP~C~~-~~d~~~~~~~~d~~l~~~~~p~~y~~~~~~i~cndC~~~~~~k~~  249 (276)
T KOG1940|consen  172 FEDAGVLKCGHYMHSRCFEEMICEG-YTCPICSK-PGDMSHYFRKLDKELAGSPMPEEYKNKTQDILCNDCGSGTNVKYH  249 (276)
T ss_pred             cccCCccCcccchHHHHHHHHhccC-CCCCcccc-hHHHHHHHHHHHHHHhcCCCCchhhchhheeeccCCCCCCcccee
Confidence            9999999999999999999999865 99999999 999999999999999999999999999999999999999999999


Q ss_pred             EeeecCCCCCCccccccCCCCCC
Q 025186          233 IIGQKCSHCKSYNTRSIAPPVLP  255 (256)
Q Consensus       233 ~lg~kC~~C~SyNT~~~~~~~~~  255 (256)
                      ||++||+.|+|||||+++.|..+
T Consensus       250 ~l~~kc~~c~~~~~r~~~~~~~~  272 (276)
T KOG1940|consen  250 ILYHKCGKCGSYNTRMISDPSKY  272 (276)
T ss_pred             hhhhhCCCcccceeeeccCCCcc
Confidence            99999999999999999876654

>PF14599 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A Back     alignment and domain information
>PF05495 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
2dkt_A143 Solution Structure Of The Chy Zinc Finger Domain Of 3e-23
2k2c_A137 Solution Nmr Structure Of N-Terminal Domain Of Huma 2e-22
2k2d_A79 Solution Nmr Structure Of C-Terminal Domain Of Huma 7e-14
2jrj_A52 Solution Structure Of The Human Pirh2 Ring-H2 Domai 2e-04
2ecm_A55 Solution Structure Of The Ring Domain Of The Ring F 5e-04
>pdb|2DKT|A Chain A, Solution Structure Of The Chy Zinc Finger Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 143 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 77/124 (62%), Gaps = 5/124 (4%)
Query: 17  GCKHYRRRCRIRAPCCNEIFDCRHCH--NEAASMLRNPYDRHELVR-QDVKQVAQVCTNC 73
           GC+HY R C ++APCC++++ CR CH  NE   + R      + +  + ++   Q C +C
Sbjct: 18  GCEHYDRACLLKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEVQCINCEKLQHAQQTCEDC 77
Query: 74  GVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLC 133
               GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T+LR  H C
Sbjct: 78  STLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKC 135
Query: 134 IENS 137
           IE+ 
Sbjct: 136 IESG 139
>pdb|2K2C|A Chain A, Solution Nmr Structure Of N-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2a Length = 137 Back     alignment and structure
>pdb|2K2D|A Chain A, Solution Nmr Structure Of C-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2c Length = 79 Back     alignment and structure
>pdb|2JRJ|A Chain A, Solution Structure Of The Human Pirh2 Ring-H2 Domain. Northeast Structural Genomics Consortium Target Ht2b Length = 52 Back     alignment and structure
>pdb|2ECM|A Chain A, Solution Structure Of The Ring Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 55 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
2dkt_A143 Ring finger and CHY zinc finger domain- containing 7e-36
2k2d_A79 Ring finger and CHY zinc finger domain- containing 3e-30
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-13
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 2e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-04
>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Length = 143 Back     alignment and structure
 Score =  123 bits (310), Expect = 7e-36
 Identities = 53/141 (37%), Positives = 79/141 (56%), Gaps = 5/141 (3%)

Query: 2   EGSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAA--SMLRNPYDRHELV 59
            GS+       +   GC+HY R C ++APCC++++ CR CH+      + R      + +
Sbjct: 3   SGSSGGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEVQCI 62

Query: 60  RQDVKQ-VAQVCTNCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKR 118
             +  Q   Q C +C    GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +
Sbjct: 63  NCEKLQHAQQTCEDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLK 120

Query: 119 CGSCYSTSLRNNHLCIENSMH 139
           C  C +T+LR  H CIE+   
Sbjct: 121 CNLCLTTNLRGKHKCIESGPS 141
>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
2dkt_A143 Ring finger and CHY zinc finger domain- containing 100.0
2k2d_A79 Ring finger and CHY zinc finger domain- containing 99.97
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.42
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.35
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.35
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.32
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.32
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.3
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.27
2ect_A78 Ring finger protein 126; metal binding protein, st 99.27
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.26
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.22
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.22
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.21
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.2
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.15
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.14
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.13
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.11
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.03
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.03
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.03
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.03
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.01
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.96
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.96
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.94
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.94
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.93
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.92
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.91
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.9
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.88
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.88
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.87
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.87
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.87
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.87
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.86
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.86
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.85
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.81
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.81
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.78
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.74
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.62
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.57
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.57
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.54
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.52
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.52
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.47
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.41
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.37
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.36
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.34
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.34
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.33
2ea5_A68 Cell growth regulator with ring finger domain prot 98.31
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.3
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.25
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.24
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.18
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.15
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.01
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.92
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.82
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.74
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.32
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.23
3nw0_A238 Non-structural maintenance of chromosomes element 95.2
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.62
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 89.95
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 89.2
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 87.02
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 84.89
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 84.47
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 84.28
>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Back     alignment and structure
Probab=100.00  E-value=2.7e-51  Score=341.66  Aligned_cols=128  Identities=44%  Similarity=1.091  Sum_probs=119.9

Q ss_pred             CCccccccCCCCccCCccccCCceeEcCcCCCeecCCcchhhhhccCCCCCCCceecchhhhhh-----------hhccc
Q 025186            3 GSANERITFGKMGYGCKHYRRRCRIRAPCCNEIFDCRHCHNEAASMLRNPYDRHELVRQDVKQV-----------AQVCT   71 (256)
Q Consensus         3 ~~~~~~~~~~~~~~GC~HY~R~cki~apcC~~~y~CR~CHde~~~~~~~~~~~H~l~r~~v~~v-----------~~~C~   71 (256)
                      ++....+|++++++||+||+|+|+|+||||++|||||+||||++        +|+|+|+++++|           ++.|+
T Consensus         4 ~~~~~~~~~~~~~~gC~HY~r~~~lr~pCC~k~y~Cr~CHde~~--------dH~l~r~~~~~vlCg~C~~~q~~~~~C~   75 (143)
T 2dkt_A            4 GSSGGVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNE--------DHQLDRFKVKEVQCINCEKLQHAQQTCE   75 (143)
T ss_dssp             CCCCCCCCCCCCSSSCSSCCCSEEEEETTTTEEESSHHHHHHTS--------SSCCCSSSCCCEEESSSCCEECSCSBCS
T ss_pred             CCCCcccccccCcCCCcccCCCeeEECCCCCCccchhhhhcccc--------ccccchhccceeeecccCccccccCcCC
Confidence            45556789999999999999999999999999999999999976        799999988877           78999


Q ss_pred             ccCcccceeeCCccccccCCCCCCcccCCCCCccccCCccceeecCccCccccccccCcceeecCCCCC
Q 025186           72 NCGVNMGEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIENSMHH  140 (256)
Q Consensus        72 ~Cg~~f~~y~C~~C~l~dd~~~k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~s~~l~~~H~C~e~~~~~  140 (256)
                      +||+.||+|||+||||||  ++|+||||++|||||||+++|||||++||+|||++|+++|+|+|+++++
T Consensus        76 ~Cg~~f~~Y~C~~C~l~d--~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~C~e~~~~s  142 (143)
T 2dkt_A           76 DCSTLFGEYYCSICHLFD--KDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIESGPSS  142 (143)
T ss_dssp             SSCCBSCSEECSSSCCEE--CSSSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSCCCSCC
T ss_pred             CCCccceeeEeceeeccc--CCCceecCCCCCceeccCCcCcEECCcCCeeeccccCcCcccCccCccC
Confidence            999999999999999997  4699999999999999999999999999999999999999999999875
>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 256
d2dkta256 g.93.1.1 (A:82-137) RING finger and CHY zinc finge 9e-21
d2dkta174 g.89.1.1 (A:8-81) RING finger and CHY zinc finger 3e-06
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 7e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.003
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 0.003
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.003
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.004
>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 80.5 bits (199), Expect = 9e-21
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 2/58 (3%)

Query: 78  GEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIE 135
           GEY+C IC  +D D  K Q+HC+ CGICRIG +E++FHC +C  C +T+LR  H CIE
Sbjct: 1   GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE 56
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d2dkta256 RING finger and CHY zinc finger domain-containing 99.96
d2dkta174 RING finger and CHY zinc finger domain-containing 99.47
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.46
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.41
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.37
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.32
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.27
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.25
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.2
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.89
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.87
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.83
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.82
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.79
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.7
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.69
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.63
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.42
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 97.88
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 89.53
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 82.11
>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=6.6e-31  Score=184.70  Aligned_cols=56  Identities=57%  Similarity=1.450  Sum_probs=54.3

Q ss_pred             ceeeCCccccccCCCCCCcccCCCCCccccCCccceeecCccCccccccccCcceeec
Q 025186           78 GEYFCDICKFYDDDIEKGQFHCDDCGICRIGGRENYFHCKRCGSCYSTSLRNNHLCIE  135 (256)
Q Consensus        78 ~~y~C~~C~l~dd~~~k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~s~~l~~~H~C~e  135 (256)
                      |+|||+||||||||  |+||||++|||||||+++|||||++||+|||++|+++|+|+|
T Consensus         1 G~YfC~iC~l~ddd--k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~~~~l~~~H~CiE   56 (56)
T d2dkta2           1 GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE   56 (56)
T ss_dssp             CSEECSSSCCEECS--SSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSC
T ss_pred             CceECCcCCcccCC--CCcccCCCCCceeecCCccccccCccccccCcccCCCccccC
Confidence            78999999999885  999999999999999999999999999999999999999997
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure