Citrus Sinensis ID: 025220
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 256 | ||||||
| 356552668 | 342 | PREDICTED: UDP-galactose transporter 1-l | 1.0 | 0.748 | 0.926 | 1e-135 | |
| 356549087 | 342 | PREDICTED: UDP-galactose transporter 1-l | 1.0 | 0.748 | 0.918 | 1e-134 | |
| 255550574 | 342 | conserved hypothetical protein [Ricinus | 1.0 | 0.748 | 0.918 | 1e-133 | |
| 388508342 | 342 | unknown [Medicago truncatula] | 1.0 | 0.748 | 0.894 | 1e-131 | |
| 297789749 | 336 | hypothetical protein ARALYDRAFT_497286 [ | 0.996 | 0.758 | 0.918 | 1e-131 | |
| 357438617 | 342 | Solute carrier family 35 member E3 [Medi | 1.0 | 0.748 | 0.894 | 1e-131 | |
| 18411611 | 336 | EamA-like transporter [Arabidopsis thali | 0.996 | 0.758 | 0.910 | 1e-130 | |
| 297845176 | 341 | hypothetical protein ARALYDRAFT_313079 [ | 0.996 | 0.747 | 0.886 | 1e-130 | |
| 225459544 | 340 | PREDICTED: UDP-galactose transporter 1 i | 0.996 | 0.75 | 0.890 | 1e-129 | |
| 357461519 | 340 | Solute carrier family 35 member E3 [Medi | 0.988 | 0.744 | 0.890 | 1e-129 |
| >gi|356552668|ref|XP_003544685.1| PREDICTED: UDP-galactose transporter 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 486 bits (1252), Expect = e-135, Method: Compositional matrix adjust.
Identities = 238/257 (92%), Positives = 249/257 (96%), Gaps = 1/257 (0%)
Query: 1 MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVG 60
MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASL+PIVG
Sbjct: 86 MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLIPIVG 145
Query: 61 GILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLHSYKFDSINTVYYMAPFATMIL 120
GILLTSVTELSFN FGFCAAL GCLATSTKTILAESLLH YKFDSINTVYYMAPFATMIL
Sbjct: 146 GILLTSVTELSFNAFGFCAALLGCLATSTKTILAESLLHGYKFDSINTVYYMAPFATMIL 205
Query: 121 SIPALLLEGSGIMDWLSTHPSPWSAFIIIFSSGVLAFCLNFSIFYVIHSTTAVTFNVAGN 180
+IPALLLEG+G+++WLSTHP PWSA IIIFSSGVLAFCLNFSIFYVIHSTTAVTFNVAGN
Sbjct: 206 AIPALLLEGNGVLEWLSTHPYPWSALIIIFSSGVLAFCLNFSIFYVIHSTTAVTFNVAGN 265
Query: 181 LKVAVAVLVSWLIFRNPISGMNAVGCAITLIGCTFYGYIRHLLSQQPP-PGTPRTPRTPR 239
LKVAVAVLVSWLIFRNPIS +N+VGCA+TL+GCTFYGY+RHLLSQQPP PGTPRTPRTPR
Sbjct: 266 LKVAVAVLVSWLIFRNPISYLNSVGCAVTLVGCTFYGYVRHLLSQQPPVPGTPRTPRTPR 325
Query: 240 NLMELLPLVNDKLDDKV 256
N MELLPLVNDKLDDKV
Sbjct: 326 NKMELLPLVNDKLDDKV 342
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356549087|ref|XP_003542929.1| PREDICTED: UDP-galactose transporter 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255550574|ref|XP_002516337.1| conserved hypothetical protein [Ricinus communis] gi|223544567|gb|EEF46084.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388508342|gb|AFK42237.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297789749|ref|XP_002862808.1| hypothetical protein ARALYDRAFT_497286 [Arabidopsis lyrata subsp. lyrata] gi|297308543|gb|EFH39066.1| hypothetical protein ARALYDRAFT_497286 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357438617|ref|XP_003589584.1| Solute carrier family 35 member E3 [Medicago truncatula] gi|355478632|gb|AES59835.1| Solute carrier family 35 member E3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|18411611|ref|NP_565158.1| EamA-like transporter [Arabidopsis thaliana] gi|75168880|sp|Q9C521.1|UGAL1_ARATH RecName: Full=UDP-galactose transporter 1; Short=At-UDP-GalT1 gi|12323396|gb|AAG51677.1|AC010704_21 unknown protein; 76010-78007 [Arabidopsis thaliana] gi|13430498|gb|AAK25871.1|AF360161_1 unknown protein [Arabidopsis thaliana] gi|21281058|gb|AAM44935.1| unknown protein [Arabidopsis thaliana] gi|46934764|emb|CAG18176.1| UDP-galactose transporter [Arabidopsis thaliana] gi|332197879|gb|AEE36000.1| EamA-like transporter [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297845176|ref|XP_002890469.1| hypothetical protein ARALYDRAFT_313079 [Arabidopsis lyrata subsp. lyrata] gi|297336311|gb|EFH66728.1| hypothetical protein ARALYDRAFT_313079 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225459544|ref|XP_002285850.1| PREDICTED: UDP-galactose transporter 1 isoform 1 [Vitis vinifera] gi|225459546|ref|XP_002285851.1| PREDICTED: UDP-galactose transporter 1 isoform 2 [Vitis vinifera] gi|147794987|emb|CAN67423.1| hypothetical protein VITISV_006650 [Vitis vinifera] gi|302141824|emb|CBI19027.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357461519|ref|XP_003601041.1| Solute carrier family 35 member E3 [Medicago truncatula] gi|355490089|gb|AES71292.1| Solute carrier family 35 member E3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 256 | ||||||
| TAIR|locus:2204690 | 336 | AT1G77610 [Arabidopsis thalian | 0.996 | 0.758 | 0.867 | 2.7e-116 | |
| TAIR|locus:2201138 | 341 | GONST5 "golgi nucleotide sugar | 0.996 | 0.747 | 0.832 | 3.5e-114 | |
| DICTYBASE|DDB_G0287319 | 348 | DDB_G0287319 "TPT transporter | 0.847 | 0.623 | 0.371 | 2.7e-36 | |
| TAIR|locus:2166384 | 309 | AT5G05820 [Arabidopsis thalian | 0.835 | 0.692 | 0.386 | 3.6e-34 | |
| TAIR|locus:2074713 | 308 | AT3G11320 [Arabidopsis thalian | 0.835 | 0.694 | 0.386 | 1.2e-33 | |
| TAIR|locus:2034730 | 361 | AT1G12500 [Arabidopsis thalian | 0.878 | 0.623 | 0.366 | 2.3e-32 | |
| TAIR|locus:2146683 | 309 | AT5G04160 "AT5G04160" [Arabido | 0.847 | 0.702 | 0.369 | 3.7e-32 | |
| TAIR|locus:2076239 | 355 | AT3G10290 [Arabidopsis thalian | 0.847 | 0.611 | 0.351 | 4.2e-31 | |
| UNIPROTKB|A4IFK2 | 313 | SLC35E3 "Solute carrier family | 0.843 | 0.690 | 0.304 | 1.5e-26 | |
| UNIPROTKB|Q7Z769 | 313 | SLC35E3 "Solute carrier family | 0.851 | 0.696 | 0.298 | 2.5e-26 |
| TAIR|locus:2204690 AT1G77610 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1146 (408.5 bits), Expect = 2.7e-116, P = 2.7e-116
Identities = 223/257 (86%), Positives = 230/257 (89%)
Query: 1 MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVG 60
MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVG
Sbjct: 81 MSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVG 140
Query: 61 GILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLHSYKFDSINTVYYMAPFATMIL 120
GILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLH YKFDSINTVYYMAPFATMIL
Sbjct: 141 GILLTSVTELSFNMFGFCAALFGCLATSTKTILAESLLHGYKFDSINTVYYMAPFATMIL 200
Query: 121 SIPALLLEGSGIMDWLSTHPSPWSAFIIIFSSGVLAFCLNFSIFYVIHSTTAVTFNVAGN 180
IPALLLEGSGI+ W HP+PWSA III SSGVLAFCLNFSIFYVIHSTTAVTFNVAGN
Sbjct: 201 GIPALLLEGSGILSWFEAHPAPWSALIIILSSGVLAFCLNFSIFYVIHSTTAVTFNVAGN 260
Query: 181 LKVAVAVLVSWLIFRNPISGMNAVGCAITLIGCTFYGYIRHLLSQQXXXXXXXXXXXXXN 240
LKVAVAV+VSWLIFRNPIS MNAVGC ITL+GCTFYGY+RH+LSQQ
Sbjct: 261 LKVAVAVMVSWLIFRNPISYMNAVGCGITLVGCTFYGYVRHMLSQQTPGTPRTPRTPRSK 320
Query: 241 LMELLPLVN-DKLDDKV 256
MELLPLVN DKL+ KV
Sbjct: 321 -MELLPLVNNDKLEGKV 336
|
|
| TAIR|locus:2201138 GONST5 "golgi nucleotide sugar transporter 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0287319 DDB_G0287319 "TPT transporter family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166384 AT5G05820 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074713 AT3G11320 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034730 AT1G12500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146683 AT5G04160 "AT5G04160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076239 AT3G10290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4IFK2 SLC35E3 "Solute carrier family 35 member E3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z769 SLC35E3 "Solute carrier family 35 member E3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 256 | |||
| pfam03151 | 149 | pfam03151, TPT, Triose-phosphate Transporter famil | 2e-24 | |
| TIGR00817 | 302 | TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate | 8e-22 | |
| PTZ00343 | 350 | PTZ00343, PTZ00343, triose or hexose phosphate/pho | 2e-20 | |
| pfam08449 | 303 | pfam08449, UAA, UAA transporter family | 4e-12 | |
| COG0697 | 292 | COG0697, RhaT, Permeases of the drug/metabolite tr | 5e-05 | |
| TIGR00950 | 260 | TIGR00950, 2A78, Carboxylate/Amino Acid/Amine Tran | 4e-04 | |
| COG5070 | 309 | COG5070, VRG4, Nucleotide-sugar transporter [Carbo | 0.002 |
| >gnl|CDD|217390 pfam03151, TPT, Triose-phosphate Transporter family | Back alignment and domain information |
|---|
Score = 94.5 bits (236), Expect = 2e-24
Identities = 44/149 (29%), Positives = 76/149 (51%), Gaps = 6/149 (4%)
Query: 76 GFCAALFGCLATSTKTILAESLLHS---YKFDSINTVYYMAPFATMILSIPALLLEGSGI 132
GF AL + + IL++ LL K + + +YY++P A ++L L EG +
Sbjct: 1 GFILALAASALFALRLILSQKLLKKKKGTKLNVLELLYYLSPVAFIVLLPGLLFSEGFKL 60
Query: 133 M---DWLSTHPSPWSAFIIIFSSGVLAFCLNFSIFYVIHSTTAVTFNVAGNLKVAVAVLV 189
+++ SGVLAF N S F ++ T+ +T +VAG +K V +++
Sbjct: 61 GKFILKFFGDLKTSRYVLLLLLSGVLAFLYNLSAFGLLGRTSPLTSSVAGTVKRVVVIVL 120
Query: 190 SWLIFRNPISGMNAVGCAITLIGCTFYGY 218
S +IF +P++ +N +G AI ++G Y Y
Sbjct: 121 SVIIFGDPVTFLNILGLAIAILGVVLYSY 149
|
This family includes transporters with a specificity for triose phosphate. Length = 149 |
| >gnl|CDD|129898 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >gnl|CDD|240371 PTZ00343, PTZ00343, triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219846 pfam08449, UAA, UAA transporter family | Back alignment and domain information |
|---|
| >gnl|CDD|223769 COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233205 TIGR00950, 2A78, Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >gnl|CDD|227402 COG5070, VRG4, Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 256 | |||
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 99.97 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 99.96 | |
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 99.96 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 99.95 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 99.94 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 99.94 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 99.92 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 99.92 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 99.92 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 99.91 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 99.89 | |
| KOG1444 | 314 | consensus Nucleotide-sugar transporter VRG4/SQV-7 | 99.89 | |
| KOG1443 | 349 | consensus Predicted integral membrane protein [Fun | 99.88 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 99.88 | |
| KOG1442 | 347 | consensus GDP-fucose transporter [Carbohydrate tra | 99.87 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 99.85 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 99.82 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 99.81 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 99.81 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 99.81 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 99.81 | |
| KOG3912 | 372 | consensus Predicted integral membrane protein [Gen | 99.8 | |
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 99.78 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 99.78 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 99.78 | |
| COG5070 | 309 | VRG4 Nucleotide-sugar transporter [Carbohydrate tr | 99.76 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 99.75 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 99.74 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 99.74 | |
| KOG1583 | 330 | consensus UDP-N-acetylglucosamine transporter [Car | 99.69 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 99.63 | |
| KOG2766 | 336 | consensus Predicted membrane protein [Function unk | 99.61 | |
| KOG1582 | 367 | consensus UDP-galactose transporter related protei | 99.6 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 99.4 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 99.32 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 99.3 | |
| KOG4314 | 290 | consensus Predicted carbohydrate/phosphate translo | 99.27 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 99.09 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 99.06 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 98.94 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 98.93 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 98.92 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 98.66 | |
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 98.56 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 98.55 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 98.54 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 98.52 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 98.5 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 98.47 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 98.46 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.43 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 98.35 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 98.31 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 98.31 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.28 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 98.2 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 98.14 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 98.13 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 98.13 | |
| PF04657 | 138 | DUF606: Protein of unknown function, DUF606; Inter | 98.06 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 98.01 | |
| KOG2922 | 335 | consensus Uncharacterized conserved protein [Funct | 97.96 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 97.95 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 97.9 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 97.82 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 97.72 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 97.69 | |
| PF07857 | 254 | DUF1632: CEO family (DUF1632); InterPro: IPR012435 | 97.66 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 97.64 | |
| COG4975 | 288 | GlcU Putative glucose uptake permease [Carbohydrat | 97.6 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 97.52 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 97.52 | |
| COG3238 | 150 | Uncharacterized protein conserved in bacteria [Fun | 97.47 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 97.37 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 97.34 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 97.31 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 97.25 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 97.25 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 97.18 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 97.11 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 97.08 | |
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 97.0 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 96.96 | |
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 96.9 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 96.67 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 96.38 | |
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 96.31 | |
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 95.61 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 95.51 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 95.33 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 95.3 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 95.07 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 94.26 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 93.44 | |
| COG4975 | 288 | GlcU Putative glucose uptake permease [Carbohydrat | 93.43 | |
| PF06379 | 344 | RhaT: L-rhamnose-proton symport protein (RhaT); In | 93.06 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 93.02 | |
| KOG4314 | 290 | consensus Predicted carbohydrate/phosphate translo | 92.63 | |
| KOG3912 | 372 | consensus Predicted integral membrane protein [Gen | 90.54 | |
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 87.45 | |
| PRK02237 | 109 | hypothetical protein; Provisional | 84.4 | |
| KOG2922 | 335 | consensus Uncharacterized conserved protein [Funct | 84.1 | |
| KOG1444 | 314 | consensus Nucleotide-sugar transporter VRG4/SQV-7 | 82.82 | |
| PF02694 | 107 | UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; | 82.69 | |
| PF02694 | 107 | UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; | 82.15 | |
| COG1742 | 109 | Uncharacterized conserved protein [Function unknow | 81.92 | |
| PF07168 | 336 | Ureide_permease: Ureide permease; InterPro: IPR009 | 81.76 | |
| PRK02237 | 109 | hypothetical protein; Provisional | 81.1 | |
| PF08507 | 136 | COPI_assoc: COPI associated protein; InterPro: IPR | 80.83 |
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
Probab=99.97 E-value=3.8e-30 Score=216.55 Aligned_cols=222 Identities=28% Similarity=0.455 Sum_probs=184.2
Q ss_pred chHHHHHHHhhhhhccccchhHHHHHHHHHHHHHHHHHHHHhccccChhhhhhhhhhhhceeEeeecccccchhhHHHHH
Q 025220 2 SFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTVVLQWLVWRKYFDWRIWASLVPIVGGILLTSVTELSFNMFGFCAAL 81 (256)
Q Consensus 2 ~~~~~~~~~~~~~al~~~~~~~~~ii~~~~pi~~~i~~~i~~~~~~~~~~~~~~~l~~~Gv~~~~~~~~~~~~~g~~~~l 81 (256)
|++++....+.|.+++|++++++++++++.|+++++++++++|||++++++.+++++++|+.+....+.+.+..|+++++
T Consensus 72 g~~~~~~~~~~~~~l~~~s~s~~~li~~~~Pv~~~ll~~~~~~e~~~~~~~~~l~l~~~Gv~l~~~~~~~~~~~G~~~~l 151 (302)
T TIGR00817 72 AIVHTIGHVTSNVSLSKVAVSFTHTIKAMEPFFSVVLSAFFLGQEFPSTLWLSLLPIVGGVALASDTELSFNWAGFLSAM 151 (302)
T ss_pred HHHHHHHHHHHHHHHHhccHHHHHHHHhcchHHHHHHHHHHhCCCCcHHHHHHHHHHHHHHhhhcCCcccccHHHHHHHH
Confidence 67788999999999999999999999999999999999999999999999999999999998876666666778999999
Q ss_pred HHHHHHHHHHHHHHHHhccCCCChHHHHHHHhHHHHHHHHHHHHHhcCcchh--hhhcc--CCCChhHHHHHHHHHH-HH
Q 025220 82 FGCLATSTKTILAESLLHSYKFDSINTVYYMAPFATMILSIPALLLEGSGIM--DWLST--HPSPWSAFIIIFSSGV-LA 156 (256)
Q Consensus 82 ~a~~~~a~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~~~~~~~~-~~ 156 (256)
.+++++|++.++.||..++++.|+.++..|+...+.+.++|.....|+.+.. ++... .......+......+. +.
T Consensus 152 ~a~~~~a~~~v~~k~~~~~~~~~~~~~~~~~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 231 (302)
T TIGR00817 152 ISNITFVSRNIFSKKAMTIKSLDKTNLYAYISIMSLFLLSPPAFITEGPPFLPHGFMQAISGVNVTKIYTVSLVAAMGFF 231 (302)
T ss_pred HHHHHHHHHHHHHHHhhccCCCCcccHHHHHHHHHHHHHHHHHHHHcchHHHHHHHHHhhcccCchHHHHHHHHHHHHHH
Confidence 9999999999999998765568999999999999999999988776654321 11110 0011112222323333 33
Q ss_pred HHHHHHHHHHhhccChhHHHHHhhhhHHHHHHHHHhhccCcccchhhhhHHHHHHHHHHHHhhhccc
Q 025220 157 FCLNFSIFYVIHSTTAVTFNVAGNLKVAVAVLVSWLIFRNPISGMNAVGCAITLIGCTFYGYIRHLL 223 (256)
Q Consensus 157 ~~~~~~~~~~~~~~~~~~~s~~~~l~~v~~~l~~~~l~~e~~s~~~~~G~~li~~g~~~~~~~~~~~ 223 (256)
...+...+..+++++|.++++..+++|++++++|++++||++++.+++|+++++.|+.+|++.|.+|
T Consensus 232 ~~~~~~~~~~l~~~sa~t~sv~~~l~pv~~~~~~~~~lge~lt~~~~~G~~lil~Gv~l~~~~k~~~ 298 (302)
T TIGR00817 232 HFYQQVAFMLLGRVSPLTHSVGNCMKRVVVIVVSILFFGTKISPQQVFGTGIAIAGVFLYSRVKAQK 298 (302)
T ss_pred HHHHHHHHHHHccCCchHHHHHhhhhhhheeeeehhhcCCCCchhHHHHHHHHHHHHHHHHHHhccC
Confidence 3455667788999999999999999999999999999999999999999999999999999765433
|
specificities overlap. |
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1443 consensus Predicted integral membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >KOG1442 consensus GDP-fucose transporter [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >KOG3912 consensus Predicted integral membrane protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >KOG1583 consensus UDP-N-acetylglucosamine transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2766 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1582 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2922 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >PF07857 DUF1632: CEO family (DUF1632); InterPro: IPR012435 These sequences are found in hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >COG3238 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF06379 RhaT: L-rhamnose-proton symport protein (RhaT); InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3912 consensus Predicted integral membrane protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02237 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2922 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1444 consensus Nucleotide-sugar transporter VRG4/SQV-7 [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF02694 UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; InterPro: IPR003844 This entry describes integral membrane proteins of unknown function | Back alignment and domain information |
|---|
| >PF02694 UPF0060: Uncharacterised BCR, YnfA/UPF0060 family; InterPro: IPR003844 This entry describes integral membrane proteins of unknown function | Back alignment and domain information |
|---|
| >COG1742 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07168 Ureide_permease: Ureide permease; InterPro: IPR009834 This entry represents ureide permease, which transports a wide spectrum of oxo derivatives of heterocyclic nitrogen compounds, including allantoin, uric acid and xanthine, but not adenine | Back alignment and domain information |
|---|
| >PRK02237 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08507 COPI_assoc: COPI associated protein; InterPro: IPR013714 Proteins in this family co-localise with COPI vesicle coat proteins [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 256 | |||
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 98.78 | |
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 98.33 | |
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 98.27 | |
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 98.26 |
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Probab=98.78 E-value=1.2e-08 Score=74.18 Aligned_cols=61 Identities=10% Similarity=0.168 Sum_probs=42.7
Q ss_pred HHHHHHHhhccChhHHHHH-hhhhHHHHHHHHHhhccCcccchhhhhHHHHHHHHHHHHhhh
Q 025220 160 NFSIFYVIHSTTAVTFNVA-GNLKVAVAVLVSWLIFRNPISGMNAVGCAITLIGCTFYGYIR 220 (256)
Q Consensus 160 ~~~~~~~~~~~~~~~~s~~-~~l~~v~~~l~~~~l~~e~~s~~~~~G~~li~~g~~~~~~~~ 220 (256)
.++....+++.++..+..+ ..+.|+++.++++++++|++++.+++|++++++|+++.+..+
T Consensus 44 ~~l~~~alk~i~~s~ay~iw~~l~pv~~~l~g~l~lgE~ls~~~~~Gi~LIi~GV~ll~~~~ 105 (137)
T 2i68_A 44 FWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS 105 (137)
T ss_dssp HHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC-
T ss_pred HHHHHHHHHhCChhHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHhcCC
Confidence 3455567899999977777 899999999999999999999999999999999999987543
|
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00