Citrus Sinensis ID: 025340

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MVIVGFLQMGKGASLMGNRNLETGNQINIQSSNLPLNVNGARMNQHPLARQQHNQQTQQQPQQPQIFPKQPAMAYATQMPLQSSPGIKSGIVGVGDQAMNGNLIHGGALQGGGMGMVGLGAPPVGVSSGSPANQLSSDGIGKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEMMNMQQGGKRRCLRRTQTGPW
cccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
cEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEcccccc
MVIVGFLqmgkgaslmgnrnletgnqiniqssnlplnvngarmnqhplarqqhnqqtqqqpqqpqifpkqpamayatqmplqsspgiksgivgvgdqamngnlihggalqgggmgmvglgappvgvssgspanqlssdgigksngdtssvspvpymfngslrgrrfngnVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEMMNMqqggkrrclrrtqtgpw
MVIVGFLQMGKGASLMGNRNLETGNQINIQSSNLPLNVNGARMNQHPLARQQHNQQTQQQPQQPQIFPKQPAMAYATQMPLQSSPGIKSGIVGVGDQAMNGNLIHGGALQGGGMGMVGLGAPPVGVSSGSPANQLSSDGIGksngdtssvspVPYMfngslrgrrfngnvekvverrqrrmiknresaarsrarkqaYTMELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEMmnmqqggkrrclrrtqtgpw
MVIVGFLQMGKGASLMGNRNLETGNQINIQSSNLPLNVNGARMNQHPLARqqhnqqtqqqpqqpqifpkqpAMAYATQMPLQSSPGIKSGIVGVGDQAMNGNLIHggalqgggmgmvglgappvgVSSGSPANQLSSDGIGKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRRMIKNRESAARSRARKQAYTMeleaevaklkeeneelrkkQDEMMEMQKNQVLEMMNMQQGGKRRCLRRTQTGPW
***VGFL**********************************************************************************GIVGVGDQAMNGNLIHGGALQGGGMGMVGL***************************************************************************************************************************************
*VIVGF*******************************************************************************************************************************************************************************************RKQAYTMELEAEVAKLKEENE*********************************RTQT***
MVIVGFLQMGKGASLMGNRNLETGNQINIQSSNLPLNVNGARMNQHP*******************FPKQPAMAYATQMPLQSSPGIKSGIVGVGDQAMNGNLIHGGALQGGGMGMVGLGAPPVGVSSGSPANQLSSDGIGKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRRMIK**************YTMELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEMMNMQQGGKRRCLRRTQTGPW
MVIVGFLQMGKGASLMGNR****GNQINIQSSNLPLNVNGA***********************QIFPKQPAMAYATQMPLQSSPGIKSGIVGVGDQAMNGNLIHGGALQGGGMGMVGLGAPPVGVSSGSPANQLSSDGIGKSNGDTSSVSPVPYMFNGSL********VEKVV********KNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEMMNMQQGGKRRC*RRT*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIVGFLQMGKGASLMGNRNLETGNQINIQSSNLPLNVNGARMNQHPLARQQHNQQTQQQPQQPQIFPKQPAMAYATQMPLQSSPGIKSGIVGVGDQAMNGNLIHGGALQGGGMGMVGLGAPPVGVSSGSPANQLSSDGIGKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRRMIKNRESAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQVLEMMNMQQGGKRRCLRRTQTGPW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
Q9M7Q4416 ABSCISIC ACID-INSENSITIVE yes no 0.874 0.533 0.588 8e-66
Q6ZDF3318 bZIP transcription factor yes no 0.602 0.481 0.616 3e-42
Q9M7Q3454 ABSCISIC ACID-INSENSITIVE no no 0.681 0.381 0.507 3e-41
Q9M7Q2431 ABSCISIC ACID-INSENSITIVE no no 0.665 0.392 0.485 1e-38
Q9M7Q5392 ABSCISIC ACID-INSENSITIVE no no 0.625 0.405 0.435 2e-29
Q9SJN0442 Protein ABSCISIC ACID-INS no no 0.496 0.285 0.456 8e-21
Q9FMM7370 ABSCISIC ACID-INSENSITIVE no no 0.582 0.4 0.397 2e-16
Q9LES3297 ABSCISIC ACID-INSENSITIVE no no 0.303 0.259 0.564 4e-16
Q9C5Q2262 ABSCISIC ACID-INSENSITIVE no no 0.192 0.187 0.795 1e-14
Q84JK2285 Protein FD OS=Arabidopsis no no 0.381 0.340 0.467 2e-14
>sp|Q9M7Q4|AI5L5_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arabidopsis thaliana GN=ABF2 PE=1 SV=1 Back     alignment and function desciption
 Score =  250 bits (638), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 143/243 (58%), Positives = 175/243 (72%), Gaps = 21/243 (8%)

Query: 13  ASLMGNRNLETGNQINIQSSNLPLNVNGARMNQHPLARQQHNQQTQQQPQQPQIFPKQPA 72
           A +MGN   ET N + +Q S+LPLNVNGAR          + Q  QQQP    I PKQP 
Sbjct: 194 AGVMGNLGAETANSLQVQGSSLPLNVNGARTT--------YQQSQQQQP----IMPKQPG 241

Query: 73  MAYATQMPLQSSPGIKSG-IVGVGDQAMNGNLIHGGALQGGGMGMVGLGAPPVGVSSGSP 131
             Y TQM   +SPGI+ G +VG+GDQ++  N+   G +QG    + G     +GV + SP
Sbjct: 242 FGYGTQMGQLNSPGIRGGGLVGLGDQSLTNNV---GFVQGASAAIPG----ALGVGAVSP 294

Query: 132 ANQLSSDGIGKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRRMIKNRESAARS 191
              LSS+GIGKSNGD+SS+SP PYMFNG +RGR+ +G VEKVVERRQRRMIKNRESAARS
Sbjct: 295 VTPLSSEGIGKSNGDSSSLSPSPYMFNGGVRGRK-SGTVEKVVERRQRRMIKNRESAARS 353

Query: 192 RARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEMMNMQQGGKRRCLRRTQT 251
           RARKQAYT+ELEAEVAKLKEEN+EL++KQ  +MEMQKNQ  EM N+ QGG ++ LRRT++
Sbjct: 354 RARKQAYTVELEAEVAKLKEENDELQRKQARIMEMQKNQETEMRNLLQGGPKKKLRRTES 413

Query: 252 GPW 254
           GPW
Sbjct: 414 GPW 416
Involved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6ZDF3|TRAB1_ORYSJ bZIP transcription factor TRAB1 OS=Oryza sativa subsp. japonica GN=TRAB1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M7Q3|AI5L6_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 6 OS=Arabidopsis thaliana GN=ABF3 PE=1 SV=1 Back     alignment and function description
>sp|Q9M7Q2|AI5L7_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 7 OS=Arabidopsis thaliana GN=ABF4 PE=1 SV=1 Back     alignment and function description
>sp|Q9M7Q5|AI5L4_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 4 OS=Arabidopsis thaliana GN=ABF1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SJN0|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana GN=ABI5 PE=1 SV=1 Back     alignment and function description
>sp|Q9FMM7|AI5L8_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 8 OS=Arabidopsis thaliana GN=BZIP15 PE=2 SV=1 Back     alignment and function description
>sp|Q9LES3|AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2 OS=Arabidopsis thaliana GN=DPBF3 PE=1 SV=1 Back     alignment and function description
>sp|Q9C5Q2|AI5L3_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 3 OS=Arabidopsis thaliana GN=DPBF4 PE=1 SV=1 Back     alignment and function description
>sp|Q84JK2|FD_ARATH Protein FD OS=Arabidopsis thaliana GN=FD PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
224067260 456 predicted protein [Populus trichocarpa] 0.850 0.473 0.706 1e-77
357465529 431 ABSCISIC ACID-INSENSITIVE 5-like protein 0.952 0.561 0.632 6e-75
110749701 423 bZIP transcription factor [Caragana kors 0.862 0.517 0.685 1e-73
449450227 411 PREDICTED: ABSCISIC ACID-INSENSITIVE 5-l 0.846 0.523 0.648 5e-72
350538377 447 AREB-like protein [Solanum lycopersicum] 0.909 0.516 0.677 3e-71
375155309 442 ABA responsive element-binding protein [ 0.984 0.565 0.615 2e-70
302777037 453 ABRE binding factor [Solanum tuberosum] 0.909 0.509 0.653 1e-68
94503774 406 abscisic acid responsive element-binding 0.885 0.554 0.681 5e-68
224136776 408 predicted protein [Populus trichocarpa] 0.893 0.556 0.681 3e-67
225458629 447 PREDICTED: ripening-related bZIP protein 0.984 0.559 0.661 1e-65
>gi|224067260|ref|XP_002302435.1| predicted protein [Populus trichocarpa] gi|222844161|gb|EEE81708.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 166/235 (70%), Positives = 185/235 (78%), Gaps = 19/235 (8%)

Query: 20  NLETGNQINIQSSNLPLNVNGARMNQHPLARQQHNQQTQQQPQQPQIFPKQPAMAYATQM 79
           N +  NQI++QSSNLPLNVNG R           NQ   QQ QQ QIFPKQP M Y TQM
Sbjct: 241 NNDNTNQISLQSSNLPLNVNGVR----------SNQAQVQQQQQQQIFPKQPNMGYVTQM 290

Query: 80  PLQSSPGIKSGIVGVGDQAMNGNLIHGGALQGGGMGMVGLGAPPVGVSSGSPANQLSSDG 139
           PLQS PGI+ G++G+GDQ ++  L+ GG +   G+G +         ++GSPANQLSSDG
Sbjct: 291 PLQSGPGIRGGMLGIGDQGIDSGLMQGGGMGVVGLGGI---------ATGSPANQLSSDG 341

Query: 140 IGKSNGDTSSVSPVPYMFNGSLRGRRFNGNVEKVVERRQRRMIKNRESAARSRARKQAYT 199
           IGKSNGDTSSVSPVPY+F  S+RGRR  G VEKVVERRQRRMIKNRESAARSRARKQAYT
Sbjct: 342 IGKSNGDTSSVSPVPYVFRESVRGRRPGGAVEKVVERRQRRMIKNRESAARSRARKQAYT 401

Query: 200 MELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEMMNMQQGGKRRCLRRTQTGPW 254
           MELEAEVAKLKEENEELRKKQ EMME+QKNQV EMMNMQQGGK+RCLRRTQTGPW
Sbjct: 402 MELEAEVAKLKEENEELRKKQAEMMEIQKNQVAEMMNMQQGGKKRCLRRTQTGPW 456

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357465529|ref|XP_003603049.1| ABSCISIC ACID-INSENSITIVE 5-like protein [Medicago truncatula] gi|355492097|gb|AES73300.1| ABSCISIC ACID-INSENSITIVE 5-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|110749701|gb|ABG90380.1| bZIP transcription factor [Caragana korshinskii] Back     alignment and taxonomy information
>gi|449450227|ref|XP_004142865.1| PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|350538377|ref|NP_001234596.1| AREB-like protein [Solanum lycopersicum] gi|42561991|gb|AAS20434.1| AREB-like protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|375155309|gb|AFA37978.1| ABA responsive element-binding protein [Solanum torvum] Back     alignment and taxonomy information
>gi|302777037|gb|ADL70202.1| ABRE binding factor [Solanum tuberosum] Back     alignment and taxonomy information
>gi|94503774|gb|ABF29696.1| abscisic acid responsive element-binding protein 2 [Populus suaveolens] Back     alignment and taxonomy information
>gi|224136776|ref|XP_002326942.1| predicted protein [Populus trichocarpa] gi|222835257|gb|EEE73692.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458629|ref|XP_002284785.1| PREDICTED: ripening-related bZIP protein-like isoform 1 [Vitis vinifera] gi|7406677|emb|CAB85632.1| putative ripening-related bZIP protein [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
UNIPROTKB|Q6ZDF3318 TRAB1 "bZIP transcription fact 0.460 0.367 0.595 6.2e-33
TAIR|locus:2118969454 ABF3 "AT4G34000" [Arabidopsis 0.629 0.352 0.440 2.9e-26
TAIR|locus:2049425442 ABI5 "ABA INSENSITIVE 5" [Arab 0.476 0.273 0.393 6.4e-14
TAIR|locus:2159986370 AT5G42910 "AT5G42910" [Arabido 0.464 0.318 0.379 2.3e-11
UNIPROTKB|Q8RZ35388 P0489B03.11 "Putative ABA resp 0.456 0.298 0.381 1.1e-10
TAIR|locus:2103665297 AREB3 "ABA-responsive element 0.334 0.286 0.425 1.4e-08
TAIR|locus:2076018331 DPBF2 "AT3G44460" [Arabidopsis 0.370 0.283 0.346 1.8e-08
TAIR|locus:2063275262 EEL "AT2G41070" [Arabidopsis t 0.141 0.137 0.810 4.1e-08
TAIR|locus:2172507315 AT5G44080 [Arabidopsis thalian 0.169 0.136 0.608 1.1e-05
TAIR|locus:2024224270 GBF4 "G-box binding factor 4" 0.145 0.137 0.648 0.00011
UNIPROTKB|Q6ZDF3 TRAB1 "bZIP transcription factor TRAB1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 6.2e-33, Sum P(2) = 6.2e-33
 Identities = 75/126 (59%), Positives = 83/126 (65%)

Query:   138 DGIGKSNGDTSS-VSPVPYMFNGSLRGRRFNGNVEKVVERRQRRMIKNRESAARSRARKQ 196
             D  GK +GD SS ++PVPY F G +RGRR  GNVEKVVERRQRRMIKNRESAARSRARKQ
Sbjct:   193 DSAGKGDGDLSSPMAPVPYPFEGVIRGRRSGGNVEKVVERRQRRMIKNRESAARSRARKQ 252

Query:   197 AYTMXXXXXXXXXXXXXXXXXXXQDEMMEMQKN--------QVLEMMNMQQGGKRRCLRR 248
             AYTM                   Q+E+MEMQKN        QVLE +N   G K+RCLRR
Sbjct:   253 AYTMELEAEVQKLKEQNMELQKKQEEIMEMQKNFFPEMQKNQVLEAVNNPYGQKKRCLRR 312

Query:   249 TQTGPW 254
             T TGPW
Sbjct:   313 TLTGPW 318
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IDA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=IDA
GO:0044212 "transcription regulatory region DNA binding" evidence=IDA
TAIR|locus:2118969 ABF3 "AT4G34000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049425 ABI5 "ABA INSENSITIVE 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159986 AT5G42910 "AT5G42910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8RZ35 P0489B03.11 "Putative ABA response element binding factor" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2103665 AREB3 "ABA-responsive element binding protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076018 DPBF2 "AT3G44460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063275 EEL "AT2G41070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172507 AT5G44080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024224 GBF4 "G-box binding factor 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00021164
hypothetical protein (456 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
smart0033865 smart00338, BRLZ, basic region leucin zipper 8e-17
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 2e-14
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 9e-10
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 1e-08
pfam00769 244 pfam00769, ERM, Ezrin/radixin/moesin family 0.003
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 72.2 bits (178), Expect = 8e-17
 Identities = 25/64 (39%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 175 ERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKNQVLEM 234
           E+R+RR  +NRE+A RSR RK+A   ELE +V +L+ ENE L+K+ + +   ++ + L+ 
Sbjct: 4   EKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERL--RRELEKLKS 61

Query: 235 MNMQ 238
              +
Sbjct: 62  ELEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
KOG3584348 consensus cAMP response element binding protein an 99.43
smart0033865 BRLZ basic region leucin zipper. 99.36
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.29
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.25
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.19
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.12
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 99.09
KOG4571294 consensus Activating transcription factor 4 [Trans 98.26
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.12
KOG0837279 consensus Transcriptional activator of the JUN fam 97.88
KOG3119269 consensus Basic region leucine zipper transcriptio 97.8
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.8
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.47
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 96.11
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 95.23
KOG3119269 consensus Basic region leucine zipper transcriptio 89.18
KOG1318411 consensus Helix loop helix transcription factor EB 88.35
PRK00888105 ftsB cell division protein FtsB; Reviewed 86.6
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 86.56
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 85.29
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 84.7
PHA03155115 hypothetical protein; Provisional 83.16
PHA03162135 hypothetical protein; Provisional 82.88
PF05812118 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: 82.83
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 82.51
PRK10884206 SH3 domain-containing protein; Provisional 82.44
PF15058 200 Speriolin_N: Speriolin N terminus 81.83
TIGR0244965 conserved hypothetical protein TIGR02449. Members 81.16
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 80.92
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information 
Probab=99.43  E-value=1.1e-12  Score=122.25  Aligned_cols=59  Identities=32%  Similarity=0.513  Sum_probs=54.8

Q ss_pred             CcchhHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025340          168 GNVEKVVERRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEM  226 (254)
Q Consensus       168 ~~~e~~eeRRqRRmiKNRESA~RSR~RKKayleeLE~eV~~Le~EN~eLk~ql~eL~e~  226 (254)
                      ...|+...||+-|+.||||+|++||+|||||+.|||.+|..||..|..|.++++.|++.
T Consensus       283 ~~aee~trKRevRLmKNREAARECRRKKKEYVKCLENRVAVLENQNKaLIEELKtLKeL  341 (348)
T KOG3584|consen  283 QGAEEATRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKALIEELKTLKEL  341 (348)
T ss_pred             ccchhhhhHHHHHHHhhHHHHHHHHHhHhHHHHHHHhHHHHHhcccHHHHHHHHHHHHH
Confidence            44567779999999999999999999999999999999999999999999999999875

>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>PHA03155 hypothetical protein; Provisional Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information
>PF05812 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: IPR008642 This family consists of several herpes virus BLRF2 tegument proteins Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 5e-18
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 6e-13
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 7e-12
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 9e-12
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 3e-11
2wt7_B90 Transcription factor MAFB; transcription, transcri 9e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-08
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 4e-08
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 4e-07
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 9e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 9e-06
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 5e-05
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 74.4 bits (183), Expect = 5e-18
 Identities = 18/55 (32%), Positives = 35/55 (63%)

Query: 176 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEMQKNQ 230
           +R+ R++KNRE+A  SR +K+ Y   LE  VA L+ +N+ L ++   + ++  ++
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLYSHK 55
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.56
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.51
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.39
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.3
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.3
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.08
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.92
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.89
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.39
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.36
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.06
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 96.55
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 96.43
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 94.96
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 94.36
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 94.08
3m48_A33 General control protein GCN4; leucine zipper, synt 93.79
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.96
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 92.65
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.41
2bni_A34 General control protein GCN4; four helix bundle, a 91.34
1uo4_A34 General control protein GCN4; four helix bundle, c 90.87
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 90.86
2hy6_A34 General control protein GCN4; protein design, para 90.33
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 88.28
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 88.04
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 85.21
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 85.04
1gmj_A84 ATPase inhibitor; coiled-coil structure, P depende 84.7
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 84.39
2wuj_A57 Septum site-determining protein diviva; bacterial 84.31
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 82.82
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 82.17
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 81.42
1dip_A78 Delta-sleep-inducing peptide immunoreactive peptid 81.35
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 81.02
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 80.29
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 80.03
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.56  E-value=5.3e-15  Score=105.70  Aligned_cols=51  Identities=35%  Similarity=0.591  Sum_probs=48.3

Q ss_pred             HHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025340          176 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENEELRKKQDEMMEM  226 (254)
Q Consensus       176 RRqRRmiKNRESA~RSR~RKKayleeLE~eV~~Le~EN~eLk~ql~eL~e~  226 (254)
                      ||++||++||+||++||.||++|+++||.+|..|+.||..|..+++.|.+.
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~   51 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDL   51 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            588999999999999999999999999999999999999999999988753
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1gmj_A ATPase inhibitor; coiled-coil structure, P dependent oligomerization, ATP hydrolysis; 2.2A {Bos taurus} SCOP: h.4.8.1 PDB: 1ohh_H* 1hf9_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 92.39
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 82.75
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 81.01
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 80.62
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=92.39  E-value=0.028  Score=40.80  Aligned_cols=31  Identities=26%  Similarity=0.313  Sum_probs=25.2

Q ss_pred             hhHHHHHHHHHHHhhHHHHHHHHHHHHHHHH
Q 025340          171 EKVVERRQRRMIKNRESAARSRARKQAYTME  201 (254)
Q Consensus       171 e~~eeRRqRRmiKNRESA~RSR~RKKaylee  201 (254)
                      -...-+-.||.=|||.+|++||+||-...++
T Consensus        43 Ql~lirDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          43 QRQLIRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            3445678899999999999999999876543
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure