Citrus Sinensis ID: 025358

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----

MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDKGGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSSWREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSCFADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQVGFSSISIIPRFRSYLVVCCQNRAIFVP

ccHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHcccEEEEcccEEEEEEccccccccEEEEEEEEcccccEEEEccEEEEccccccHHccccccccccHHHHHHcccccccEEEEEEEEcccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHccccccccccEEEEEEEcccEEcc

cHHHHHHHHccccHHHHcHHHHHHHHHHHHHHccccHHHHHccccHHHHcHHHHHHHHHcccEEEEcccEEEEEEcccccccEEEEEEEEEccccccEEEEEEEEEEcccHHHHHHccHHHHccHHHHHHHcccccEEEEEEEEEcccEEccccHHHHHHHHHHcccccEEEccccccEEEHHHHccccHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEcccccEEEcc

MWDPVAYalgfidcdniSARCMLTIFALFATKTEASLLRMLkgspdvylsgpirkyitdkggrfhlrwgCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVaacdvpgikrllpssWREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGldnllytpdadfscfadlaltspedyyregqgsllqcvltpgdpymplpndEIIRRVAKQvgfssisiipRFRSYLVVCCqnraifvp

MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKgspdvylsgpiRKYITDKGGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSSWREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSCFADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQVGFSsisiiprfrsYLVVCCQNRAIFVP

**DPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDKGGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSSWREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSCFADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQVGFSSISIIPRFRSYLVVCCQNRAIFV*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		254	2.2.26 [Sep-21-2011]
Q9FV46		587	Zeta-carotene desaturase,	N/A	no	0.893	0.386	0.881	1e-120
Q9SE20		588	Zeta-carotene desaturase,	N/A	no	0.893	0.386	0.863	1e-118
Q9SMJ3		588	Zeta-carotene desaturase,	N/A	no	0.893	0.386	0.863	1e-118
O49901		574	Zeta-carotene desaturase,	N/A	no	0.893	0.395	0.859	1e-117
Q38893		558	Zeta-carotene desaturase,	yes	no	0.893	0.406	0.837	1e-115
Q9ZTP4		570	Zeta-carotene desaturase,	N/A	no	0.944	0.421	0.778	1e-113
P74306		489	Zeta-carotene desaturase	N/A	no	0.889	0.462	0.631	5e-80
Q9R6X4		479	Zeta-carotene desaturase	yes	no	0.889	0.471	0.607	1e-79
Q31N27		481	Probable zeta-carotene de	yes	no	0.889	0.469	0.616	8e-79
P29273		472	Phytoene dehydrogenase OS	N/A	no	0.799	0.430	0.299	1e-22

>sp\|Q9FV46\|ZDS_TARER Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Tagetes erecta PE=2 SV=1	Back alignment and function desciption

 Score =  430 bits (1105), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/227 (88%), Positives = 215/227 (94%)

Query: 1   MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDK 60
           MWDPVAYALGFIDCDNISARCMLTIF+LFATKTEASLLRMLKGSPDVYLSGPIR YI +K
Sbjct: 256 MWDPVAYALGFIDCDNISARCMLTIFSLFATKTEASLLRMLKGSPDVYLSGPIRDYIIEK 315

Query: 61  GGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSS 120
           GGRFHLRWGCREILY+K+AN ETYV GLAMSKAT K++V+AD Y+AACDVPGIKRLLPS+
Sbjct: 316 GGRFHLRWGCREILYEKSANGETYVTGLAMSKATQKQIVKADVYIAACDVPGIKRLLPSN 375

Query: 121 WREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSC 180
           WRE +FF+NIY LVGVPVVTVQLRYNGWVTELQD+ERSRQLR+A GLDNLLYTPDADFSC
Sbjct: 376 WREWEFFDNIYKLVGVPVVTVQLRYNGWVTELQDVERSRQLRQAAGLDNLLYTPDADFSC 435

Query: 181 FADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQV 227
           FADLAL SPEDYY EGQGSLLQCVLTPGDPYMPLPN+EII RV+KQV
Sbjct: 436 FADLALASPEDYYIEGQGSLLQCVLTPGDPYMPLPNEEIISRVSKQV 482

Catalyzes the conversion of zeta-carotene to lycopene via the intermediary of neurosporene. It carries out two consecutive desaturations (introduction of double bonds) at positions C-7 and C-7'.
Tagetes erecta (taxid: 13708)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 6

>sp\|Q9SE20\|ZDS_SOLLC Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Solanum lycopersicum GN=ZDS PE=2 SV=1	Back alignment and function description

>sp\|Q9SMJ3\|ZDS_CAPAN Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Capsicum annuum GN=ZDS PE=1 SV=1	Back alignment and function description

>sp\|O49901\|ZDS_NARPS Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=ZDS1 PE=2 SV=1	Back alignment and function description

>sp\|Q38893\|ZDS_ARATH Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=ZDS1 PE=1 SV=3	Back alignment and function description

>sp\|Q9ZTP4\|ZDS_MAIZE Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Zea mays GN=ZDS1 PE=2 SV=1	Back alignment and function description

>sp\|P74306\|ZDS_SYNY3 Zeta-carotene desaturase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crtQ PE=3 SV=1	Back alignment and function description

>sp\|Q9R6X4\|ZDS_NOSS1 Zeta-carotene desaturase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=crtQ PE=3 SV=2	Back alignment and function description

>sp\|Q31N27\|ZDS_SYNE7 Probable zeta-carotene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=zds PE=3 SV=1	Back alignment and function description

>sp\|P29273\|CRTI_SYNY3 Phytoene dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pds PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		254
83637848		570	zeta-carotene desaturase [Citrus unshiu]	0.893	0.398	1.0	1e-132
15824043		570	zeta-carotene desaturase [Citrus unshiu]	0.893	0.398	0.995	1e-131
18073986		570	zeta-carotene desaturase [Citrus sinensi	0.893	0.398	0.995	1e-131
190576747		570	zeta carotene desaturase [Citrus maxima]	0.893	0.398	0.991	1e-131
13991921		570	zeta-carotene desaturase precursor [Citr	0.893	0.398	0.982	1e-129
388503838		579	unknown [Medicago truncatula]	0.913	0.400	0.868	1e-119
449449539		576	PREDICTED: zeta-carotene desaturase, chl	0.893	0.394	0.885	1e-119
19572276		587	putative zeta-carotene desaturase [Helia	0.893	0.386	0.889	1e-119
37951180		587	putative zeta-carotene desaturase [Helia	0.893	0.386	0.889	1e-119
356576733		570	PREDICTED: zeta-carotene desaturase, chl	0.893	0.398	0.889	1e-119

>gi\|83637848\|gb\|ABC33728.1\| zeta-carotene desaturase [Citrus unshiu]	Back alignment and taxonomy information

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 227/227 (100%), Positives = 227/227 (100%)

Query: 1   MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDK 60
           MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDK
Sbjct: 234 MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDK 293

Query: 61  GGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSS 120
           GGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSS
Sbjct: 294 GGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSS 353

Query: 121 WREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSC 180
           WREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSC
Sbjct: 354 WREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSC 413

Query: 181 FADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQV 227
           FADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQV
Sbjct: 414 FADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQV 460

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|15824043\|dbj\|BAB68552.1\| zeta-carotene desaturase [Citrus unshiu]	Back alignment and taxonomy information

>gi\|18073986\|emb\|CAC85667.1\| zeta-carotene desaturase [Citrus sinensis]	Back alignment and taxonomy information

>gi\|190576747\|gb\|ACE79169.1\| zeta carotene desaturase [Citrus maxima]	Back alignment and taxonomy information

>gi\|13991921\|gb\|AAK51557.1\|AF372617_1 zeta-carotene desaturase precursor [Citrus x paradisi]	Back alignment and taxonomy information

>gi\|388503838\|gb\|AFK39985.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449449539\|ref\|XP_004142522.1\| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|19572276\|emb\|CAD27442.1\| putative zeta-carotene desaturase [Helianthus annuus]	Back alignment and taxonomy information

>gi\|37951180\|emb\|CAD55814.2\| putative zeta-carotene desaturase [Helianthus annuus] gi\|337731000\|gb\|AEI70832.1\| zeta-carotene desaturase [Helianthus annuus]	Back alignment and taxonomy information

>gi\|356576733\|ref\|XP_003556484.1\| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		254
TAIR\|locus:2114789		558	ZDS "zeta-carotene desaturase"	0.893	0.406	0.837	1.6e-104
TAIR\|locus:2129515		566	PDS3 "phytoene desaturase 3" [	0.775	0.348	0.3	2.9e-17

TAIR\|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1035 (369.4 bits), Expect = 1.6e-104, P = 1.6e-104
 Identities = 190/227 (83%), Positives = 211/227 (92%)

Query:     1 MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDK 60
             MWDPVAYALGFIDCDN+SARCMLTIF+LFATKTEASLLRMLKGSPDVYLSGPI++YITD+
Sbjct:   230 MWDPVAYALGFIDCDNMSARCMLTIFSLFATKTEASLLRMLKGSPDVYLSGPIKQYITDR 289

Query:    61 GGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSS 120
             GGR HLRWGCREILYDK+A+ ETYV GLA+SKAT+KK+V+AD YVAACDVPGIKRLLP  
Sbjct:   290 GGRIHLRWGCREILYDKSADGETYVTGLAISKATNKKIVKADVYVAACDVPGIKRLLPKE 349

Query:   121 WREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSC 180
             WRE +FFN+IY L GVPVVTVQLRYNGWVTELQD+E +RQL+RA+GLDNLLYTPDADFSC
Sbjct:   350 WRESRFFNDIYELEGVPVVTVQLRYNGWVTELQDIELARQLKRAVGLDNLLYTPDADFSC 409

Query:   181 FADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQV 227
             FADLAL SP DYY EGQG+LLQCVLTPGDPYM +PND+II +VA QV
Sbjct:   410 FADLALASPADYYIEGQGTLLQCVLTPGDPYMRMPNDKIIEKVAMQV 456

GO:0005739 "mitochondrion" evidence=ISM

GO:0016117 "carotenoid biosynthetic process" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0016719 "carotene 7,8-desaturase activity" evidence=IEA;IDA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009507 "chloroplast" evidence=IDA

GO:0016120 "carotene biosynthetic process" evidence=IDA

TAIR\|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q38893	ZDS_ARATH	1, ., 3, ., 5, ., 6	0.8370	0.8937	0.4068	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.14.99	0.766
3rd Layer	1.14.99.30	0.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00031131001	SubName- Full=Chromosome chr14 scaffold_54, whole genome shotgun sequence; (583 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00027139001	SubName- Full=Chromosome chr8 scaffold_41, whole genome shotgun sequence; (569 aa)			•		•	•		0.980
	GSVIVG00016526001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (529 aa)				•	•	•		0.939
	GSVIVG00025310001	SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (504 aa)				•	•	•		0.938
	PDS1	SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (582 aa)			•		•	•	•	0.917
	GSVIVG00025926001	SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (583 aa)				•	•			0.903
	GSVIVG00033552001	SubName- Full=Chromosome chr5 scaffold_67, whole genome shotgun sequence; (307 aa)	•		•			•		0.611
	GSVIVG00018857001	SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (396 aa)	•	•	•	•		•		0.537
	GSVIVG00024765001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (389 aa)	•	•	•			•		0.524
	GSVIVG00028499001	RecName- Full=Photosystem II reaction center psb28 protein; (179 aa)			•	•		•		0.506
	GSVIVG00016085001	SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (471 aa)				•		•		0.505

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		254
PLN02487		569	PLN02487, PLN02487, zeta-carotene desaturase	1e-171
TIGR02732		474	TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot	1e-151
COG3349		485	COG3349, COG3349, Uncharacterized conserved protei	2e-52
TIGR02731		453	TIGR02731, phytoene_desat, phytoene desaturase	3e-30
PLN02612		567	PLN02612, PLN02612, phytoene desaturase	3e-23
pfam01593		444	pfam01593, Amino_oxidase, Flavin containing amine	6e-18
TIGR03467		411	TIGR03467, HpnE, squalene-associated FAD-dependent	1e-04

>gnl\|CDD\|215268 PLN02487, PLN02487, zeta-carotene desaturase	Back alignment and domain information

 Score =  485 bits (1249), Expect = e-171
 Identities = 190/227 (83%), Positives = 210/227 (92%)

Query: 1   MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDK 60
           MWDP+AYALGFIDCDNISARCMLTIF+LFATKTEASLLRMLKGSPDV LSGPI KYITD+
Sbjct: 249 MWDPIAYALGFIDCDNISARCMLTIFSLFATKTEASLLRMLKGSPDVRLSGPIAKYITDR 308

Query: 61  GGRFHLRWGCREILYDKAANAETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSS 120
           GGRFHLRWGCREILYDK+ + ETYV GL +SKAT+K++V+ADAYVAACDVPGIKRLLP  
Sbjct: 309 GGRFHLRWGCREILYDKSPDGETYVTGLKVSKATEKEIVKADAYVAACDVPGIKRLLPEQ 368

Query: 121 WREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQLRRALGLDNLLYTPDADFSC 180
           WRE +FF+NIY LVGVPVVTVQLRYNGWVTE+QDLE SRQLRRA GLDNLLY+ DADFSC
Sbjct: 369 WREYEFFDNIYKLVGVPVVTVQLRYNGWVTEMQDLELSRQLRRAAGLDNLLYSADADFSC 428

Query: 181 FADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQV 227
           FADLALTSPEDYY+EG+GSL+Q VLTPGDPYMPL ND+I+ +V KQV
Sbjct: 429 FADLALTSPEDYYKEGEGSLIQAVLTPGDPYMPLSNDKIVEKVHKQV 475

Length = 569

>gnl\|CDD\|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase	Back alignment and domain information

>gnl\|CDD\|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|131778 TIGR02731, phytoene_desat, phytoene desaturase	Back alignment and domain information

>gnl\|CDD\|215330 PLN02612, PLN02612, phytoene desaturase	Back alignment and domain information

>gnl\|CDD\|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase	Back alignment and domain information

>gnl\|CDD\|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		254
PLN02487		569	zeta-carotene desaturase	100.0
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	99.98
PLN02612		567	phytoene desaturase	99.95
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	99.92
TIGR03467		419	HpnE squalene-associated FAD-dependent desaturase.	99.81
PRK07233		434	hypothetical protein; Provisional	99.78
PRK07208		479	hypothetical protein; Provisional	99.72
COG3349		485	Uncharacterized conserved protein [Function unknow	99.7
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	99.65
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	99.6
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	99.55
PRK12416		463	protoporphyrinogen oxidase; Provisional	99.53
PRK11883		451	protoporphyrinogen oxidase; Reviewed	99.53
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	99.49
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	99.48
PLN02576		496	protoporphyrinogen oxidase	99.37
KOG4254		561	consensus Phytoene desaturase [Coenzyme transport	99.31
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	99.15
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	99.0
PLN03000		881	amine oxidase	98.59
PRK13977		576	myosin-cross-reactive antigen; Provisional	98.5
PLN02676		487	polyamine oxidase	98.42
PLN02268		435	probable polyamine oxidase	98.41
PLN02328		808	lysine-specific histone demethylase 1 homolog	98.39
PLN02529		738	lysine-specific histone demethylase 1	98.35
COG2907		447	Predicted NAD/FAD-binding protein [General functio	98.32
PLN02568		539	polyamine oxidase	98.28
KOG0029		501	consensus Amine oxidase [Secondary metabolites bio	98.24
PLN02976		1713	amine oxidase	98.22
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	98.06
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	98.01
KOG1276		491	consensus Protoporphyrinogen oxidase [Coenzyme tra	97.62
KOG0685		498	consensus Flavin-containing amine oxidase [Coenzym	97.55
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	97.43
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	97.29
COG2081		408	Predicted flavoproteins [General function predicti	97.2
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	97.15
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	97.14
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	96.96
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	96.94
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	96.94
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	96.67
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	96.45
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	96.43
COG0579		429	Predicted dehydrogenase [General function predicti	96.36
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	96.25
PRK06847		375	hypothetical protein; Provisional	96.12
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	96.12
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	96.11
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	96.06
PRK07121		492	hypothetical protein; Validated	96.03
PRK08274		466	tricarballylate dehydrogenase; Validated	95.98
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.98
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	95.93
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.88
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	95.8
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.69
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	95.63
PRK12842		574	putative succinate dehydrogenase; Reviewed	95.63
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.63
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	95.61
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	95.6
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	95.58
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	95.57
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	95.57
PRK06175		433	L-aspartate oxidase; Provisional	95.56
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	95.47
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	95.44
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	95.42
KOG1336		478	consensus Monodehydroascorbate/ferredoxin reductas	95.4
PTZ00383		497	malate:quinone oxidoreductase; Provisional	95.34
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	95.33
TIGR00275		400	flavoprotein, HI0933 family. The model when search	95.31
PRK11728		393	hydroxyglutarate oxidase; Provisional	95.22
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	95.2
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	95.17
PLN02464		627	glycerol-3-phosphate dehydrogenase	95.1
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	95.09
PRK12839		572	hypothetical protein; Provisional	95.04
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	95.01
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	94.98
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	94.89
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	94.8
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	94.8
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	94.74
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	94.71
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	94.7
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	94.64
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	94.61
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	94.6
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	94.55
PRK08275		554	putative oxidoreductase; Provisional	94.55
PRK14989		847	nitrite reductase subunit NirD; Provisional	94.54
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	94.53
PRK05257		494	malate:quinone oxidoreductase; Validated	94.5
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	94.49
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	94.48
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	94.47
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	94.47
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	94.43
PRK06116		450	glutathione reductase; Validated	94.32
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	94.29
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	94.22
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	94.19
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	94.16
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	94.13
PRK09564		444	coenzyme A disulfide reductase; Reviewed	94.12
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	94.07
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	94.04
PRK10157		428	putative oxidoreductase FixC; Provisional	94.04
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	93.87
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	93.85
PLN02507		499	glutathione reductase	93.77
PRK06834		488	hypothetical protein; Provisional	93.77
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	93.76
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	93.74
PRK07512		513	L-aspartate oxidase; Provisional	93.74
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	93.69
PRK10015		429	oxidoreductase; Provisional	93.68
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	93.58
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	93.57
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	93.53
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	93.52
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	93.4
PRK06184		502	hypothetical protein; Provisional	93.38
PRK13339		497	malate:quinone oxidoreductase; Reviewed	93.36
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	93.35
PRK08401		466	L-aspartate oxidase; Provisional	93.34
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	93.33
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	93.32
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	93.31
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	93.29
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	93.2
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	93.2
PRK07395		553	L-aspartate oxidase; Provisional	93.18
PRK07804		541	L-aspartate oxidase; Provisional	93.15
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	93.13
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	93.11
TIGR02053		463	MerA mercuric reductase. This model represents the	93.09
PRK06370		463	mercuric reductase; Validated	93.03
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	92.98
PRK07190		487	hypothetical protein; Provisional	92.98
PRK07845		466	flavoprotein disulfide reductase; Reviewed	92.76
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	92.66
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	92.4
PRK06185		407	hypothetical protein; Provisional	92.38
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	92.38
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	92.35
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	92.29
PTZ00052		499	thioredoxin reductase; Provisional	92.27
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	92.12
PRK07045		388	putative monooxygenase; Reviewed	92.07
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	92.03
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	92.01
PRK10262		321	thioredoxin reductase; Provisional	91.69
PRK14694		468	putative mercuric reductase; Provisional	91.66
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	91.57
PF07156		368	Prenylcys_lyase: Prenylcysteine lyase; InterPro: I	91.46
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	91.31
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	91.3
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	91.24
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	91.23
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	91.17
PRK07588		391	hypothetical protein; Provisional	91.13
PRK09897		534	hypothetical protein; Provisional	91.1
COG1251		793	NirB NAD(P)H-nitrite reductase [Energy production	91.1
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	91.08
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	91.04
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	91.04
PRK13512		438	coenzyme A disulfide reductase; Provisional	91.02
PRK08071		510	L-aspartate oxidase; Provisional	90.98
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	90.97
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	90.97
PRK09077		536	L-aspartate oxidase; Provisional	90.97
PRK09126		392	hypothetical protein; Provisional	90.89
PRK08163		396	salicylate hydroxylase; Provisional	90.75
KOG2820		399	consensus FAD-dependent oxidoreductase [General fu	90.74
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	90.66
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	90.63
PRK06475		400	salicylate hydroxylase; Provisional	90.62
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	90.6
PTZ00058		561	glutathione reductase; Provisional	90.52
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	90.44
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	90.43
PRK08244		493	hypothetical protein; Provisional	90.43
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	90.37
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	90.35
PLN02815		594	L-aspartate oxidase	90.3
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	90.29
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	90.21
PRK14727		479	putative mercuric reductase; Provisional	90.13
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	90.08
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	89.94
PRK08013		400	oxidoreductase; Provisional	89.76
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	89.56
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	89.53
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	89.48
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	89.43
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	89.38
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	89.37
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	89.35
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	88.96
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	88.88
PLN02697		529	lycopene epsilon cyclase	88.65
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	88.61
PRK06126		545	hypothetical protein; Provisional	88.51
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	88.46
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	88.45
PRK13748		561	putative mercuric reductase; Provisional	88.43
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	88.39
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	88.03
PLN02546		558	glutathione reductase	88.0
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	87.95
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	87.76
KOG0404		322	consensus Thioredoxin reductase [Posttranslational	87.6
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	87.56
KOG1439		440	consensus RAB proteins geranylgeranyltransferase c	87.41
PRK05868		372	hypothetical protein; Validated	87.3
KOG1335		506	consensus Dihydrolipoamide dehydrogenase [Energy p	87.29
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	87.21
PLN02463		447	lycopene beta cyclase	87.19
PRK12831		464	putative oxidoreductase; Provisional	87.12
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	87.05
PRK06996		398	hypothetical protein; Provisional	86.84
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	86.68
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	86.63
KOG2844		856	consensus Dimethylglycine dehydrogenase precursor	86.0
PRK12770		352	putative glutamate synthase subunit beta; Provisio	85.99
PRK08132		547	FAD-dependent oxidoreductase; Provisional	85.92
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	85.8
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	85.7
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	85.1
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	84.74
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	84.54
PRK07538		413	hypothetical protein; Provisional	84.48
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	84.43
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	84.18
PRK07846		451	mycothione reductase; Reviewed	84.17
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	84.17
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	83.7
PRK07236		386	hypothetical protein; Provisional	82.77
PRK06753		373	hypothetical protein; Provisional	82.34
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	82.31
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	82.25
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	82.15
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	82.11
PLN02661		357	Putative thiazole synthesis	81.6
PRK09564		444	coenzyme A disulfide reductase; Reviewed	81.54
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	80.94
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	80.8
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	80.52

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

Probab=100.00  E-value=3e-34  Score=272.72  Aligned_cols=251  Identities=77%  Similarity=1.267  Sum_probs=202.2

Q ss_pred             CchhHHhHhCCCCCccccHHHHHHHHHHHHhccCCceeEEeCCCCcchhHHHHHHHHHhCCcEEEcCceeeEEEeccCCC
Q 025358            1 MWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDKGGRFHLRWGCREILYDKAAN   80 (254)
Q Consensus         1 ~w~pl~~a~l~~~~~~~SA~~~~~~l~~~~~~~~~~~~g~~~g~~~~~l~~~l~~~l~~~Gg~i~~~~~V~~i~~~~~~~   80 (254)
                      ||+|+|++++|.+++++||++++.+|..|..+.++++++|++|++++.|+++++++|+++||+|+++++|++|+.+++.+
T Consensus       249 l~dPll~~~~~~~~d~~SA~~~~~vl~~~~~~~~~~~l~~~~Gg~~~~l~~pl~~~L~~~Gg~V~l~~~V~~I~~~~~~~  328 (569)
T PLN02487        249 MWDPIAYALGFIDCDNISARCMLTIFSLFATKTEASLLRMLKGSPDVRLSGPIAKYITDRGGRFHLRWGCREILYDKSPD  328 (569)
T ss_pred             HHHHHHHHhhCCCHHHHHHHHHHHHHHHHhhcCCcceeeecCCCchHHHHHHHHHHHHHcCCEEEeCCceEEEEEecCCC
Confidence            69999999999999999999999999776656667899999999998899999999999999999999999999974211


Q ss_pred             CcceEEEEEEeecCCCeEEEcCEEEEcCChhhHhhcCCCcccCchhHHHhhcCCCCcEEEEEEEecCccccchhhhHHHH
Q 025358           81 AETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSSWREMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERSRQ  160 (254)
Q Consensus        81 g~~~v~gv~l~~~~~g~~~~aD~VV~a~p~~~~~~Ll~~~~~~~~~~~~~~~l~~~~i~~v~L~~d~~~~~~~~~~~~~~  160 (254)
                      |..+++||++.++.+++.+.||+||+|+|++.+.+|+|+.+...+.++++.+|++.||++|||+||++++.....+..++
T Consensus       329 g~~~v~gv~~~~~~~~~~~~aD~VV~A~p~~~~~~Llp~~~~~~~~~~~l~~L~~~pi~tv~L~~d~~v~~~~~~~~~r~  408 (569)
T PLN02487        329 GETYVTGLKVSKATEKEIVKADAYVAACDVPGIKRLLPEQWREYEFFDNIYKLVGVPVVTVQLRYNGWVTEMQDLELSRQ  408 (569)
T ss_pred             CceeEEEEEEecCCCceEEECCEEEECCCHHHHHHhCCchhhccHHHhHHhcCCCeeEEEEEEEeccccccccccccccc
Confidence            21147899884223566789999999999999999999876656678999999999999999999998864332211111


Q ss_pred             hhhccCCCceeecCCCCccceeccCCCCCcccccCCCceEEEEEeecCCCCCCCCHHHHHHHHHHHHc--CCCCCcceee
Q 025358          161 LRRALGLDNLLYTPDADFSCFADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQVG--FSSISIIPRF  238 (254)
Q Consensus       161 l~~~~~~~~~~~~~~~~~~~~~~~s~~~p~~~~~~g~~~~~~~~~~~~~~~~~~~~eei~~~v~~~L~--~P~~~~~~~~  238 (254)
                      +......++++|..+..+++|.+++++++++++.++++++++++++++++++++++|+|+++++++|.  ||.+ +.+++
T Consensus       409 l~~~~g~~~~~~~~~~~~~f~~di~l~~~~~~~~~~~g~~l~~vis~a~~~~~~~~~ei~~~~~~~L~~~~p~~-~~~~v  487 (569)
T PLN02487        409 LRRAAGLDNLLYSADADFSCFADLALTSPEDYYKEGEGSLIQAVLTPGDPYMPLSNDKIVEKVHKQVLELFPSS-RGLEV  487 (569)
T ss_pred             ccccccccccccccCCCcceEeeeecCCHHHHcccCCceEEEEEEcCCccccCCCHHHHHHHHHHHHHHhCccc-ccCce
Confidence            11011234544666666667777666666444444456899999999999999999999999999998  9998 55688


Q ss_pred             eeeeEEeeeCceeec
Q 025358          239 RSYLVVCCQNRAIFV  253 (254)
Q Consensus       239 ~~~~v~~~~~~a~~~  253 (254)
                      .+++||| +++|||-
T Consensus       488 ~~~~vv~-~~~at~~  501 (569)
T PLN02487        488 TWSSVVK-IGQSLYR  501 (569)
T ss_pred             EEEEEEE-ccCceec
Confidence            8999999 9999995

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>TIGR03467 HpnE squalene-associated FAD-dependent desaturase	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism]	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism]	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only]	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion]	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion]	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		254
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	1e-04

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424	Back alignment and structure

 Score = 41.4 bits (97), Expect = 1e-04
 Identities = 33/189 (17%), Positives = 57/189 (30%), Gaps = 29/189 (15%)

Query: 1   MWDPVAYALGFIDCDNISARCMLTIFAL--FATKTEASLLRMLKGS------------PD 46
           +W     A G+   DN+ A  +L         +  +  L     G+              
Sbjct: 160 LWINPFTAFGYGHFDNVPAAYVLKYLDFVTMMSFAKGDLWTWADGTQAMFEHLNATLEHP 219

Query: 47  VYLSGPIRKYITDKGGRFHLRWGCREILYDKAANAETYVKGLAMSKATDK------KVVQ 100
              +  I + IT + G+ H+     +   D         K L  S A D       K++ 
Sbjct: 220 AERNVDITR-ITREDGKVHIHTTDWDRESDVLVLTVPLEKFLDYSDADDDEREYFSKIIH 278

Query: 101 ADAYVAACDVPGI--------KRLLPSSWREMKFFNNIYALVGVPVVTVQLRYNGWVTEL 152
               V AC V             + P     +  + + +A     ++T  L  N      
Sbjct: 279 QQYMVDACLVKEYPTISGYVPDNMRPERLGHVMVYYHRWADDPHQIITTYLLRNHPDYAD 338

Query: 153 QDLERSRQL 161
           +  E  RQ+
Sbjct: 339 KTQEECRQM 347

PyMOL of 2b9w

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		254
3ka7_A		425	Oxidoreductase; structural genomics, PSI-2, protei	99.79
4dgk_A		501	Phytoene dehydrogenase; the FAD/NAD(P)-binding ros	99.69
3nrn_A		421	Uncharacterized protein PF1083; alpha-beta protein	99.68
3nks_A		477	Protoporphyrinogen oxidase; FAD containing protein	99.57
4gde_A		513	UDP-galactopyranose mutase; flavin adenine dinucle	99.55
4dsg_A		484	UDP-galactopyranose mutase; rossmann fold, flavin	99.54
3i6d_A		470	Protoporphyrinogen oxidase; protein-inhibitor comp	99.52
3lov_A		475	Protoporphyrinogen oxidase; structural genomics, J	99.46
1s3e_A		520	Amine oxidase [flavin-containing] B; human monoami	99.45
2ivd_A		478	PPO, PPOX, protoporphyrinogen oxidase; porphyrin b	99.44
2vvm_A		495	Monoamine oxidase N; FAD, peroxisome, flavoprotein	99.3
1sez_A		504	Protoporphyrinogen oxidase, mitochondrial; FAD-bin	99.28
2yg5_A		453	Putrescine oxidase; oxidoreductase, flavin; HET: F	99.25
3qj4_A		342	Renalase; FAD/NAD(P)-binding rossmann fold superfa	99.19
1b37_A		472	Protein (polyamine oxidase); flavin-dependent amin	99.12
2jae_A		489	L-amino acid oxidase; oxidoreductase, dimerisation	99.04
3p1w_A		475	Rabgdi protein; GDI RAB, malaria, structural genom	98.91
2iid_A		498	L-amino-acid oxidase; flavoenzyme, FAD binding dom	98.65
1d5t_A		433	Guanine nucleotide dissociation inhibitor; ultra-h	98.65
1vg0_A		650	RAB proteins geranylgeranyltransferase component A	98.59
4gut_A		776	Lysine-specific histone demethylase 1B; histone de	98.45
2z3y_A		662	Lysine-specific histone demethylase 1; chromatin,	98.45
2xag_A		852	Lysine-specific histone demethylase 1; amine oxida	98.39
3k7m_X		431	6-hydroxy-L-nicotine oxidase; enantiomeric substra	98.37
1yvv_A		336	Amine oxidase, flavin-containing; oxidoreductase,	98.32
2b9w_A		424	Putative aminooxidase; isomerase, conjugated linol	98.31
2bcg_G		453	Secretory pathway GDP dissociation inhibitor; RABG	98.13
1rsg_A		516	FMS1 protein; FAD binding motif, oxidoreductase; H	98.0
3hdq_A		397	UDP-galactopyranose mutase; substrate and inhibito	97.87
1i8t_A		367	UDP-galactopyranose mutase; rossman fold, FAD, con	97.73
3dje_A		438	Fructosyl amine: oxygen oxidoreductase; fructosyl-	97.4
1v0j_A		399	UDP-galactopyranose mutase; flavoprotein, isomeras	97.38
2bi7_A		384	UDP-galactopyranose mutase; FAD, flavoprotein, iso	97.3
3fg2_P		404	Putative rubredoxin reductase; ferredoxin reductas	97.15
3lxd_A		415	FAD-dependent pyridine nucleotide-disulphide oxido	97.15
3ayj_A		721	Pro-enzyme of L-phenylalanine oxidase; amino acid	97.03
1ryi_A		382	Glycine oxidase; flavoprotein, protein-inhibitor c	97.0
2i0z_A		447	NAD(FAD)-utilizing dehydrogenases; structural geno	96.93
3dme_A		369	Conserved exported protein; structural genomics, P	96.91
3nlc_A		549	Uncharacterized protein VP0956; FAD-binding protei	96.84
1y56_B		382	Sarcosine oxidase; dehydrogenase, protein-protein	96.81
3nyc_A		381	D-arginine dehydrogenase; FAD, imino-arginine, oxi	96.79
4at0_A		510	3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore	96.79
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	96.57
2gag_B		405	Heterotetrameric sarcosine oxidase beta-subunit; f	96.56
3cgv_A		397	Geranylgeranyl reductase related protein; NP_39399	96.52
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	96.44
3axb_A		448	Putative oxidoreductase; dinucleotide-binding fold	96.42
3ps9_A		676	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	96.42
3iwa_A		472	FAD-dependent pyridine nucleotide-disulphide oxido	96.4
1y0p_A		571	Fumarate reductase flavoprotein subunit; flavocyto	96.38
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	96.37
3da1_A		561	Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9	96.35
3atr_A		453	Conserved archaeal protein; saturating double bond	96.3
3pvc_A		689	TRNA 5-methylaminomethyl-2-thiouridine biosynthes	96.29
2cdu_A		452	NADPH oxidase; flavoenzyme, oxidoreductase; HET: F	96.27
1d4d_A		572	Flavocytochrome C fumarate reductase; oxidoreducta	96.22
1qo8_A		566	Flavocytochrome C3 fumarate reductase; oxidoreduct	96.15
1pj5_A		830	N,N-dimethylglycine oxidase; channelling, FAD bind	96.14
2rgh_A		571	Alpha-glycerophosphate oxidase; flavoprotein oxida	96.13
2uzz_A		372	N-methyl-L-tryptophan oxidase; N-methyltryptophan	96.1
2cul_A		232	Glucose-inhibited division protein A-related PROT	95.99
3oc4_A		452	Oxidoreductase, pyridine nucleotide-disulfide FAM;	95.99
1mo9_A		523	ORF3; nucleotide binding motifs, nucleotide bindin	95.97
2wpf_A		495	Trypanothione reductase; oxidoreductase, trypanoso	95.94
1m6i_A		493	Programmed cell death protein 8; apoptosis, AIF, o	95.91
2hqm_A		479	GR, grase, glutathione reductase; glutathione redu	95.9
2v3a_A		384	Rubredoxin reductase; alkane degradation, NADH oxi	95.87
2wdq_A		588	Succinate dehydrogenase flavoprotein subunit; succ	95.85
1fec_A		490	Trypanothione reductase; redox-active center, oxid	95.84
3o0h_A		484	Glutathione reductase; ssgcid, structur genomics,	95.83
2qcu_A		501	Aerobic glycerol-3-phosphate dehydrogenase; glycer	95.82
2gf3_A		389	MSOX, monomeric sarcosine oxidase; flavoprotein ox	95.81
1xdi_A		499	RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun	95.79
3v76_A		417	Flavoprotein; structural genomics, PSI-biology, NE	95.74
2x3n_A		399	Probable FAD-dependent monooxygenase; oxidoreducta	95.74
2ywl_A		180	Thioredoxin reductase related protein; uncharacter	95.73
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	95.73
3nix_A		421	Flavoprotein/dehydrogenase; structural genomics, P	95.69
2e4g_A		550	Tryptophan halogenase; flavin-binding, rebeccamyci	95.68
4dna_A		463	Probable glutathione reductase; structural genomic	95.68
2weu_A		511	Tryptophan 5-halogenase; regioselectivity, antifun	95.67
3e1t_A		512	Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro	95.66
2bs2_A		660	Quinol-fumarate reductase flavoprotein subunit A;	95.66
3cty_A		319	Thioredoxin reductase; FAD, oxidoreductase, flavin	95.63
2gmh_A		584	Electron transfer flavoprotein-ubiquinone oxidored	95.5
2oln_A		397	NIKD protein; flavoprotein, rossmann fold, oxidore	95.45
1ges_A		450	Glutathione reductase; oxidoreductase(flavoenzyme)	95.45
2h88_A		621	Succinate dehydrogenase flavoprotein subunit; comp	95.32
2bc0_A		490	NADH oxidase; flavoprotein, pyridine nucleotide di	95.26
3r9u_A		315	Thioredoxin reductase; structural genomics, center	95.25
1onf_A		500	GR, grase, glutathione reductase; oxidoreductase;	95.18
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	95.13
2r9z_A		463	Glutathione amide reductase; NAD, FAD, substrate s	95.1
1k0i_A		394	P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h	95.1
3cgb_A		480	Pyridine nucleotide-disulfide oxidoreductase, CLA;	95.08
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	95.02
2yqu_A		455	2-oxoglutarate dehydrogenase E3 component; lipoami	95.0
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	94.97
2aqj_A		538	Tryptophan halogenase, pRNA; flavin-dependent halo	94.97
1nhp_A		447	NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA	94.92
1zk7_A		467	HGII, reductase, mercuric reductase; mercuric ION	94.9
3ics_A		588	Coenzyme A-disulfide reductase; pyridine nucleotid	94.88
2gqw_A		408	Ferredoxin reductase; flavoprotein, oxidoreductase	94.88
3lad_A		476	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	94.88
3h8l_A		409	NADH oxidase; membrane protein, complete form, ros	94.87
2gqf_A		401	Hypothetical protein HI0933; structural genomics,	94.85
1kf6_A		602	Fumarate reductase flavoprotein; respiration, fuma	94.8
1zmd_A		474	Dihydrolipoyl dehydrogenase; lipoamide dehydrogena	94.67
2pyx_A		526	Tryptophan halogenase; structural genomics, JOI fo	94.52
3c4n_A		405	Uncharacterized protein DR_0571; alpha-beta protei	94.43
4g6h_A		502	Rotenone-insensitive NADH-ubiquinone oxidoreducta	94.38
1rp0_A		284	ARA6, thiazole biosynthetic enzyme; protein ligand	94.37
3i3l_A		591	Alkylhalidase CMLS; flavin-dependent halogenase, c	94.36
1ebd_A		455	E3BD, dihydrolipoamide dehydrogenase; redox-active	94.34
1ojt_A		482	Surface protein; redox-active center, glycolysis,	94.33
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	94.19
1v59_A		478	Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog	94.16
3alj_A		379	2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG;	94.13
2zxi_A		637	TRNA uridine 5-carboxymethylaminomethyl modificat	94.12
4a9w_A		357	Monooxygenase; baeyer-villiger, FAD, oxidoreductas	94.11
1y56_A		493	Hypothetical protein PH1363; dehydrogenase, protei	94.06
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	94.03
3urh_A		491	Dihydrolipoyl dehydrogenase; PSI-biology, structur	94.02
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	93.98
2a8x_A		464	Dihydrolipoyl dehydrogenase, E3 component of alpha	93.97
1dxl_A		470	Dihydrolipoamide dehydrogenase; oxidoreductase, mu	93.95
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	93.87
2qa2_A		499	CABE, polyketide oxygenase CABE; FAD, angucycline,	93.85
3dk9_A		478	Grase, GR, glutathione reductase; flavoenzyme, nic	93.82
3dgh_A		483	TRXR-1, thioredoxin reductase 1, mitochondrial; ox	93.79
3ntd_A		565	FAD-dependent pyridine nucleotide-disulphide oxido	93.73
2qa1_A		500	PGAE, polyketide oxygenase PGAE; FAD, angucycline,	93.71
1n4w_A		504	CHOD, cholesterol oxidase; flavoenzyme, steroid me	93.69
4eqs_A		437	Coenzyme A disulfide reductase; oxidoreductase; HE	93.67
3ces_A		651	MNMG, tRNA uridine 5-carboxymethylaminomethyl modi	93.64
2eq6_A		464	Pyruvate dehydrogenase complex, dihydrolipoamide d	93.5
3ihg_A		535	RDME; flavoenzyme, anthracycline, polyketide biosy	93.49
3dgz_A		488	Thioredoxin reductase 2; oxidoreductase, rossmann,	93.37
1chu_A		540	Protein (L-aspartate oxidase); flavoenzyme, NAD bi	93.26
3oz2_A		397	Digeranylgeranylglycerophospholipid reductase; str	93.24
3h28_A		430	Sulfide-quinone reductase; monotopic membrane prot	93.04
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	93.01
2qae_A		468	Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin	92.92
2e5v_A		472	L-aspartate oxidase; archaea, oxidoreductase; HET:	92.9
1coy_A		507	Cholesterol oxidase; oxidoreductase(oxygen recepto	92.85
3fmw_A		570	Oxygenase; mithramycin, baeyer-villiger, flavin bi	92.62
3k30_A		690	Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi	92.61
1jnr_A		643	Adenylylsulfate reductase; oxidoreductase; HET: FA	92.39
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	92.27
1fl2_A		310	Alkyl hydroperoxide reductase subunit F; reactive	92.06
2vou_A		397	2,6-dihydroxypyridine hydroxylase; oxidoreductase,	91.91
3gyx_A		662	Adenylylsulfate reductase; oxidoreductase; HET: FA	91.73
2bry_A		497	NEDD9 interacting protein with calponin homology a	91.71
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	91.49
3ab1_A		360	Ferredoxin--NADP reductase; oxidoreductase, electr	91.48
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	91.47
1kdg_A		546	CDH, cellobiose dehydrogenase; GMC oxidoreductase,	91.43
4b1b_A		542	TRXR, thioredoxin reductase; oxidoreductase, FAD,	91.29
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	91.26
4ap3_A		549	Steroid monooxygenase; oxidoreductase, baeyer-vill	91.23
3cp8_A		641	TRNA uridine 5-carboxymethylaminomethyl modificati	91.22
3gwf_A		540	Cyclohexanone monooxygenase; flavoprotein biocatal	91.18
3lzw_A		332	Ferredoxin--NADP reductase 2; ferredoxin reductase	91.14
3fbs_A		297	Oxidoreductase; structural genomics, PSI2, MCSG, p	91.08
2e1m_B		130	L-glutamate oxidase; L-amino acid oxidase, FAD, L-	91.07
3klj_A		385	NAD(FAD)-dependent dehydrogenase, NIRB-family (N-	91.02
3vrd_B		401	FCCB subunit, flavocytochrome C flavin subunit; su	91.01
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	90.92
3rp8_A		407	Flavoprotein monooxygenase; FAD-binding protein, o	90.69
1lvl_A		458	Dihydrolipoamide dehydrogenase; oxidoreductase; HE	90.66
2xve_A		464	Flavin-containing monooxygenase; oxidoreductase; H	90.65
3hyw_A		430	Sulfide-quinone reductase; monotopic membrane prot	90.53
2zbw_A		335	Thioredoxin reductase; redox protein, oxidoreducta	90.51
3pl8_A		623	Pyranose 2-oxidase; substrate complex, H167A mutan	90.37
3d1c_A		369	Flavin-containing putative monooxygenase; NP_37310	90.35
3kd9_A		449	Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o	90.26
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	89.47
3sx6_A		437	Sulfide-quinone reductase, putative; sulfide:quino	89.4
3ic9_A		492	Dihydrolipoamide dehydrogenase; APC62701, colwelli	89.06
2xdo_A		398	TETX2 protein; tetracycline degradation, tigecycli	89.03
2dkh_A		639	3-hydroxybenzoate hydroxylase; flavoprotein, monoo	88.96
3c96_A		410	Flavin-containing monooxygenase; FAD, oxidoreducta	88.92
3f8d_A		323	Thioredoxin reductase (TRXB-3); redox protein, nuc	88.86
2q0l_A		311	TRXR, thioredoxin reductase; bacterial thiredoxin	88.85
2jbv_A		546	Choline oxidase; alcohol oxidation, flavoenyzme ox	88.82
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	88.62
2gv8_A		447	Monooxygenase; FMO, FAD, NADPH, cofactor complex,	88.33
4fk1_A		304	Putative thioredoxin reductase; structural genomic	88.23
1ps9_A		671	2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel	87.55
3itj_A		338	Thioredoxin reductase 1; disulfide B flavoprotein,	87.3
3qfa_A		519	Thioredoxin reductase 1, cytoplasmic; protein-prot	86.79
1vdc_A		333	NTR, NADPH dependent thioredoxin reductase; hypoth	86.77
1w4x_A		542	Phenylacetone monooxygenase; baeyer-villiger, FAD;	86.66
2gag_A		965	Heterotetrameric sarcosine oxidase alpha-subunit;	86.43
2q7v_A		325	Thioredoxin reductase; rossman fold, FAD, flavopro	85.64
3s5w_A		463	L-ornithine 5-monooxygenase; class B flavin depend	85.33
2gjc_A		326	Thiazole biosynthetic enzyme, mitochondrial; gluta	85.22
1trb_A		320	Thioredoxin reductase; oxidoreductase(flavoenzyme)	85.18
3jsk_A		344	Cypbp37 protein; octameric thiazole synthase, bios	84.7
2vdc_G		456	Glutamate synthase [NADPH] small chain; oxidoreduc	84.57
2a87_A		335	TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL	83.96
1q1r_A		431	Putidaredoxin reductase; glutathione reductase fol	83.8
1lqt_A		456	FPRA; NADP+ derivative, oxidoreductase, structural	83.23
1cjc_A		460	Protein (adrenodoxin reductase); flavoenzyme, MAD	83.11
1gte_A		1025	Dihydropyrimidine dehydrogenase; electron transfer	82.62
3qvp_A		583	Glucose oxidase; oxidoreductase; HET: NAG BMA MAN	82.29
3ef6_A		410	Toluene 1,2-dioxygenase system ferredoxin--NAD(+)	81.65
1xhc_A		367	NADH oxidase /nitrite reductase; southe collaborat	81.62
2x8g_A		598	Thioredoxin glutathione reductase; redox-active ce	81.56
2r0c_A		549	REBC; flavin adenine dinucleotide, monooxygenase,	81.37
3uox_A		545	Otemo; baeyer-villiger monooxygenase, oxidoreducta	81.15
4hb9_A		412	Similarities with probable monooxygenase; flavin,	81.13

>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}	Back alignment and structure

Probab=99.79  E-value=8.5e-18  Score=152.98  Aligned_cols=213  Identities=14%  Similarity=0.163  Sum_probs=155.5

Q ss_pred             chhHHhHhCCCCCccccHHHHHHHHHHHHhccCCceeEEeCCCCcchhHHHHHHHHHhCCcEEEcCceeeEEEeccCCCC
Q 025358            2 WDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDKGGRFHLRWGCREILYDKAANA   81 (254)
Q Consensus         2 w~pl~~a~l~~~~~~~SA~~~~~~l~~~~~~~~~~~~g~~~g~~~~~l~~~l~~~l~~~Gg~i~~~~~V~~i~~~~~~~g   81 (254)
                      |+|++...++.+++++|+..++..+..+....   ...++.|+.. .++++|.+.++++|++|++|++|++|..++   +
T Consensus       155 ~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~---~~~~~~gG~~-~l~~~l~~~~~~~G~~i~~~~~V~~i~~~~---~  227 (425)
T 3ka7_A          155 ADSFCGWALSLKSDEVPVEEVFEIIENMYRFG---GTGIPEGGCK-GIIDALETVISANGGKIHTGQEVSKILIEN---G  227 (425)
T ss_dssp             HHHHHHHHHSSCGGGSBHHHHHHHHHHHHHHC---SCEEETTSHH-HHHHHHHHHHHHTTCEEECSCCEEEEEEET---T
T ss_pred             HHHHHHHHhCCCcccchHHHHHHHHHHHHhcC---CccccCCCHH-HHHHHHHHHHHHcCCEEEECCceeEEEEEC---C
Confidence            56777777889999999998888877643221   2457888875 699999999999999999999999999886   5


Q ss_pred             cceEEEEEEeecCCCeEEEcCEEEEcCChhhHhhcCCCccc---CchhHHHhhcCCCCcEEEEEEEecCccccchhhhHH
Q 025358           82 ETYVKGLAMSKATDKKVVQADAYVAACDVPGIKRLLPSSWR---EMKFFNNIYALVGVPVVTVQLRYNGWVTELQDLERS  158 (254)
Q Consensus        82 ~~~v~gv~l~~~~~g~~~~aD~VV~a~p~~~~~~Ll~~~~~---~~~~~~~~~~l~~~~i~~v~L~~d~~~~~~~~~~~~  158 (254)
                        ++.+|.+    +|++++||.||+|+|++.+.+|+++...   ...+.+++.++++.++++++|+++++..        
T Consensus       228 --~~~gv~~----~g~~~~ad~VV~a~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~~~~~~~--------  293 (425)
T 3ka7_A          228 --KAAGIIA----DDRIHDADLVISNLGHAATAVLCSEALSKEADAAYFKMVGTLQPSAGIKICLAADEPLV--------  293 (425)
T ss_dssp             --EEEEEEE----TTEEEECSEEEECSCHHHHHHHTTTTCCTTTTHHHHHHHHHCCCBEEEEEEEEESSCSS--------
T ss_pred             --EEEEEEE----CCEEEECCEEEECCCHHHHHHhcCCcccccCCHHHHHHhhCcCCCceEEEEeecCCCcc--------
Confidence              6888876    5889999999999999998899975321   3456777888888888999999998653        


Q ss_pred             HHhhhccCCCceeecCCCC-ccceeccCCCCCcccccCCCceEEEEEeecCCCCCCCCHHHHHHHHHHHHc--CCCCCcc
Q 025358          159 RQLRRALGLDNLLYTPDAD-FSCFADLALTSPEDYYREGQGSLLQCVLTPGDPYMPLPNDEIIRRVAKQVG--FSSISII  235 (254)
Q Consensus       159 ~~l~~~~~~~~~~~~~~~~-~~~~~~~s~~~p~~~~~~g~~~~~~~~~~~~~~~~~~~~eei~~~v~~~L~--~P~~~~~  235 (254)
                             ..+++++..+.. ...+...+.++| +++|+| ++++.++.....+..+. .++++++++++|+  +|+.  .
T Consensus       294 -------~~~~~~~~~~~~~~~~~~~~s~~~p-~~ap~G-~~~l~~~~~~~~~~~~~-~~~~~~~~~~~l~~~~p~~--~  361 (425)
T 3ka7_A          294 -------GHTGVLLTPYTRRINGVNEVTQADP-ELAPPG-KHLTMCHQYVAPENVKN-LESEIEMGLEDLKEIFPGK--R  361 (425)
T ss_dssp             -------CSSSEEECCSSSSEEEEECGGGTCG-GGSCTT-CEEEEEEEEECGGGGGG-HHHHHHHHHHHHHHHSTTC--C
T ss_pred             -------CcCEEEECCChhhcceEEeccCCCC-CcCCCC-CeEEEEEeccccccccc-hHHHHHHHHHHHHHhCCCC--c
Confidence                   345666655543 222334466788 578888 56766655433222222 3456799999999  9983  3


Q ss_pred             eeeeeeeEEeeeCce
Q 025358          236 PRFRSYLVVCCQNRA  250 (254)
Q Consensus       236 ~~~~~~~v~~~~~~a  250 (254)
                      .++.  .|.+ ++.|
T Consensus       362 ~~~~--~v~~-~~~~  373 (425)
T 3ka7_A          362 YEVL--LIQS-YHDE  373 (425)
T ss_dssp             EEEE--EEEE-EBTT
T ss_pred             eEEE--EEEE-ECCC
Confidence            4443  4555 4444

PyMOL of 3ka7

>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis}	Back alignment and structure

>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}	Back alignment and structure

>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens}	Back alignment and structure

>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A*	Back alignment and structure

>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A*	Back alignment and structure

>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}	Back alignment and structure

>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum}	Back alignment and structure

>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ...	Back alignment and structure

>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*	Back alignment and structure

>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G*	Back alignment and structure

>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5	Back alignment and structure

>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A*	Back alignment and structure

>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens}	Back alignment and structure

>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A*	Back alignment and structure

>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A*	Back alignment and structure

>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7}	Back alignment and structure

>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A*	Back alignment and structure

>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A	Back alignment and structure

>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R*	Back alignment and structure

>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A*	Back alignment and structure

>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A	Back alignment and structure

>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A	Back alignment and structure

>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A*	Back alignment and structure

>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A*	Back alignment and structure

>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G*	Back alignment and structure

>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*	Back alignment and structure

>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A*	Back alignment and structure

>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7	Back alignment and structure

>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A*	Back alignment and structure

>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis}	Back alignment and structure

>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A*	Back alignment and structure

>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris}	Back alignment and structure

>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A*	Back alignment and structure

>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*	Back alignment and structure

>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis}	Back alignment and structure

>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus}	Back alignment and structure

>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A*	Back alignment and structure

>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B*	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A*	Back alignment and structure

>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A*	Back alignment and structure

>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris}	Back alignment and structure

>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A*	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans}	Back alignment and structure

>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A*	Back alignment and structure

>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A*	Back alignment and structure

>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis}	Back alignment and structure

>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A*	Back alignment and structure

>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1	Back alignment and structure

>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A*	Back alignment and structure

>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A*	Back alignment and structure

>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli}	Back alignment and structure

>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7	Back alignment and structure

>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis}	Back alignment and structure

>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A*	Back alignment and structure

>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A*	Back alignment and structure

>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A*	Back alignment and structure

>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A*	Back alignment and structure

>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A*	Back alignment and structure

>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A*	Back alignment and structure

>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae}	Back alignment and structure

>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A*	Back alignment and structure

>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A*	Back alignment and structure

>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1	Back alignment and structure

>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti}	Back alignment and structure

>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa}	Back alignment and structure

>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A*	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii}	Back alignment and structure

>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A	Back alignment and structure

>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti}	Back alignment and structure

>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A*	Back alignment and structure

>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus}	Back alignment and structure

>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A*	Back alignment and structure

>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum}	Back alignment and structure

>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A*	Back alignment and structure

>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A*	Back alignment and structure

>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A*	Back alignment and structure

>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ...	Back alignment and structure

>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A*	Back alignment and structure

>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni}	Back alignment and structure

>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A*	Back alignment and structure

>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ...	Back alignment and structure

>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A*	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A*	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A*	Back alignment and structure

>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A*	Back alignment and structure

>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A*	Back alignment and structure

>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*	Back alignment and structure

>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A*	Back alignment and structure

>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A*	Back alignment and structure

>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A*	Back alignment and structure

>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1	Back alignment and structure

>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A*	Back alignment and structure

>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A*	Back alignment and structure

>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina}	Back alignment and structure

>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1}	Back alignment and structure

>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A*	Back alignment and structure

>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6	Back alignment and structure

>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae}	Back alignment and structure

>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A*	Back alignment and structure

>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A*	Back alignment and structure

>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A*	Back alignment and structure

>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia}	Back alignment and structure

>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii}	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti}	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A*	Back alignment and structure

>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces}	Back alignment and structure

>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ...	Back alignment and structure

>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A*	Back alignment and structure

>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A*	Back alignment and structure

>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces}	Back alignment and structure

>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A*	Back alignment and structure

>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A*	Back alignment and structure

>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A	Back alignment and structure

>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A*	Back alignment and structure

>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens}	Back alignment and structure

>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A*	Back alignment and structure

>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A*	Back alignment and structure

>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum}	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi}	Back alignment and structure

>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii}	Back alignment and structure

>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A*	Back alignment and structure

>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus}	Back alignment and structure

>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex}	Back alignment and structure

>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A*	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5	Back alignment and structure

>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2	Back alignment and structure

>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas}	Back alignment and structure

>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A*	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum}	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A*	Back alignment and structure

>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum}	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A*	Back alignment and structure

>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum}	Back alignment and structure

>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A*	Back alignment and structure

>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A*	Back alignment and structure

>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens}	Back alignment and structure

>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}	Back alignment and structure

>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A*	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A*	Back alignment and structure

>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A*	Back alignment and structure

>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A*	Back alignment and structure

>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus}	Back alignment and structure

>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ...	Back alignment and structure

>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus}	Back alignment and structure

>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii}	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A*	Back alignment and structure

>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea}	Back alignment and structure

>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A*	Back alignment and structure

>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A*	Back alignment and structure

>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A*	Back alignment and structure

>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A*	Back alignment and structure

>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A*	Back alignment and structure

>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A*	Back alignment and structure

>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C*	Back alignment and structure

>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1	Back alignment and structure

>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A*	Back alignment and structure

>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A*	Back alignment and structure

>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A*	Back alignment and structure

>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A*	Back alignment and structure

>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A*	Back alignment and structure

>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans}	Back alignment and structure

>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A*	Back alignment and structure

>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A*	Back alignment and structure

>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A*	Back alignment and structure

>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa}	Back alignment and structure

>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense}	Back alignment and structure

>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis}	Back alignment and structure

>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A*	Back alignment and structure

>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A*	Back alignment and structure

>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A*	Back alignment and structure

>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A*	Back alignment and structure

>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A*	Back alignment and structure

>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A*	Back alignment and structure

>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1	Back alignment and structure

>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A*	Back alignment and structure

>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A*	Back alignment and structure

>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A*	Back alignment and structure

>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		254
d2bcgg1		297	Guanine nucleotide dissociation inhibitor, GDI {Ba	98.82
d1d5ta1		336	Guanine nucleotide dissociation inhibitor, GDI {Co	98.25
d2ivda1		347	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	98.18
d1aoga2		117	Trypanothione reductase {Trypanosoma cruzi [TaxId:	97.93
d1q1ra2		133	Putidaredoxin reductase {Pseudomonas putida [TaxId	97.92
d1feca2		117	Trypanothione reductase {Crithidia fasciculata [Ta	97.83
d2v5za1		383	Monoamine oxidase B {Human (Homo sapiens) [TaxId:	97.82
d2i0za1		251	Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]	97.79
d1mo9a2		121	NADH-dependent 2-ketopropyl coenzyme M oxidoreduct	97.77
d1m6ia2		137	Apoptosis-inducing factor (AIF) {Human (Homo sapie	97.76
d2iida1		370	L-aminoacid oxidase {Malayan pit viper (Calloselas	97.75
d1gesa2		116	Glutathione reductase {Escherichia coli [TaxId: 56	97.67
d1pj5a2		305	N,N-dimethylglycine oxidase {Arthrobacter globifor	97.63
d3lada2		119	Dihydrolipoamide dehydrogenase {Azotobacter vinela	97.61
d1nhpa2		123	NADH peroxidase {Enterococcus faecalis [TaxId: 135	97.56
d1dxla2		123	Dihydrolipoamide dehydrogenase {Garden pea (Pisum	97.55
d1v59a2		122	Dihydrolipoamide dehydrogenase {Baker's yeast (Sac	97.5
d1onfa2		117	Glutathione reductase {Plasmodium falciparum [TaxI	97.46
d1ebda2		117	Dihydrolipoamide dehydrogenase {Bacillus stearothe	97.37
d1d7ya2		121	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	97.27
d1ryia1		276	Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	97.22
d1vg0a1		491	Rab escort protein 1 {Rat (Rattus norvegicus) [Tax	97.2
d2gf3a1		281	Sarcosine oxidase {Bacillus sp., strain b0618 [Tax	97.18
d2gqfa1		253	Hypothetical protein HI0933 {Haemophilus influenza	97.08
d1y0pa2		308	Flavocytochrome c3 (respiratory fumarate reductase	96.92
d1xhca2		122	NADH oxidase /nitrite reductase {Pyrococcus furios	96.83
d1lvla2		115	Dihydrolipoamide dehydrogenase {Pseudomonas putida	96.81
d1d4ca2		322	Flavocytochrome c3 (respiratory fumarate reductase	96.8
d3grsa2		125	Glutathione reductase {Human (Homo sapiens) [TaxId	96.7
d2ivda2		108	Protoporphyrinogen oxidase {Myxococcus xanthus [Ta	96.67
d1seza2		112	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	96.56
d1ojta2		125	Dihydrolipoamide dehydrogenase {Neisseria meningit	96.47
d1h6va2		122	Mammalian thioredoxin reductase {Rat (Rattus norve	96.46
d1qo8a2		317	Flavocytochrome c3 (respiratory fumarate reductase	96.37
d1seza1		373	Protoporphyrinogen oxidase {Tobacco (Nicotiana tab	96.1
d2bs2a2		336	Fumarate reductase {Wolinella succinogenes [TaxId:	95.26
d1kf6a2		311	Fumarate reductase {Escherichia coli [TaxId: 562]}	94.6
d1m6ia1		213	Apoptosis-inducing factor (AIF) {Human (Homo sapie	94.57
d3coxa1		370	Cholesterol oxidase of GMC family {Brevibacterium	93.41
d1b5qa1		347	Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	92.96
d1w4xa1		298	Phenylacetone monooxygenase {Thermobifida fusca [T	92.8
d2gv8a1		335	Flavin-dependent monoxygenase SPBP16F5.08c {Schizo	92.72
d1n4wa1		367	Cholesterol oxidase of GMC family {Streptomyces sp	92.08
d1ps9a2		162	2,4-dienoyl-CoA reductase, C-terminal domain {Esch	92.02
d1fl2a2		126	Alkyl hydroperoxide reductase subunit F (AhpF), C-	91.94
d2f5va1		379	Pyranose 2-oxidase {White-rot fungus (Peniophora s	91.92
d1trba2		126	Thioredoxin reductase {Escherichia coli [TaxId: 56	91.44
d1nhpa1		198	NADH peroxidase {Enterococcus faecalis [TaxId: 135	91.19
d1xhca1		167	NADH oxidase /nitrite reductase {Pyrococcus furios	90.51
d2cula1		230	GidA-related protein TTHA1897 {Thermus thermophilu	87.84
d1d7ya1		183	NADH-dependent ferredoxin reductase, BphA4 {Pseudo	87.54
d1djqa2		156	Trimethylamine dehydrogenase, C-terminal domain {M	87.43
d1neka2		330	Succinate dehydogenase {Escherichia coli [TaxId: 5	86.33
d2iida2		113	L-aminoacid oxidase {Malayan pit viper (Calloselas	85.29
d1vdca2		130	Thioredoxin reductase {Mouse-ear cress (Arabidopsi	84.87
d1kdga1		360	Flavoprotein domain of flavocytochrome cellobiose	83.75
d1chua2		305	L-aspartate oxidase {Escherichia coli [TaxId: 562]	83.57

>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GDI-like N domain
domain: Guanine nucleotide dissociation inhibitor, GDI
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.82  E-value=9.7e-09  Score=82.21  Aligned_cols=86  Identities=17%  Similarity=0.144  Sum_probs=64.5

Q ss_pred             CccccHHHHHHHHHHHH---hccCCceeEEeCCCCcchhHHHHHHHHHhCCcEEEcCceeeEEEeccCCCCcceEEEEEE
Q 025358           14 CDNISARCMLTIFALFA---TKTEASLLRMLKGSPDVYLSGPIRKYITDKGGRFHLRWGCREILYDKAANAETYVKGLAM   90 (254)
Q Consensus        14 ~~~~SA~~~~~~l~~~~---~~~~~~~~g~~~g~~~~~l~~~l~~~l~~~Gg~i~~~~~V~~i~~~~~~~g~~~v~gv~l   90 (254)
                      ..+.++...+..+..+.   .......+.++.|+.+ .++++|.+.++++||+|++|++|++|..+++ ++  ++.+|+.
T Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gG~~-~l~~~l~~~~~~~G~~i~~~~~V~~I~~~~~-~~--~v~~v~~  276 (297)
T d2bcgg1         201 YLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLG-ELPQGFARLSAIYGGTYMLDTPIDEVLYKKD-TG--KFEGVKT  276 (297)
T ss_dssp             GGGSBHHHHHHHHHHHHHHHHHHSSCSEEEETTCTT-HHHHHHHHHHHHTTCEEECSCCCCEEEEETT-TT--EEEEEEE
T ss_pred             ccchhhhhhhhhhhhhhhcccccccCcceeccCcHH-HHHHHHHHHHHhcCCEEEeCCEeeEEEEECC-CC--EEEEEEc
Confidence            44456655444444322   1222335778999986 5899999999999999999999999998764 35  7888764


Q ss_pred             eecCCCeEEEcCEEEEc
Q 025358           91 SKATDKKVVQADAYVAA  107 (254)
Q Consensus        91 ~~~~~g~~~~aD~VV~a  107 (254)
                          +|++++||+||++
T Consensus       277 ----~g~~~~ad~VI~~  289 (297)
T d2bcgg1         277 ----KLGTFKAPLVIAD  289 (297)
T ss_dssp             ----TTEEEECSCEEEC
T ss_pred             ----CCEEEECCEEEEC
Confidence                8999999999998

PyMOL of d2bcgg1

>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]}	Back information, alignment and structure

>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}	Back information, alignment and structure

>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]}	Back information, alignment and structure

>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}	Back information, alignment and structure

>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}	Back information, alignment and structure

>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]}	Back information, alignment and structure

>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}	Back information, alignment and structure

>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}	Back information, alignment and structure

>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}	Back information, alignment and structure

>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]}	Back information, alignment and structure

>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}	Back information, alignment and structure

>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}	Back information, alignment and structure

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]}	Back information, alignment and structure

>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}	Back information, alignment and structure

>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}	Back information, alignment and structure

>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]}	Back information, alignment and structure

>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure